F355444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 163 | 238 | 188 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100369685|Ga0068862_1003696852 |
| Length | 209 |
| Sequence | VIKLKKEFIGAYNMPFIQTPISNLLVFEPKIHEDSRGYFFESFNLQTFRAEGIDINFVQDNQSSSKYGVIRGLHYQLNPSAQVKLIRVLSGRILDVVVDIRKGSPTFGKNFSVELTAENKKQLFVPAGLAHGFSVLSEEAEVLYKCDSFYNKDSEAGILYNDPSLNIDWKIPAEKEIVSEKDKGLPLFAECRNNFIWNENKVQNTGNRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 2 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 3 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 4 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 5 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 73 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 110 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 111 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 112 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 113 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 114 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 115 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 116 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 117 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 118 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 119 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 122 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 123 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 124 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 134 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 136 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 147 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 151 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 157 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 158 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 159 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 160 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 161 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 162 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 163 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0 |
| Isolates | 2.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 0 |
| Rhizoplane | 0.41 |
| Rhizosphere | 89.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10000611 | 3300002459 | Bacteria | 9290 |
| 2 | JGI25406J46586_10004895 | 3300003203 | Bacteria | 6222 |
| 3 | rootH1_10183992 | 3300003323 | Bacteria | 1519 |
| 4 | rootH1_10207743 | 3300003323 | Bacteria | 2190 |
| 5 | Ga0065714_10046969 | 3300005288 | Bacteria | 689 |
| 6 | Ga0065704_10169157 | 3300005289 | Bacteria | 1302 |
| 7 | Ga0065712_10008503 | 3300005290 | Bacteria | 3134 |
| 8 | Ga0065712_10016228 | 3300005290 | Bacteria | 2706 |
| 9 | Ga0065715_10121072 | 3300005293 | Bacteria | 2231 |
| 10 | Ga0065707_10680682 | 3300005295 | Bacteria | 649 |
| 11 | Ga0070690_100052089 | 3300005330 | Bacteria | 2615 |
| 12 | Ga0070670_100061004 | 3300005331 | Bacteria | 3238 |
| 13 | Ga0070670_100076421 | 3300005331 | Bacteria | 2877 |
| 14 | Ga0070670_101031550 | 3300005331 | Bacteria | 749 |
| 15 | Ga0070677_10067032 | 3300005333 | Bacteria | 1498 |
| 16 | Ga0068869_100037896 | 3300005334 | Bacteria | 3431 |
| 17 | Ga0068869_100395470 | 3300005334 | Bacteria | 1135 |
| 18 | Ga0068869_100629815 | 3300005334 | Bacteria | 909 |
| 19 | Ga0070666_10144398 | 3300005335 | Unclassified | 1658 |
| 20 | Ga0070682_100000101 | 3300005337 | Bacteria | 76535 |
| 21 | Ga0070689_100096077 | 3300005340 | Bacteria | 2341 |
| 22 | Ga0070689_100241527 | 3300005340 | Unclassified | 1487 |
| 23 | Ga0070687_100058529 | 3300005343 | Bacteria | 2025 |
| 24 | Ga0070687_100208283 | 3300005343 | Unclassified | 1189 |
| 25 | Ga0070669_100046405 | 3300005353 | Bacteria | 3168 |
| 26 | Ga0070669_100047502 | 3300005353 | Bacteria | 3131 |
| 27 | Ga0070673_100056502 | 3300005364 | Bacteria | 3097 |
