F355352

General Info

Members Datasets Scaffolds Average Seq Length
243 177 236 183

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000704|Ga0070667_10000070417
Length 201
Sequence MTAAHASSVPSAWVRRWSHLVANGATVLDVACGSGRHVRWFAQRGARVTGVDRDAAALAPLANAAEIVVADIEAGPWPFANRRFDAVVVTNYLWRERLPDVIASVAPGGVLIYETFAAGNEGVGKPSNPKFLLRPGELLQAAAGLRVVAFEDGFEPDPPRFVQRIVAFRDDPSQTPVPRCFVLVPGDSPGQVKSSDSEDPA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
3 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
4 2738541337 Pelomonas sp. BT06 Isolate Unclassified
5 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
6 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
7 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
8 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
9 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
89 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
102 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
105 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
106 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
114 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
121 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
122 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
135 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
136 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
150 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
151 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
152 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
153 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
154 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
161 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
162 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
163 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
166 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
167 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
171 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
172 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
175 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
176 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
177 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 40.33
Nodule 0.82
Rhizoplane 1.23
Rhizosphere 41.98
Stem 0
Stem Tuber 0
Unclassified 15.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000079 3300002704 Bacteria 56287
2 JGI25156J39149_1000125 3300002705 Bacteria 56308
3 JGI25154J39366_1000141 3300002738 Bacteria 56305
4 JGI25157J39369_1000159 3300002741 Bacteria 56308
5 JGI25159J45721_1003507 3300002987 Bacteria 5532
6 JGI25151J46595_10011650 3300003187 Bacteria 4035
7 JGI25151J46595_10031014 3300003187 Bacteria 2093
8 rootH1_10048676 3300003316 Bacteria 3523
9 rootL2_10085097 3300003322 Bacteria 3824
10 rootL2_10110321 3300003322 Bacteria 1114
11 rootH1_10106618 3300003323 Bacteria 1462
12 Ga0055526_1001094 3300003771 Bacteria 19717
13 Ga0055537_1000490 3300003773 Bacteria 24227
14 Ga0055537_1004715 3300003773 Bacteria 3830
15 Ga0055537_1008736 3300003773 Bacteria 2306
16 Ga0055524_1000006 3300003775 Bacteria 324702
17 Ga0055536_1001210 3300003781 Bacteria 16014
18 Ga0055534_1000042 3300003784 Bacteria 99433
19 Ga0055534_1001178 3300003784 Bacteria 10992
20 Ga0055534_1001497 3300003784 Bacteria 9239
21 Ga0055534_1032839 3300003784 Bacteria 792
22 Ga0055528_1000242 3300003790 Bacteria 45905
23 Ga0055528_1000374 3300003790 Bacteria 36367
24 Ga0055530_10000346 3300003791 Bacteria 41934
25 Ga0055530_10019866 3300003791 Bacteria 2024
26 Ga0055540_1000005 3300003792 Bacteria 378126
27 Ga0055540_1048004 3300003792 Bacteria 891
28 Ga0055531_10000314 3300003794 Bacteria 47668
29 Ga0055531_10000705 3300003794 Bacteria 28429
30 Ga0065165_1013863 3300005262 Bacteria 3169
31 Ga0065165_1030577 3300005262 Bacteria 1711
32 Ga0065704_10171981 3300005289 Bacteria 1286
33 Ga0068868_100383146 3300005338 Bacteria 1210
34 Ga0070671_100866410 3300005355 Bacteria 788
35 Ga0070673_100345761 3300005364 Bacteria 1319
36 Ga0070667_100000704 3300005367 Bacteria 32289
37 Ga0070667_100155700 3300005367 Bacteria 2010
38 Ga0070667_100389571 3300005367 Bacteria 1267
39 Ga0070685_10143018 3300005466 Bacteria 1508
40 Ga0070665_100672867 3300005548 Bacteria 1048
41 Ga0068852_100582261 3300005616 Bacteria 1122
42 Ga0068859_100019868 3300005617 Bacteria 6744
43 Ga0068859_100675738 3300005617 Bacteria 1124
44 Ga0068864_100042407 3300005618 Bacteria 3894
45 Ga0068851_10277798 3300005834 Bacteria 957
46 Ga0068863_100172358 3300005841 Bacteria 2076
47 Ga0075368_10028304 3300006042 Bacteria 2165
48 Ga0075363_100108139 3300006048 Bacteria 1544
49 Ga0075362_10025368 3300006177 Bacteria 2523
50 Ga0075362_10037159 3300006177 Bacteria 2133
51 Ga0075362_10106428 3300006177 Bacteria 1316
52 Ga0075367_10209526 3300006178 Bacteria 1218
53 Ga0075366_10003846 3300006195 Bacteria 7997
54 Ga0075366_10162008 3300006195 Bacteria 1355
55 Ga0075366_10331611 3300006195 Bacteria 933
56 Ga0097621_100239689 3300006237 Bacteria 1585
57 Ga0075370_10000415 3300006353 Bacteria 15744
58 Ga0075370_10002974 3300006353 Bacteria 7966
59 Ga0075370_10129910 3300006353 Bacteria 1470
60 Ga0097620_100019867 3300006931 Bacteria 6744
61 Ga0097620_100675642 3300006931 Bacteria 1124
62 Ga0099826_10061797 3300006948 Bacteria 2431
63 Ga0111539_11745905 3300009094 Bacteria 722
64 Ga0105246_10114987 3300011119 Bacteria 1983
65 Ga0163162_11472970 3300013306 Bacteria 775
66 Ga0163162_11482923 3300013306 Bacteria 772
67 Ga0157375_10566540 3300013308 Bacteria 1297
68 Ga0163163_10469464 3300014325 Bacteria 1319
69 Ga0182008_10174730 3300014497 Bacteria 1085
70 Ga0157379_10100198 3300014968 Bacteria 2600
71 Ga0209435_100001 3300025206 Bacteria 1424171
72 Ga0207425_1000863 3300025245 Bacteria 14839
73 Ga0207425_1002398 3300025245 Bacteria 6625
74 Ga0209646_1000001 3300025246 Bacteria 3092932
75 Ga0209026_1000003 3300025250 Bacteria 1060571
76 Ga0209759_1000001 3300025256 Bacteria 2799452
77 Ga0209565_1000083 3300025263 Bacteria 154007
78 Ga0209565_1000124 3300025263 Bacteria 110789
79 Ga0209565_1000498 3300025263 Bacteria 28727
80 Ga0209673_1000043 3300025273 Bacteria 291503
81 Ga0209673_1000534 3300025273 Bacteria 62274
82 Ga0209130_1000620 3300025284 Bacteria 33992
83 Ga0209675_1000081 3300025291 Bacteria 154007
84 Ga0209675_1000309 3300025291 Bacteria 44113
85 Ga0209675_1007688 3300025291 Bacteria 4083
86 Ga0209675_1015228 3300025291 Bacteria 2296
87 Ga0209675_1030715 3300025291 Bacteria 1278
88 Ga0209676_1000007 3300025292 Bacteria 1029371
89 Ga0209676_1009837 3300025292 Bacteria 4067
90 Ga0209025_1002427 3300025294 Bacteria 19781
91 Ga0209025_1007365 3300025294 Bacteria 8232
92 Ga0209025_1019391 3300025294 Bacteria 3784
93 Ga0209025_1025773 3300025294 Bacteria 2978
94 Ga0209564_1000268 3300025295 Bacteria 109101
95 Ga0209564_1003314 3300025295 Bacteria 11188
96 Ga0209758_1004677 3300025297 Bacteria 11192
97 Ga0209758_1079633 3300025297 Bacteria 996
98 Ga0209050_1000003 3300025298 Bacteria 1609245
99 Ga0209050_1001494 3300025298 Bacteria 24797
100 Ga0209050_1056160 3300025298 Bacteria 960
101 Ga0209256_1000001 3300025299 Bacteria 2166974
102 Ga0209256_1031560 3300025299 Bacteria 1447
103 Ga0207426_1002558 3300025302 Bacteria 11384
104 Ga0209051_1000003 3300025303 Bacteria 1609245
105 Ga0209051_1023851 3300025303 Bacteria 2533
106 Ga0209051_1092260 3300025303 Bacteria 839
107 Ga0209257_1000017 3300025304 Bacteria 866287
108 Ga0209257_1000020 3300025304 Bacteria 773356
109 Ga0209257_1017645 3300025304 Bacteria 2798
110 Ga0207687_10172787 3300025927 Bacteria 1668
111 Ga0207687_10187361 3300025927 Bacteria 1608
112 Ga0207644_10493482 3300025931 Bacteria 1009
113 Ga0207658_10000319 3300025986 Bacteria 48401
114 Ga0207658_10413662 3300025986 Bacteria 1188
115 Ga0207677_10126370 3300026023 Bacteria 1933
116 Ga0207641_10025448 3300026088 Bacteria 4880
117 Ga0207676_10208074 3300026095 Bacteria 1733
118 Ga0209282_1023309 3300027666 Bacteria 3893
119 Ga0209998_10003658 3300027717 Bacteria 3336
120 Ga0209813_10004852 3300027866 Bacteria 3233
121 Ga0209974_10011080 3300027876 Bacteria 3036
122 Ga0268266_10376735 3300028379 Bacteria 1338
123 Ga0268264_10201944 3300028381 Bacteria 1819
124 Ga0307515_10143815 3300028794 Bacteria 2540
125 Ga0307515_10211276 3300028794 Bacteria 1784
126 Ga0307515_10275137 3300028794 Bacteria 1399
127 Ga0307512_10074569 3300030522 Bacteria 2490
128 Ga0265330_10195165 3300031235 Bacteria 856
129 Ga0307513_10039345 3300031456 Bacteria 5242
130 Ga0307513_10125808 3300031456 Bacteria 2519
131 Ga0307513_10177128 3300031456 Bacteria 2001
132 Ga0307509_10000041 3300031507 Bacteria 182302
133 Ga0307509_10181610 3300031507 Bacteria 1968
134 Ga0307408_100008657 3300031548 Bacteria 6720
135 Ga0307508_10580378 3300031616 Bacteria 721
136 Ga0307514_10102061 3300031649 Bacteria 2057
137 Ga0265314_10002818 3300031711 Bacteria 17343
138 Ga0265342_10085846 3300031712 Bacteria 1810
139 Ga0307405_10089794 3300031731 Bacteria 2031
140 Ga0307405_10826804 3300031731 Bacteria 778
141 Ga0307406_10401587 3300031901 Bacteria 1086