| 28 | Ga0070673_100101023 | 3300005364 | Bacteria | 2375 |
| 29 | Ga0070673_100473393 | 3300005364 | Bacteria | 1130 |
| 30 | Ga0070673_100555015 | 3300005364 | Bacteria | 1044 |
| 31 | Ga0070688_100024394 | 3300005365 | Bacteria | 3569 |
| 32 | Ga0070701_10071128 | 3300005438 | Bacteria | 1860 |
| 33 | Ga0070705_100460748 | 3300005440 | Unclassified | 956 |
| 34 | Ga0070694_100201949 | 3300005444 | Bacteria | 1482 |
| 35 | Ga0070678_100970388 | 3300005456 | Unclassified | 780 |
| 36 | Ga0070662_101127327 | 3300005457 | Bacteria | 673 |
| 37 | Ga0068867_100271589 | 3300005459 | Bacteria | 1386 |
| 38 | Ga0070685_10108623 | 3300005466 | Bacteria | 1705 |
| 39 | Ga0070698_100005764 | 3300005471 | Bacteria | 13543 |
| 40 | Ga0070684_100187985 | 3300005535 | Bacteria | 1879 |
| 41 | Ga0068853_100004753 | 3300005539 | Bacteria | 10558 |
| 42 | Ga0070672_100393654 | 3300005543 | Unclassified | 1187 |
| 43 | Ga0070665_100000008 | 3300005548 | Bacteria | 606341 |
| 44 | Ga0070704_100040346 | 3300005549 | Bacteria | 3213 |
| 45 | Ga0070704_101166927 | 3300005549 | Unclassified | 701 |
| 46 | Ga0068857_100178297 | 3300005577 | Bacteria | 1933 |
| 47 | Ga0068857_101530300 | 3300005577 | Unclassified | 650 |
| 48 | Ga0068854_100545884 | 3300005578 | Bacteria | 982 |
| 49 | Ga0068852_100120388 | 3300005616 | Bacteria | 2402 |
| 50 | Ga0068852_101119714 | 3300005616 | Bacteria | 808 |
| 51 | Ga0068859_100121426 | 3300005617 | Bacteria | 2679 |
| 52 | Ga0068859_100786942 | 3300005617 | Bacteria | 1039 |
| 53 | Ga0068864_100048758 | 3300005618 | Bacteria | 3642 |
| 54 | Ga0068864_100466611 | 3300005618 | Unclassified | 1210 |
| 55 | Ga0068861_100005893 | 3300005719 | Bacteria | 8329 |
| 56 | Ga0068861_101140988 | 3300005719 | Unclassified | 751 |
| 57 | Ga0068851_10068773 | 3300005834 | Bacteria | 1828 |
| 58 | Ga0068851_10069741 | 3300005834 | Bacteria | 1816 |
| 59 | Ga0068863_100075894 | 3300005841 | Bacteria | 3180 |
| 60 | Ga0068860_100000029 | 3300005843 | Bacteria | 259192 |
| 61 | Ga0068860_100140603 | 3300005843 | Bacteria | 2320 |
| 62 | Ga0068860_100469955 | 3300005843 | Bacteria | 1252 |
| 63 | Ga0068860_101643004 | 3300005843 | Unclassified | 664 |
| 64 | Ga0068862_100369685 | 3300005844 | Unclassified | 1334 |
| 65 | Ga0068862_100378682 | 3300005844 | Bacteria | 1319 |
| 66 | Ga0075366_10062783 | 3300006195 | Bacteria | 2208 |
| 67 | Ga0075370_10357186 | 3300006353 | Bacteria | 873 |
| 68 | Ga0068871_100232203 | 3300006358 | Bacteria | 1601 |
| 69 | Ga0075428_100052075 | 3300006844 | Bacteria | 4488 |
| 70 | Ga0075430_100593420 | 3300006846 | Bacteria | 914 |
| 71 | Ga0075431_100127863 | 3300006847 | Bacteria | 2622 |
| 72 | Ga0075429_100005315 | 3300006880 | Bacteria | 11083 |
| 73 | Ga0097620_100121425 | 3300006931 | Bacteria | 2679 |
| 74 | Ga0097620_100786776 | 3300006931 | Bacteria | 1039 |
| 75 | Ga0105240_10601699 | 3300009093 | Bacteria | 1210 |
| 76 | Ga0105240_10688331 | 3300009093 | Bacteria | 1117 |
| 77 | Ga0111539_10138953 | 3300009094 | Bacteria | 2845 |
| 78 | Ga0111539_11870700 | 3300009094 | Bacteria | 696 |
| 79 | Ga0105245_10450899 | 3300009098 | Bacteria | 1295 |
| 80 | Ga0105242_10002400 | 3300009176 | Bacteria | 14740 |
| 81 | Ga0105242_10042029 | 3300009176 | Bacteria | 3689 |
| 82 | Ga0105242_10195440 | 3300009176 | Bacteria | 1794 |
| 83 | Ga0105238_10057019 | 3300009551 | Bacteria | 3917 |
| 84 | Ga0105238_10473672 | 3300009551 | Bacteria | 1251 |
| 85 | Ga0105238_10947334 | 3300009551 | Bacteria | 880 |
| 86 | Ga0105238_11565789 | 3300009551 | Unclassified | 689 |
| 87 | Ga0105249_10006698 | 3300009553 | Bacteria | 10035 |
| 88 | Ga0105249_10009044 | 3300009553 | Bacteria | 8706 |
| 89 | Ga0105249_10096659 | 3300009553 | Bacteria | 2772 |
| 90 | Ga0105249_10267973 | 3300009553 | Bacteria | 1700 |
| 91 | Ga0105239_10020869 | 3300010375 | Bacteria | 7227 |
| 92 | Ga0157371_10353280 | 3300013102 | Unclassified | 1070 |