142 Ga0307409_100672868 3300031995 Bacteria 1031
143 Ga0307414_10009103 3300032004 Bacteria 5686
144 Ga0307411_10000263 3300032005 Bacteria 17179
145 Ga0307510_10052365 3300033180 Bacteria 4304
146 Ga0307510_10323517 3300033180 Bacteria 998
147 Ga0373948_0042108 3300034817 Bacteria 958
148 Ga0373959_0012295 3300034820 Bacteria 1526
149 Ga0373940_0010689 3300035088 Bacteria 2165
150 Ga0373949_0055555 3300035090 Bacteria 1007
151 Ga0373951_0043719 3300035091 Bacteria 1086
152 Ga0373939_0000017 3300035114 Bacteria 61924
153 Ga0373961_0018880 3300035241 Bacteria 1805
154 Ga0373931_0011317 3300035691 Bacteria 4308
155 Ga0373925_0044453 3300037068 Bacteria 3298
156 Ga0395905_0748372 3300037471 Bacteria 880
157 Ga0439439_0031322 3300041406 Bacteria 1355
158 Ga0439466_0010309 3300041411 Bacteria 3474
159 Ga0439465_0010653 3300041413 Bacteria 2885
160 Ga0451853_0914069 3300041512 Bacteria 919
161 Ga0439431_0001255 3300041997 Bacteria 5559
162 Ga0439433_0000519 3300041999 Bacteria 7235
163 Ga0439445_0001045 3300042004 Bacteria 5910
164 Ga0439445_0014839 3300042004 Bacteria 1902
165 Ga0439432_006319 3300042006 Bacteria 4237
166 Ga0439449_0000720 3300042007 Bacteria 12664
167 Ga0439462_0010252 3300042015 Bacteria 2373
168 Ga0450911_000542 3300042115 Bacteria 11763
169 Ga0450890_006747 3300042127 Bacteria 1466
170 Ga0439446_0013357 3300042156 Bacteria 2253
171 Ga0439434_0001219 3300042435 Bacteria 7405
172 Ga0451576_0383728 3300045051 Bacteria 1473
173 Ga0495592_0000028 3300046454 Bacteria 132590
174 Ga0495592_0744116 3300046454 Bacteria 586
175 Ga0495638_0071908 3300046460 Bacteria 2115
176 Ga0495608_0317020 3300046511 Bacteria 964
177 Ga0495610_0049584 3300046512 Bacteria 2055
178 Ga0495637_0004867 3300046520 Bacteria 6907
179 Ga0495625_0000637 3300046660 Bacteria 50416
180 Ga0495625_0191649 3300046660 Bacteria 1354
181 Ga0495588_0005864 3300046674 Bacteria 5500
182 Ga0495646_0140778 3300046680 Bacteria 1349
183 Ga0495671_0008248 3300046692 Bacteria 5872
184 Ga0495660_0074307 3300046810 Bacteria 1796
185 Ga0495673_0095621 3300047469 Bacteria 1208
186 Ga0495686_0003083 3300047472 Bacteria 14729
187 Ga0495686_0141096 3300047472 Bacteria 1422
188 Ga0496100_0557173 3300048903 Bacteria 887
189 Ga0496106_1196862 3300048909 Bacteria 593
190 Ga0496113_0648823 3300048916 Bacteria 844
191 Ga0496117_0072694 3300048920 Bacteria 2297
192 Ga0496121_0043732 3300048924 Bacteria 3874
193 Ga0496123_0063216 3300048926 Bacteria 2367
194 Ga0496124_0000161 3300048927 Bacteria 136651
195 Ga0496125_0024016 3300048928 Bacteria 5615
196 Ga0496125_0025298 3300048928 Bacteria 5439
197 Ga0496125_0054610 3300048928 Bacteria 3262
198 Ga0496125_0056043 3300048928 Bacteria 3204
199 Ga0496126_0387161 3300048929 Bacteria 1137
200 Ga0495682_0224838 3300049460 Bacteria 665
201 Ga0501031_0001649 3300049568 Bacteria 14009
202 Ga0501222_004828 3300049662 Bacteria 1832
203 Ga0501223_015026 3300049663 Bacteria 1535
204 Ga0501249_036288 3300049679 Bacteria 1110
205 Ga0501262_000697 3300049759 Bacteria 3892
206 Ga0501263_023168 3300049760 Bacteria 845
207 Ga0501267_001020 3300049764 Bacteria 2319
208 Ga0501035_0292300 3300049822 Bacteria 1375
209 nmdc:mga0k408_271521_c1 3300050493 Bacteria 1012
210 nmdc:mga0k408_47201_c1 3300050493 Bacteria 2489
211 nmdc:mga06z11_158529_c1 3300050494 Bacteria 1292
212 nmdc:mga04h51_9283_c1 3300050495 Bacteria 2659
213 nmdc:mga07m45_350_c1 3300050496 Bacteria 18847
214 nmdc:mga07m45_663455_c1 3300050496 Bacteria 601
215 nmdc:mga07m45_7137_c1 3300050496 Bacteria 5690
216 nmdc:mga09592_5234_c1 3300050508 Bacteria 10546
217 Ga0500610_0046782 3300053079 Bacteria 2247
218 Ga0500644_0026940 3300053088 Bacteria 1783
219 Ga0500644_0035535 3300053088 Bacteria 1615
220 Ga0500651_0003954 3300053093 Bacteria 8220
221 Ga0500566_0180715 3300053094 Bacteria 1082
222 Ga0500593_000729 3300053117 Bacteria 12456
223 Ga0500594_0003862 3300053118 Bacteria 3299
224 Ga0500607_124494 3300053121 Bacteria 1241
225 Ga0500618_021844 3300053125 Bacteria 1560
226 Ga0500559_0000141 3300053136 Bacteria 56026
227 Ga0500559_0030841 3300053136 Bacteria 2299
228 Ga0500559_0128663 3300053136 Bacteria 1182
229 Ga0500564_227880 3300053138 Bacteria 750
230 Ga0500568_0130796 3300053139 Bacteria 933
231 Ga0500586_012793 3300053145 Bacteria 2451
232 Ga0500616_0065823 3300053153 Bacteria 1863
233 Ga0500619_007960 3300053154 Bacteria 2546
234 Ga0500622_0001173 3300053156 Bacteria 21675
235 Ga0500645_015083 3300053730 Bacteria 2453
236 Ga0500587_004820 3300053739 Bacteria 1840