| 93 | Ga0157378_10058147 | 3300013297 | Bacteria | 3448 |
| 94 | Ga0157378_10449663 | 3300013297 | Bacteria | 1278 |
| 95 | Ga0163162_10000423 | 3300013306 | Bacteria | 39010 |
| 96 | Ga0163162_10033676 | 3300013306 | Bacteria | 5092 |
| 97 | Ga0163162_10555607 | 3300013306 | Unclassified | 1276 |
| 98 | Ga0157375_10074137 | 3300013308 | Bacteria | 3424 |
| 99 | Ga0157375_10661752 | 3300013308 | Bacteria | 1200 |
| 100 | Ga0163163_10665790 | 3300014325 | Bacteria | 1104 |
| 101 | Ga0163163_11281391 | 3300014325 | Unclassified | 795 |
| 102 | Ga0157380_10017367 | 3300014326 | Bacteria | 5325 |
| 103 | Ga0157380_10140915 | 3300014326 | Bacteria | 2072 |
| 104 | Ga0157380_10143104 | 3300014326 | Bacteria | 2057 |
| 105 | Ga0157380_11457534 | 3300014326 | Bacteria | 736 |
| 106 | Ga0157377_10002480 | 3300014745 | Bacteria | 8165 |
| 107 | Ga0157376_10174448 | 3300014969 | Bacteria | 1960 |
| 108 | Ga0157376_10415708 | 3300014969 | Unclassified | 1304 |
| 109 | Ga0157376_11598344 | 3300014969 | Bacteria | 686 |
| 110 | Ga0163161_10053027 | 3300017792 | Bacteria | 2940 |
| 111 | Ga0213876_10277220 | 3300021384 | Bacteria | 891 |
| 112 | Ga0207697_10026089 | 3300025315 | Unclassified | 2390 |
| 113 | Ga0207682_10018849 | 3300025893 | Bacteria | 2699 |
| 114 | Ga0207680_10239526 | 3300025903 | Unclassified | 1250 |
| 115 | Ga0207647_10055707 | 3300025904 | Bacteria | 2429 |
| 116 | Ga0207645_10145618 | 3300025907 | Bacteria | 1544 |
| 117 | Ga0207645_10368515 | 3300025907 | Bacteria | 963 |
| 118 | Ga0207643_10048898 | 3300025908 | Bacteria | 2396 |
| 119 | Ga0207695_10028280 | 3300025913 | Bacteria | 6223 |
| 120 | Ga0207695_10782046 | 3300025913 | Bacteria | 834 |
| 121 | Ga0207671_10049931 | 3300025914 | Bacteria | 3098 |
| 122 | Ga0207662_10062043 | 3300025918 | Bacteria | 2245 |
| 123 | Ga0207681_10389604 | 3300025923 | Unclassified | 1123 |
| 124 | Ga0207681_10846643 | 3300025923 | Unclassified | 765 |
| 125 | Ga0207694_10117417 | 3300025924 | Bacteria | 2121 |
| 126 | Ga0207650_10059065 | 3300025925 | Bacteria | 2857 |
| 127 | Ga0207650_10208464 | 3300025925 | Unclassified | 1569 |
| 128 | Ga0207650_10359157 | 3300025925 | Bacteria | 1200 |
| 129 | Ga0207650_10599027 | 3300025925 | Bacteria | 927 |
| 130 | Ga0207706_10288335 | 3300025933 | Unclassified | 1431 |
| 131 | Ga0207686_10000715 | 3300025934 | Bacteria | 20597 |
| 132 | Ga0207686_10078304 | 3300025934 | Bacteria | 2149 |
| 133 | Ga0207686_10109900 | 3300025934 | Bacteria | 1857 |
| 134 | Ga0207670_10009038 | 3300025936 | Bacteria | 5657 |
| 135 | Ga0207691_10009967 | 3300025940 | Bacteria | 9126 |
| 136 | Ga0207689_10035121 | 3300025942 | Bacteria | 4164 |
| 137 | Ga0207689_10047854 | 3300025942 | Bacteria | 3528 |
| 138 | Ga0207651_10014803 | 3300025960 | Bacteria | 4515 |
| 139 | Ga0207651_10036157 | 3300025960 | Bacteria | 3221 |
| 140 | Ga0207651_10371331 | 3300025960 | Unclassified | 1210 |
| 141 | Ga0207712_10001188 | 3300025961 | Bacteria | 17998 |
| 142 | Ga0207712_10002851 | 3300025961 | Bacteria | 11074 |
| 143 | Ga0207712_10014921 | 3300025961 | Bacteria | 5003 |
| 144 | Ga0207712_10053260 | 3300025961 | Bacteria | 2838 |
| 145 | Ga0207640_10209040 | 3300025981 | Unclassified | 1485 |
| 146 | Ga0207640_10475415 | 3300025981 | Bacteria | 1035 |
| 147 | Ga0207658_10169377 | 3300025986 | Bacteria | 1798 |
| 148 | Ga0207658_10272238 | 3300025986 | Unclassified | 1448 |
| 149 | Ga0207703_10633839 | 3300026035 | Bacteria | 1013 |
| 150 | Ga0207639_10002436 | 3300026041 | Bacteria | 12511 |
| 151 | Ga0207639_10024079 | 3300026041 | Bacteria | 4402 |
| 152 | Ga0207639_10318891 | 3300026041 | Bacteria | 1379 |
| 153 | Ga0207639_10480289 | 3300026041 | Bacteria | 1132 |
| 154 | Ga0207708_10183476 | 3300026075 | Unclassified | 1662 |
| 155 | Ga0207702_10606842 | 3300026078 | Unclassified | 1074 |
| 156 | Ga0207641_10000213 | 3300026088 | Bacteria | 75051 |