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053739 Ga0500587_004820 Ga0500587_004820_1360_1812 146
2 3300003791 Ga0055530_10019866 Ga0055530_100198662 162
3 3300003792 Ga0055540_1048004 Ga0055540_10480042 162
4 3300003794 Ga0055531_10000314 Ga0055531_1000031443 162
5 3300025298 Ga0209050_1001494 Ga0209050_10014947 162
6 3300025303 Ga0209051_1023851 Ga0209051_10238513 162
7 3300025304 Ga0209257_1000017 Ga0209257_1000017530 162
8 3300048909 Ga0496106_1196862 Ga0496106_1196862_84_572 162
9 3300048916 Ga0496113_0648823 Ga0496113_0648823_344_832 162
10 iso_pu_bacteria 2643221639 2644221655 162
11 3300047472 Ga0495686_0141096 Ga0495686_0141096_12_515 163
12 3300049822 Ga0501035_0292300 Ga0501035_0292300_856_1365 163
13 iso_pu_bacteria 2643221646 2644257580 163
14 iso_pu_bacteria 2738541337 2739058566 163
15 iso_pu_bacteria 2885192300 2885196189 163
16 3300003316 rootH1_10048676 rootH1_100486765 164
17 3300003322 rootL2_10085097 rootL2_100850974 164
18 3300028794 Ga0307515_10275137 Ga0307515_102751372 164
19 3300002987 JGI25159J45721_1003507 JGI25159J45721_10035073 165
20 3300003773 Ga0055537_1004715 Ga0055537_10047152 165
21 3300003322 rootL2_10110321 rootL2_101103212 166
22 3300003323 rootH1_10106618 rootH1_101066182 166
23 3300005616 Ga0068852_100582261 Ga0068852_1005822612 166
24 3300025299 Ga0209256_1031560 Ga0209256_10315603 166
25 3300031995 Ga0307409_100672868 Ga0307409_1006728682 166
26 3300032004 Ga0307414_10009103 Ga0307414_100091037 166
27 3300032005 Ga0307411_10000263 Ga0307411_100002633 166
28 3300049662 Ga0501222_004828 Ga0501222_004828_149_655 166
29 3300049663 Ga0501223_015026 Ga0501223_015026_594_1100 166
30 3300049679 Ga0501249_036288 Ga0501249_036288_475_981 166
31 3300049764 Ga0501267_001020 Ga0501267_001020_753_1259 166
32 3300006353 Ga0075370_10129910 Ga0075370_101299102 167
33 3300034817 Ga0373948_0042108 Ga0373948_0042108_13_534 167
34 3300034820 Ga0373959_0012295 Ga0373959_0012295_828_1349 167
35 3300035088 Ga0373940_0010689 Ga0373940_0010689_301_822 167
36 3300035090 Ga0373949_0055555 Ga0373949_0055555_329_850 167
37 3300035091 Ga0373951_0043719 Ga0373951_0043719_427_948 167
38 3300035114 Ga0373939_0000017 Ga0373939_0000017_25493_26014 167
39 3300035241 Ga0373961_0018880 Ga0373961_0018880_360_881 167
40 3300035691 Ga0373931_0011317 Ga0373931_0011317_199_720 167
41 3300041406 Ga0439439_0031322 Ga0439439_0031322_719_1222 167
42 3300041411 Ga0439466_0010309 Ga0439466_0010309_1868_2371 167
43 3300041413 Ga0439465_0010653 Ga0439465_0010653_1660_2163 167
44 3300041997 Ga0439431_0001255 Ga0439431_0001255_1924_2427 167
45 3300041999 Ga0439433_0000519 Ga0439433_0000519_6400_6903 167
46 3300042004 Ga0439445_0001045 Ga0439445_0001045_410_913 167
47 3300042006 Ga0439432_006319 Ga0439432_006319_2679_3182 167
48 3300042007 Ga0439449_0000720 Ga0439449_0000720_9394_9897 167
49 3300042015 Ga0439462_0010252 Ga0439462_0010252_699_1202 167
50 3300042156 Ga0439446_0013357 Ga0439446_0013357_300_803 167
51 3300042435 Ga0439434_0001219 Ga0439434_0001219_2425_2928 167
52 3300037471 Ga0395905_0748372 Ga0395905_0748372_287_796 169
53 3300046454 Ga0495592_0744116 Ga0495592_0744116_40_564 170
54 3300053118 Ga0500594_0003862 Ga0500594_0003862_23_547 170
55 3300053136 Ga0500559_0030841 Ga0500559_0030841_123_653 170
56 3300053138 Ga0500564_227880 Ga0500564_227880_196_723 170
57 3300042004 Ga0439445_0014839 Ga0439445_0014839_1269_1787 172
58 3300042115 Ga0450911_000542 Ga0450911_000542_3125_3643 172
59 3300048928 Ga0496125_0024016 Ga0496125_0024016_1632_2150 172
60 3300048928 Ga0496125_0056043 Ga0496125_0056043_496_1014 172
61 3300047472 Ga0495686_0003083 Ga0495686_0003083_8450_9001 175