| 157 | Ga0207641_10018145 | 3300026088 | Bacteria | 5766 |
| 158 | Ga0207648_10069357 | 3300026089 | Bacteria | 3072 |
| 159 | Ga0207648_10193421 | 3300026089 | Bacteria | 1804 |
| 160 | Ga0207676_10016401 | 3300026095 | Bacteria | 5364 |
| 161 | Ga0207674_10063414 | 3300026116 | Bacteria | 3730 |
| 162 | Ga0207674_10378502 | 3300026116 | Bacteria | 1368 |
| 163 | Ga0207675_100011637 | 3300026118 | Bacteria | 8227 |
| 164 | Ga0207683_10149149 | 3300026121 | Bacteria | 2110 |
| 165 | Ga0207698_10846645 | 3300026142 | Bacteria | 919 |
| 166 | Ga0207428_10198410 | 3300027907 | Bacteria | 1510 |
| 167 | Ga0268266_10000016 | 3300028379 | Bacteria | 629101 |
| 168 | Ga0268265_10114481 | 3300028380 | Bacteria | 2209 |
| 169 | Ga0268265_10244984 | 3300028380 | Bacteria | 1584 |
| 170 | Ga0268264_10000072 | 3300028381 | Bacteria | 260791 |
| 171 | Ga0268264_10007515 | 3300028381 | Bacteria | 9093 |
| 172 | Ga0268264_10149431 | 3300028381 | Bacteria | 2093 |
| 173 | Ga0268264_10927185 | 3300028381 | Bacteria | 875 |
| 174 | Ga0268264_10979609 | 3300028381 | Bacteria | 851 |
| 175 | Ga0307517_10000697 | 3300028786 | Bacteria | 57970 |
| 176 | Ga0307513_10485743 | 3300031456 | Bacteria | 954 |
| 177 | Ga0307509_10174317 | 3300031507 | Bacteria | 2025 |
| 178 | Ga0316576_10004720 | 3300031727 | Bacteria | 8223 |
| 179 | Ga0316576_10009509 | 3300031727 | Bacteria | 6278 |
| 180 | Ga0316578_10043047 | 3300031728 | Bacteria | 2621 |
| 181 | Ga0316577_10147464 | 3300031733 | Bacteria | 1326 |
| 182 | Ga0307412_10094073 | 3300031911 | Bacteria | 2104 |
| 183 | Ga0316574_0085022 | 3300035398 | Bacteria | 2013 |
| 184 | Ga0316584_0002337 | 3300036712 | Bacteria | 11957 |
| 185 | Ga0395905_0129711 | 3300037471 | Bacteria | 2371 |
| 186 | Ga0400483_152004 | 3300039062 | Bacteria | 1590 |
| 187 | Ga0436365_1534476 | 3300039437 | Bacteria | 874 |
| 188 | Ga0451843_1169828 | 3300041509 | Bacteria | 790 |
| 189 | Ga0439441_059679 | 3300042001 | Bacteria | 801 |
| 190 | Ga0451577_0302238 | 3300042876 | Bacteria | 1450 |
| 191 | Ga0453683_0354325 | 3300044673 | Unclassified | 943 |
| 192 | Ga0453684_0096188 | 3300044712 | Bacteria | 3639 |
| 193 | Ga0453684_0709378 | 3300044712 | Bacteria | 1092 |
| 194 | Ga0495648_0003626 | 3300046524 | Bacteria | 13516 |
| 195 | Ga0495598_0087575 | 3300046537 | Bacteria | 1010 |
| 196 | Ga0495621_0034432 | 3300046539 | Bacteria | 1750 |
| 197 | Ga0495621_0225660 | 3300046539 | Bacteria | 759 |
| 198 | Ga0495625_0214841 | 3300046660 | Bacteria | 1263 |
| 199 | Ga0495672_0048991 | 3300047320 | Bacteria | 2503 |
| 200 | Ga0495687_000004 | 3300047443 | Bacteria | 779298 |
| 201 | Ga0495686_0178108 | 3300047472 | Unclassified | 1233 |
| 202 | Ga0496109_0267242 | 3300048912 | Bacteria | 1611 |
| 203 | Ga0501032_0044738 | 3300049569 | Bacteria | 2996 |
| 204 | Ga0501034_0076899 | 3300049571 | Bacteria | 3344 |
| 205 | Ga0501034_0889789 | 3300049571 | Bacteria | 779 |
| 206 | Ga0501037_0019761 | 3300049573 | Bacteria | 4971 |
| 207 | Ga0501038_0005909 | 3300049574 | Bacteria | 11311 |
| 208 | Ga0501039_0125305 | 3300049575 | Bacteria | 2015 |
| 209 | Ga0501043_0062294 | 3300049579 | Bacteria | 2928 |
| 210 | Ga0501046_0019608 | 3300049580 | Bacteria | 5607 |
| 211 | Ga0501047_0005143 | 3300049581 | Bacteria | 12276 |
| 212 | Ga0501067_0048077 | 3300049583 | Bacteria | 2366 |
| 213 | Ga0501068_0038333 | 3300049584 | Bacteria | 2871 |
| 214 | Ga0501073_0002414 | 3300049589 | Bacteria | 13987 |
| 215 | Ga0501074_0064741 | 3300049590 | Bacteria | 2632 |
| 216 | Ga0501079_0680110 | 3300049741 | Bacteria | 810 |
| 217 | Ga0501080_0000609 | 3300049742 | Bacteria | 28337 |
| 218 | Ga0501080_0607253 | 3300049742 | Bacteria | 971 |
| 219 | Ga0501083_0113275 | 3300049744 | Bacteria | 1782 |
| 220 | Ga0501035_0303252 | 3300049822 | Bacteria | 1345 |
| 221 | nmdc:mga0k408_110218_c1 | 3300050493 | Bacteria | 1627 |
| 222 | nmdc:mga0k408_282503_c1 | 3300050493 | Bacteria | 991 |
| 223 | nmdc:mga0k408_97056_c1 | 3300050493 | Bacteria | 1735 |
| 224 | nmdc:mga05p37_3553_c1 | 3300050507 | Bacteria | 18203 |
| 225 | nmdc:mga0qj67_754498_c1 | 3300050509 | Bacteria | 772 |
| 226 | nmdc:mga06r32_1452231_c1 | 3300050510 | Bacteria | 627 |
| 227 | nmdc:mga08y16_168790_c1 | 3300050511 | Bacteria | 2273 |
| 228 | nmdc:mga0a205_306218_c1 | 3300050515 | Bacteria | 1461 |
| 229 | nmdc:mga0a205_752285_c1 | 3300050515 | Unclassified | 823 |
| 230 | Ga0500583_0000120 | 3300053092 | Bacteria | 37819 |
| 231 | Ga0500583_0000866 | 3300053092 | Bacteria | 8739 |
| 232 | Ga0500618_116878 | 3300053125 | Bacteria | 603 |
| 233 | Ga0500561_0172913 | 3300053137 | Bacteria | 678 |
| 234 | Ga0500568_0000609 | 3300053139 | Bacteria | 25906 |
| 235 | Ga0500622_0002131 | 3300053156 | Bacteria | 14740 |
| 236 | Ga0500639_236193 | 3300053163 | Bacteria | 747 |
| 237 | Ga0500611_120228 | 3300053727 | Bacteria | 699 |
| 238 | Ga0501082_0010004 | 3300060353 | Bacteria | 8178 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2563366752 | 2563930271 | 151 |
| 2 | 3300037471 | Ga0395905_0129711 | Ga0395905_0129711_1846_2355 | 168 |
| 3 | iso_pu_bacteria | 2846952575 | 2846958563 | 168 |
| 4 | 3300053137 | Ga0500561_0172913 | Ga0500561_0172913_139_651 | 169 |
| 5 | 3300025914 | Ga0207671_10049931 | Ga0207671_100499312 | 173 |
| 6 | 3300028381 | Ga0268264_10007515 | Ga0268264_100075152 | 173 |
| 7 | 3300053125 | Ga0500618_116878 | Ga0500618_116878_63_590 | 174 |
| 8 | 3300005535 | Ga0070684_100187985 | Ga0070684_1001879852 | 177 |
| 9 | 3300005616 | Ga0068852_100120388 | Ga0068852_1001203882 | 177 |
| 10 | 3300009098 | Ga0105245_10450899 | Ga0105245_104508992 | 177 |
| 11 | 3300014326 | Ga0157380_11457534 | Ga0157380_114575342 | 177 |
| 12 | 3300026078 | Ga0207702_10606842 | Ga0207702_106068422 | 177 |
| 13 | 3300048912 | Ga0496109_0267242 | Ga0496109_0267242_946_1500 | 177 |
| 14 | iso_pu_bacteria | 2671180694 | 2673818020 | 177 |
| 15 | iso_pu_bacteria | 2597490356 | 2599102538 | 180 |
| 16 | 3300031727 | Ga0316576_10004720 | Ga0316576_100047205 | 181 |
| 17 | 3300031728 | Ga0316578_10043047 | Ga0316578_100430473 | 181 |
| 18 | 3300031733 | Ga0316577_10147464 | Ga0316577_101474642 | 181 |
| 19 | 3300036712 | Ga0316584_0002337 | Ga0316584_0002337_10240_10788 | 181 |
| 20 | 3300050515 | nmdc:mga0a205_752285_c1 | nmdc:mga0a205_752285_c1_204_752 | 181 |
| 21 | 3300003203 | JGI25406J46586_10004895 | JGI25406J46586_100048953 | 182 |
| 22 | 3300005438 | Ga0070701_10071128 | Ga0070701_100711282 | 182 |
| 23 | 3300005440 | Ga0070705_100460748 | Ga0070705_1004607482 | 182 |
| 24 | 3300005444 | Ga0070694_100201949 | Ga0070694_1002019492 | 182 |
| 25 | 3300005549 | Ga0070704_101166927 | Ga0070704_1011669271 | 182 |
| 26 | 3300005577 | Ga0068857_101530300 | Ga0068857_1015303001 | 182 |
| 27 | 3300009094 | Ga0111539_11870700 | Ga0111539_118707001 | 182 |
| 28 | 3300028786 | Ga0307517_10000697 | Ga0307517_1000069735 | 182 |
| 29 | 3300031727 | Ga0316576_10009509 | Ga0316576_100095095 | 182 |
| 30 | 3300039062 | Ga0400483_152004 | Ga0400483_152004_390_938 | 182 |
| 31 | 3300042876 | Ga0451577_0302238 | Ga0451577_0302238_653_1204 | 182 |
| 32 | 3300044673 | Ga0453683_0354325 | Ga0453683_0354325_49_603 | 182 |
| 33 | 3300044712 | Ga0453684_0709378 | Ga0453684_0709378_295_846 | 182 |
| 34 | 3300049571 | Ga0501034_0889789 | Ga0501034_0889789_165_740 | 182 |
| 35 | 3300049742 | Ga0501080_0607253 | Ga0501080_0607253_46_621 | 182 |
| 36 | 3300050515 | nmdc:mga0a205_306218_c1 | nmdc:mga0a205_306218_c1_792_1343 | 182 |
| 37 | iso_pu_bacteria | 2554235469 | 2556063744 | 182 |
| 38 | 3300003323 | rootH1_10183992 | rootH1_101839922 | 184 |
| 39 | 3300005335 | Ga0070666_10144398 | Ga0070666_101443982 | 184 |
| 40 | 3300005457 | Ga0070662_101127327 | Ga0070662_1011273271 | 184 |