62 3300048929 Ga0496126_0387161 Ga0496126_0387161_184_795 175
63 3300006177 Ga0075362_10106428 Ga0075362_101064282 176
64 3300006178 Ga0075367_10209526 Ga0075367_102095262 176
65 3300006353 Ga0075370_10000415 Ga0075370_100004152 176
66 3300009094 Ga0111539_11745905 Ga0111539_117459051 176
67 3300048927 Ga0496124_0000161 Ga0496124_0000161_3194_3742 176
68 3300048928 Ga0496125_0025298 Ga0496125_0025298_2009_2557 176
69 3300050493 nmdc:mga0k408_47201_c1 nmdc:mga0k408_47201_c1_1017_1547 176
70 3300050494 nmdc:mga06z11_158529_c1 nmdc:mga06z11_158529_c1_116_646 176
71 3300050496 nmdc:mga07m45_350_c1 nmdc:mga07m45_350_c1_14951_15481 176
72 3300027717 Ga0209998_10003658 Ga0209998_100036584 177
73 3300027876 Ga0209974_10011080 Ga0209974_100110803 177
74 3300050508 nmdc:mga09592_5234_c1 nmdc:mga09592_5234_c1_6001_6543 177
75 3300005338 Ga0068868_100383146 Ga0068868_1003831462 178
76 3300005355 Ga0070671_100866410 Ga0070671_1008664101 178
77 3300005364 Ga0070673_100345761 Ga0070673_1003457612 178
78 3300005367 Ga0070667_100155700 Ga0070667_1001557002 178
79 3300005367 Ga0070667_100389571 Ga0070667_1003895712 178
80 3300005466 Ga0070685_10143018 Ga0070685_101430181 178
81 3300005617 Ga0068859_100019868 Ga0068859_1000198687 178
82 3300005618 Ga0068864_100042407 Ga0068864_1000424075 178
83 3300005841 Ga0068863_100172358 Ga0068863_1001723582 178
84 3300006237 Ga0097621_100239689 Ga0097621_1002396892 178
85 3300006931 Ga0097620_100019867 Ga0097620_1000198677 178
86 3300011119 Ga0105246_10114987 Ga0105246_101149872 178
87 3300013306 Ga0163162_11482923 Ga0163162_114829231 178
88 3300014325 Ga0163163_10469464 Ga0163163_104694642 178
89 3300014968 Ga0157379_10100198 Ga0157379_101001983 178
90 3300025927 Ga0207687_10187361 Ga0207687_101873612 178
91 3300025931 Ga0207644_10493482 Ga0207644_104934822 178
92 3300025986 Ga0207658_10413662 Ga0207658_104136622 178
93 3300026023 Ga0207677_10126370 Ga0207677_101263702 178
94 3300026088 Ga0207641_10025448 Ga0207641_100254486 178
95 3300026095 Ga0207676_10208074 Ga0207676_102080742 178
96 3300028381 Ga0268264_10201944 Ga0268264_102019442 178
97 3300030522 Ga0307512_10074569 Ga0307512_100745692 178
98 3300031507 Ga0307509_10000041 Ga0307509_10000041119 178
99 3300031507 Ga0307509_10181610 Ga0307509_101816102 178
100 3300031616 Ga0307508_10580378 Ga0307508_105803782 178
101 3300031649 Ga0307514_10102061 Ga0307514_101020612 178
102 3300033180 Ga0307510_10052365 Ga0307510_100523652 178
103 3300033180 Ga0307510_10323517 Ga0307510_103235172 178
104 3300046454 Ga0495592_0000028 Ga0495592_0000028_109689_110246 178
105 3300046460 Ga0495638_0071908 Ga0495638_0071908_214_768 178
106 3300046511 Ga0495608_0317020 Ga0495608_0317020_276_833 178
107 3300046512 Ga0495610_0049584 Ga0495610_0049584_698_1252 178
108 3300046680 Ga0495646_0140778 Ga0495646_0140778_425_982 178
109 3300047469 Ga0495673_0095621 Ga0495673_0095621_513_1067 178
110 3300049460 Ga0495682_0224838 Ga0495682_0224838_79_636 178
111 3300053088 Ga0500644_0035535 Ga0500644_0035535_981_1535 178
112 3300053093 Ga0500651_0003954 Ga0500651_0003954_486_1040 178
113 3300053121 Ga0500607_124494 Ga0500607_124494_125_682 178
114 3300053125 Ga0500618_021844 Ga0500618_021844_667_1221 178
115 3300053136 Ga0500559_0000141 Ga0500559_0000141_8886_9440 178
116 3300053136 Ga0500559_0128663 Ga0500559_0128663_334_891 178
117 3300053139 Ga0500568_0130796 Ga0500568_0130796_162_716 178
118 3300053154 Ga0500619_007960 Ga0500619_007960_735_1292 178
119 3300053156 Ga0500622_0001173 Ga0500622_0001173_2088_2642 178
120 3300006042 Ga0075368_10028304 Ga0075368_100283044 179
121 3300027866 Ga0209813_10004852 Ga0209813_100048526 179