| 41 | 3300005548 | Ga0070665_100000008 | Ga0070665_100000008347 | 184 |
| 42 | 3300005577 | Ga0068857_100178297 | Ga0068857_1001782972 | 184 |
| 43 | 3300005843 | Ga0068860_100000029 | Ga0068860_100000029181 | 184 |
| 44 | 3300005843 | Ga0068860_100469955 | Ga0068860_1004699552 | 184 |
| 45 | 3300006353 | Ga0075370_10357186 | Ga0075370_103571862 | 184 |
| 46 | 3300006358 | Ga0068871_100232203 | Ga0068871_1002322032 | 184 |
| 47 | 3300009093 | Ga0105240_10688331 | Ga0105240_106883312 | 184 |
| 48 | 3300009551 | Ga0105238_10947334 | Ga0105238_109473342 | 184 |
| 49 | 3300009551 | Ga0105238_11565789 | Ga0105238_115657891 | 184 |
| 50 | 3300013297 | Ga0157378_10449663 | Ga0157378_104496632 | 184 |
| 51 | 3300013306 | Ga0163162_10000423 | Ga0163162_100004237 | 184 |
| 52 | 3300025903 | Ga0207680_10239526 | Ga0207680_102395262 | 184 |
| 53 | 3300025913 | Ga0207695_10782046 | Ga0207695_107820462 | 184 |
| 54 | 3300025986 | Ga0207658_10169377 | Ga0207658_101693772 | 184 |
| 55 | 3300026116 | Ga0207674_10378502 | Ga0207674_103785022 | 184 |
| 56 | 3300028379 | Ga0268266_10000016 | Ga0268266_10000016345 | 184 |
| 57 | 3300028381 | Ga0268264_10000072 | Ga0268264_10000072182 | 184 |
| 58 | 3300028381 | Ga0268264_10927185 | Ga0268264_109271852 | 184 |
| 59 | 3300035398 | Ga0316574_0085022 | Ga0316574_0085022_83_637 | 184 |
| 60 | 3300046524 | Ga0495648_0003626 | Ga0495648_0003626_5886_6440 | 184 |
| 61 | 3300046660 | Ga0495625_0214841 | Ga0495625_0214841_657_1211 | 184 |
| 62 | 3300047443 | Ga0495687_000004 | Ga0495687_000004_475593_476147 | 184 |
| 63 | 3300047472 | Ga0495686_0178108 | Ga0495686_0178108_309_863 | 184 |
| 64 | 3300050493 | nmdc:mga0k408_110218_c1 | nmdc:mga0k408_110218_c1_975_1529 | 184 |
| 65 | 3300053092 | Ga0500583_0000866 | Ga0500583_0000866_3557_4111 | 184 |
| 66 | 3300053156 | Ga0500622_0002131 | Ga0500622_0002131_11346_11900 | 184 |
| 67 | 3300002459 | JGI24751J29686_10000611 | JGI24751J29686_100006112 | 185 |
| 68 | 3300003323 | rootH1_10207743 | rootH1_102077432 | 185 |
| 69 | 3300005288 | Ga0065714_10046969 | Ga0065714_100469691 | 185 |
| 70 | 3300005289 | Ga0065704_10169157 | Ga0065704_101691572 | 185 |
| 71 | 3300005290 | Ga0065712_10008503 | Ga0065712_100085032 | 185 |
| 72 | 3300005290 | Ga0065712_10016228 | Ga0065712_100162283 | 185 |
| 73 | 3300005293 | Ga0065715_10121072 | Ga0065715_101210722 | 185 |
| 74 | 3300005295 | Ga0065707_10680682 | Ga0065707_106806821 | 185 |
| 75 | 3300005330 | Ga0070690_100052089 | Ga0070690_1000520892 | 185 |
| 76 | 3300005331 | Ga0070670_100061004 | Ga0070670_1000610042 | 185 |
| 77 | 3300005331 | Ga0070670_100076421 | Ga0070670_1000764213 | 185 |
| 78 | 3300005331 | Ga0070670_101031550 | Ga0070670_1010315502 | 185 |
| 79 | 3300005333 | Ga0070677_10067032 | Ga0070677_100670322 | 185 |
| 80 | 3300005334 | Ga0068869_100037896 | Ga0068869_1000378963 | 185 |
| 81 | 3300005334 | Ga0068869_100395470 | Ga0068869_1003954702 | 185 |
| 82 | 3300005334 | Ga0068869_100629815 | Ga0068869_1006298152 | 185 |
| 83 | 3300005337 | Ga0070682_100000101 | Ga0070682_10000010127 | 185 |
| 84 | 3300005340 | Ga0070689_100096077 | Ga0070689_1000960771 | 185 |
| 85 | 3300005340 | Ga0070689_100241527 | Ga0070689_1002415272 | 185 |
| 86 | 3300005343 | Ga0070687_100058529 | Ga0070687_1000585292 | 185 |
| 87 | 3300005343 | Ga0070687_100208283 | Ga0070687_1002082832 | 185 |
| 88 | 3300005353 | Ga0070669_100046405 | Ga0070669_1000464051 | 185 |
| 89 | 3300005353 | Ga0070669_100047502 | Ga0070669_1000475024 | 185 |
| 90 | 3300005364 | Ga0070673_100056502 | Ga0070673_1000565022 | 185 |
| 91 | 3300005364 | Ga0070673_100101023 | Ga0070673_1001010233 | 185 |
| 92 | 3300005364 | Ga0070673_100473393 | Ga0070673_1004733932 | 185 |
| 93 | 3300005364 | Ga0070673_100555015 | Ga0070673_1005550152 | 185 |
| 94 | 3300005365 | Ga0070688_100024394 | Ga0070688_1000243942 | 185 |
| 95 | 3300005456 | Ga0070678_100970388 | Ga0070678_1009703881 | 185 |
| 96 | 3300005459 | Ga0068867_100271589 | Ga0068867_1002715892 | 185 |
| 97 | 3300005466 | Ga0070685_10108623 | Ga0070685_101086232 | 185 |
| 98 | 3300005471 | Ga0070698_100005764 | Ga0070698_1000057645 | 185 |
| 99 | 3300005539 | Ga0068853_100004753 | Ga0068853_1000047533 | 185 |
| 100 | 3300005543 | Ga0070672_100393654 | Ga0070672_1003936542 | 185 |
| 101 | 3300005549 | Ga0070704_100040346 | Ga0070704_1000403463 | 185 |
| 102 | 3300005578 | Ga0068854_100545884 | Ga0068854_1005458842 | 185 |
| 103 | 3300005616 | Ga0068852_101119714 | Ga0068852_1011197142 | 185 |
| 104 | 3300005617 | Ga0068859_100121426 | Ga0068859_1001214263 | 185 |
| 105 | 3300005617 | Ga0068859_100786942 | Ga0068859_1007869422 | 185 |
| 106 | 3300005618 | Ga0068864_100048758 | Ga0068864_1000487582 | 185 |
| 107 | 3300005618 | Ga0068864_100466611 | Ga0068864_1004666112 | 185 |
| 108 | 3300005719 | Ga0068861_100005893 | Ga0068861_1000058934 | 185 |
| 109 | 3300005719 | Ga0068861_101140988 | Ga0068861_1011409881 | 185 |
| 110 | 3300005834 | Ga0068851_10068773 | Ga0068851_100687732 | 185 |
| 111 | 3300005834 | Ga0068851_10069741 | Ga0068851_100697412 | 185 |
| 112 | 3300005841 | Ga0068863_100075894 | Ga0068863_1000758943 | 185 |
| 113 | 3300005843 | Ga0068860_100140603 | Ga0068860_1001406032 | 185 |
| 114 | 3300005843 | Ga0068860_101643004 | Ga0068860_1016430041 | 185 |
| 115 | 3300005844 | Ga0068862_100369685 | Ga0068862_1003696852 | 185 |
| 116 | 3300005844 | Ga0068862_100378682 | Ga0068862_1003786822 | 185 |
| 117 | 3300006195 | Ga0075366_10062783 | Ga0075366_100627833 | 185 |
| 118 | 3300006844 | Ga0075428_100052075 | Ga0075428_1000520752 | 185 |
| 119 | 3300006846 | Ga0075430_100593420 | Ga0075430_1005934202 | 185 |
| 120 | 3300006847 | Ga0075431_100127863 | Ga0075431_1001278632 | 185 |
| 121 | 3300006880 | Ga0075429_100005315 | Ga0075429_10000531512 | 185 |
| 122 | 3300006931 | Ga0097620_100121425 | Ga0097620_1001214252 | 185 |
| 123 | 3300006931 | Ga0097620_100786776 | Ga0097620_1007867762 | 185 |
| 124 | 3300009093 | Ga0105240_10601699 | Ga0105240_106016991 | 185 |
| 125 | 3300009094 | Ga0111539_10138953 | Ga0111539_101389533 | 185 |
| 126 | 3300009176 | Ga0105242_10002400 | Ga0105242_100024007 | 185 |
| 127 | 3300009176 | Ga0105242_10042029 | Ga0105242_100420294 | 185 |
| 128 | 3300009176 | Ga0105242_10195440 | Ga0105242_101954402 | 185 |
| 129 | 3300009551 | Ga0105238_10057019 | Ga0105238_100570192 | 185 |
| 130 | 3300009551 | Ga0105238_10473672 | Ga0105238_104736722 | 185 |
| 131 | 3300009553 | Ga0105249_10006698 | Ga0105249_100066984 | 185 |
| 132 | 3300009553 | Ga0105249_10009044 | Ga0105249_100090445 | 185 |
| 133 | 3300009553 | Ga0105249_10096659 | Ga0105249_100966593 | 185 |
| 134 | 3300009553 | Ga0105249_10267973 | Ga0105249_102679732 | 185 |
| 135 | 3300010375 | Ga0105239_10020869 | Ga0105239_100208694 | 185 |
| 136 | 3300013102 | Ga0157371_10353280 | Ga0157371_103532802 | 185 |
| 137 | 3300013297 | Ga0157378_10058147 | Ga0157378_100581473 | 185 |
| 138 | 3300013306 | Ga0163162_10033676 | Ga0163162_100336765 | 185 |
| 139 | 3300013306 | Ga0163162_10555607 | Ga0163162_105556072 | 185 |
| 140 | 3300013308 | Ga0157375_10074137 | Ga0157375_100741372 | 185 |
| 141 | 3300013308 | Ga0157375_10661752 | Ga0157375_106617522 | 185 |
| 142 | 3300014325 | Ga0163163_10665790 | Ga0163163_106657902 | 185 |
| 143 | 3300014325 | Ga0163163_11281391 | Ga0163163_112813912 | 185 |
| 144 | 3300014326 | Ga0157380_10017367 | Ga0157380_100173674 | 185 |
| 145 | 3300014326 | Ga0157380_10140915 | Ga0157380_101409152 | 185 |
| 146 | 3300014326 | Ga0157380_10143104 | Ga0157380_101431042 | 185 |
| 147 | 3300014745 | Ga0157377_10002480 | Ga0157377_100024803 | 185 |
| 148 | 3300014969 | Ga0157376_10174448 | Ga0157376_101744482 | 185 |
| 149 | 3300014969 | Ga0157376_10415708 | Ga0157376_104157082 | 185 |
| 150 | 3300014969 | Ga0157376_11598344 | Ga0157376_115983441 | 185 |