122 3300031235 Ga0265330_10195165 Ga0265330_101951652 179
123 3300031711 Ga0265314_10002818 Ga0265314_1000281819 179
124 3300031712 Ga0265342_10085846 Ga0265342_100858462 179
125 3300045051 Ga0451576_0383728 Ga0451576_0383728_654_1196 179
126 3300050495 nmdc:mga04h51_9283_c1 nmdc:mga04h51_9283_c1_89_640 179
127 3300013306 Ga0163162_11472970 Ga0163162_114729702 180
128 3300005367 Ga0070667_100000704 Ga0070667_10000070417 181
129 3300005548 Ga0070665_100672867 Ga0070665_1006728672 181
130 3300005617 Ga0068859_100675738 Ga0068859_1006757382 181
131 3300006195 Ga0075366_10003846 Ga0075366_100038462 181
132 3300006195 Ga0075366_10331611 Ga0075366_103316113 181
133 3300006931 Ga0097620_100675642 Ga0097620_1006756422 181
134 3300013308 Ga0157375_10566540 Ga0157375_105665402 181
135 3300014497 Ga0182008_10174730 Ga0182008_101747302 181
136 3300025927 Ga0207687_10172787 Ga0207687_101727872 181
137 3300025986 Ga0207658_10000319 Ga0207658_1000031932 181
138 3300028379 Ga0268266_10376735 Ga0268266_103767352 181
139 3300028794 Ga0307515_10211276 Ga0307515_102112762 181
140 3300031456 Ga0307513_10039345 Ga0307513_100393453 181
141 3300037068 Ga0373925_0044453 Ga0373925_0044453_2421_3026 181
142 3300046660 Ga0495625_0191649 Ga0495625_0191649_350_904 181
143 3300049568 Ga0501031_0001649 Ga0501031_0001649_5209_5760 181
144 3300050493 nmdc:mga0k408_271521_c1 nmdc:mga0k408_271521_c1_362_913 181
145 3300003773 Ga0055537_1000490 Ga0055537_10004905 182
146 3300003784 Ga0055534_1000042 Ga0055534_100004292 182
147 3300003790 Ga0055528_1000242 Ga0055528_100024247 182
148 3300006177 Ga0075362_10025368 Ga0075362_100253684 182
149 3300006353 Ga0075370_10002974 Ga0075370_100029747 182
150 3300006948 Ga0099826_10061797 Ga0099826_100617972 182
151 3300025263 Ga0209565_1000083 Ga0209565_100008393 182
152 3300025273 Ga0209673_1000534 Ga0209673_100053454 182
153 3300025291 Ga0209675_1000081 Ga0209675_100008193 182
154 3300025291 Ga0209675_1015228 Ga0209675_10152283 182
155 3300025294 Ga0209025_1007365 Ga0209025_10073655 182
156 3300027666 Ga0209282_1023309 Ga0209282_10233093 182
157 3300042127 Ga0450890_006747 Ga0450890_006747_482_1051 182
158 3300046520 Ga0495637_0004867 Ga0495637_0004867_1463_2032 182
159 3300046660 Ga0495625_0000637 Ga0495625_0000637_44089_44658 182
160 3300046674 Ga0495588_0005864 Ga0495588_0005864_3104_3673 182
161 3300046692 Ga0495671_0008248 Ga0495671_0008248_2457_3026 182
162 3300046810 Ga0495660_0074307 Ga0495660_0074307_1073_1642 182
163 3300048903 Ga0496100_0557173 Ga0496100_0557173_242_796 182
164 3300048920 Ga0496117_0072694 Ga0496117_0072694_45_614 182
165 3300048926 Ga0496123_0063216 Ga0496123_0063216_1306_1875 182
166 3300049759 Ga0501262_000697 Ga0501262_000697_3223_3792 182
167 3300049760 Ga0501263_023168 Ga0501263_023168_135_704 182
168 3300050496 nmdc:mga07m45_7137_c1 nmdc:mga07m45_7137_c1_1799_2368 182
169 3300053079 Ga0500610_0046782 Ga0500610_0046782_1581_2150 182
170 iso_pu_bacteria 2919462493 2919464040 182
171 iso_pu_bacteria 2945945610 2945946852 182
172 3300031456 Ga0307513_10177128 Ga0307513_101771283 183
173 3300048924 Ga0496121_0043732 Ga0496121_0043732_2786_3352 183
174 3300053145 Ga0500586_012793 Ga0500586_012793_130_720 183
175 3300053153 Ga0500616_0065823 Ga0500616_0065823_781_1371 183
176 3300005289 Ga0065704_10171981 Ga0065704_101719813 184
177 3300028794 Ga0307515_10143815 Ga0307515_101438153 184
178 3300031456 Ga0307513_10125808 Ga0307513_101258084 184
179 3300048928 Ga0496125_0054610 Ga0496125_0054610_61_690 184
180 3300053088 Ga0500644_0026940 Ga0500644_0026940_657_1241 184
181 3300003187 JGI25151J46595_10031014 JGI25151J46595_100310142 185
182 3300003773 Ga0055537_1008736 Ga0055537_10087362 185
183 3300003784 Ga0055534_1032839 Ga0055534_10328392 185
184 3300005262 Ga0065165_1013863 Ga0065165_10138634 185
185 3300005834 Ga0068851_10277798 Ga0068851_102777981 185
186 3300006048 Ga0075363_100108139 Ga0075363_1001081392 185
187 3300006177 Ga0075362_10037159 Ga0075362_100371594 185
188 3300006195 Ga0075366_10162008 Ga0075366_101620082 185
189 3300025245 Ga0207425_1000863 Ga0207425_10008637 185
190 3300025263 Ga0209565_1000498 Ga0209565_100049815 185
191 3300025291 Ga0209675_1007688 Ga0209675_10076884 185
192 3300025292 Ga0209676_1009837 Ga0209676_10098373 185
193 3300025294 Ga0209025_1025773 Ga0209025_10257734 185
194 3300025297 Ga0209758_1004677 Ga0209758_10046778 185
195 3300025298 Ga0209050_1056160 Ga0209050_10561601 185
196 3300025303 Ga0209051_1092260 Ga0209051_10922602 185
197 3300025304 Ga0209257_1017645 Ga0209257_10176452 185
198 3300031731 Ga0307405_10089794 Ga0307405_100897943 185
199 3300050496 nmdc:mga07m45_663455_c1 nmdc:mga07m45_663455_c1_20_577 185
200 3300053730 Ga0500645_015083 Ga0500645_015083_1312_1878 188
201 3300002704 JGI25155J39150_1000079 JGI25155J39150_100007927 189
202 3300002705 JGI25156J39149_1000125 JGI25156J39149_100012527 189
203 3300002738 JGI25154J39366_1000141 JGI25154J39366_100014127 189
204 3300002741 JGI25157J39369_1000159 JGI25157J39369_100015927 189
205 3300003187 JGI25151J46595_10011650 JGI25151J46595_100116501 189
206 3300003771 Ga0055526_1001094 Ga0055526_10010945 189
207 3300003775 Ga0055524_1000006 Ga0055524_100000682 189
208 3300003781 Ga0055536_1001210 Ga0055536_10012105 189
209 3300003784 Ga0055534_1001178 Ga0055534_100117813 189
210 3300003784 Ga0055534_1001497 Ga0055534_10014972 189
211 3300003790 Ga0055528_1000374 Ga0055528_100037413 189
212 3300003791 Ga0055530_10000346 Ga0055530_1000034628 189
213 3300003792 Ga0055540_1000005 Ga0055540_1000005232 189
214 3300003794 Ga0055531_10000705 Ga0055531_100007056 189
215 3300005262 Ga0065165_1030577 Ga0065165_10305772 189
216 3300025206 Ga0209435_100001 Ga0209435_10000126 189
217 3300025245 Ga0207425_1002398 Ga0207425_10023988 189
218 3300025246 Ga0209646_1000001 Ga0209646_1000001395 189
219 3300025250 Ga0209026_1000003 Ga0209026_100000326 189
220 3300025256 Ga0209759_1000001 Ga0209759_100000126 189
221 3300025263 Ga0209565_1000124 Ga0209565_100012413 189
222 3300025273 Ga0209673_1000043 Ga0209673_1000043172 189
223 3300025284 Ga0209130_1000620 Ga0209130_100062018 189
224 3300025291 Ga0209675_1000309 Ga0209675_10003097 189
225 3300025291 Ga0209675_1030715 Ga0209675_10307152 189
226 3300025292 Ga0209676_1000007 Ga0209676_1000007467 189
227 3300025294 Ga0209025_1002427 Ga0209025_100242710 189
228 3300025294 Ga0209025_1019391 Ga0209025_10193915 189
229 3300025295 Ga0209564_1000268 Ga0209564_100026813 189
230 3300025295 Ga0209564_1003314 Ga0209564_100331412 189
231 3300025297 Ga0209758_1079633 Ga0209758_10796332 189
232 3300025298 Ga0209050_1000003 Ga0209050_10000031041 189
233 3300025299 Ga0209256_1000001 Ga0209256_10000011047 189
234 3300025302 Ga0207426_1002558 Ga0207426_10025587 189
235 3300025303 Ga0209051_1000003 Ga0209051_10000031041 189
236 3300025304 Ga0209257_1000020 Ga0209257_1000020467 189
237 3300031548 Ga0307408_100008657 Ga0307408_1000086574 189
238 3300031731 Ga0307405_10826804 Ga0307405_108268041 189
239 3300031901 Ga0307406_10401587 Ga0307406_104015871 189
240 3300041512 Ga0451853_0914069 Ga0451853_0914069_81_659 189
241 3300053094 Ga0500566_0180715 Ga0500566_0180715_75_653 189
242 3300053117 Ga0500593_000729 Ga0500593_000729_3706_4284 189
243 iso_pu_bacteria 2511231002 2511244391 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07021

MetW

Methionine biosynthesis protein MetW

13

106

0.93

PF13649

Methyltransf_25

Methyltransferase domain

27

109

0.9

PF08241

Methyltransf_11

Methyltransferase domain

28

112

0.84

PF13489

Methyltransf_23

Methyltransferase domain

3

146

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8115 5 175
3mer-assembly2.cif.gz_B crystal structure of the methyltransferase slr1183 from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr145 0.7946 6 173
2xva-assembly3.cif.gz_C crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sinefungin 0.7936 7 171
2xvm-assembly2.cif.gz_B crystal structure of the tellurite detoxification protein tehb from e. coli in complex with sah 0.7837 5 173
7fbh-assembly1.cif.gz_B-5 geranyl pyrophosphate c6-methyltransferase beza 0.7771 10 155
ID Description Score Start End Superfamily
af_Q4D7A8_87_267_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8757 6 172 3.40.50.150
af_A0A1P8AP99_122_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8698 22 62 3.40.50.150
af_Q54Y84_189_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8281 21 160 3.40.50.150
af_L7N687_2_189_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8277 7 140 3.40.50.150
af_Q4D7A8_87_267_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.808 6 172 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A4P6UMF0-F1-model_v4 Class I SAM-dependent methyltransferase 0.9588 6 173 GO:0008168
GO:0032259
AF-A0A519I1D4-F1-model_v4 deleted 0.9559 1 96
AF-A0A0Q4Y4F9-F1-model_v4 SAM-dependent methyltransferase 0.9551 6 188 GO:0008168
GO:0032259
AF-A0A1P8K3P7-F1-model_v4 SAM-dependent methyltransferase 0.9545 6 188 GO:0008168
GO:0032259
AF-A0A7Y5HY56-F1-model_v4 Class I SAM-dependent methyltransferase 0.9527 8 189 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
92.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map