| 151 | 3300017792 | Ga0163161_10053027 | Ga0163161_100530273 | 185 |
| 152 | 3300021384 | Ga0213876_10277220 | Ga0213876_102772202 | 185 |
| 153 | 3300025315 | Ga0207697_10026089 | Ga0207697_100260892 | 185 |
| 154 | 3300025893 | Ga0207682_10018849 | Ga0207682_100188492 | 185 |
| 155 | 3300025904 | Ga0207647_10055707 | Ga0207647_100557072 | 185 |
| 156 | 3300025907 | Ga0207645_10145618 | Ga0207645_101456182 | 185 |
| 157 | 3300025907 | Ga0207645_10368515 | Ga0207645_103685152 | 185 |
| 158 | 3300025908 | Ga0207643_10048898 | Ga0207643_100488983 | 185 |
| 159 | 3300025913 | Ga0207695_10028280 | Ga0207695_100282803 | 185 |
| 160 | 3300025918 | Ga0207662_10062043 | Ga0207662_100620433 | 185 |
| 161 | 3300025923 | Ga0207681_10389604 | Ga0207681_103896042 | 185 |
| 162 | 3300025923 | Ga0207681_10846643 | Ga0207681_108466432 | 185 |
| 163 | 3300025924 | Ga0207694_10117417 | Ga0207694_101174172 | 185 |
| 164 | 3300025925 | Ga0207650_10059065 | Ga0207650_100590652 | 185 |
| 165 | 3300025925 | Ga0207650_10208464 | Ga0207650_102084642 | 185 |
| 166 | 3300025925 | Ga0207650_10359157 | Ga0207650_103591572 | 185 |
| 167 | 3300025925 | Ga0207650_10599027 | Ga0207650_105990272 | 185 |
| 168 | 3300025933 | Ga0207706_10288335 | Ga0207706_102883352 | 185 |
| 169 | 3300025934 | Ga0207686_10000715 | Ga0207686_100007159 | 185 |
| 170 | 3300025934 | Ga0207686_10078304 | Ga0207686_100783041 | 185 |
| 171 | 3300025934 | Ga0207686_10109900 | Ga0207686_101099003 | 185 |
| 172 | 3300025936 | Ga0207670_10009038 | Ga0207670_100090382 | 185 |
| 173 | 3300025940 | Ga0207691_10009967 | Ga0207691_100099676 | 185 |
| 174 | 3300025942 | Ga0207689_10035121 | Ga0207689_100351213 | 185 |
| 175 | 3300025942 | Ga0207689_10047854 | Ga0207689_100478543 | 185 |
| 176 | 3300025960 | Ga0207651_10014803 | Ga0207651_100148034 | 185 |
| 177 | 3300025960 | Ga0207651_10036157 | Ga0207651_100361571 | 185 |
| 178 | 3300025960 | Ga0207651_10371331 | Ga0207651_103713312 | 185 |
| 179 | 3300025961 | Ga0207712_10001188 | Ga0207712_1000118813 | 185 |
| 180 | 3300025961 | Ga0207712_10002851 | Ga0207712_1000285110 | 185 |
| 181 | 3300025961 | Ga0207712_10014921 | Ga0207712_100149214 | 185 |
| 182 | 3300025961 | Ga0207712_10053260 | Ga0207712_100532603 | 185 |
| 183 | 3300025981 | Ga0207640_10209040 | Ga0207640_102090402 | 185 |
| 184 | 3300025981 | Ga0207640_10475415 | Ga0207640_104754152 | 185 |
| 185 | 3300025986 | Ga0207658_10272238 | Ga0207658_102722382 | 185 |
| 186 | 3300026035 | Ga0207703_10633839 | Ga0207703_106338392 | 185 |
| 187 | 3300026041 | Ga0207639_10002436 | Ga0207639_100024363 | 185 |
| 188 | 3300026041 | Ga0207639_10024079 | Ga0207639_100240792 | 185 |
| 189 | 3300026041 | Ga0207639_10318891 | Ga0207639_103188912 | 185 |
| 190 | 3300026041 | Ga0207639_10480289 | Ga0207639_104802892 | 185 |
| 191 | 3300026075 | Ga0207708_10183476 | Ga0207708_101834762 | 185 |
| 192 | 3300026088 | Ga0207641_10000213 | Ga0207641_1000021368 | 185 |
| 193 | 3300026088 | Ga0207641_10018145 | Ga0207641_100181455 | 185 |
| 194 | 3300026089 | Ga0207648_10069357 | Ga0207648_100693573 | 185 |
| 195 | 3300026089 | Ga0207648_10193421 | Ga0207648_101934213 | 185 |
| 196 | 3300026095 | Ga0207676_10016401 | Ga0207676_100164014 | 185 |
| 197 | 3300026116 | Ga0207674_10063414 | Ga0207674_100634142 | 185 |
| 198 | 3300026118 | Ga0207675_100011637 | Ga0207675_1000116373 | 185 |
| 199 | 3300026121 | Ga0207683_10149149 | Ga0207683_101491491 | 185 |
| 200 | 3300026142 | Ga0207698_10846645 | Ga0207698_108466452 | 185 |
| 201 | 3300027907 | Ga0207428_10198410 | Ga0207428_101984102 | 185 |
| 202 | 3300028380 | Ga0268265_10114481 | Ga0268265_101144814 | 185 |
| 203 | 3300028380 | Ga0268265_10244984 | Ga0268265_102449841 | 185 |
| 204 | 3300028381 | Ga0268264_10149431 | Ga0268264_101494312 | 185 |
| 205 | 3300028381 | Ga0268264_10979609 | Ga0268264_109796091 | 185 |
| 206 | 3300031456 | Ga0307513_10485743 | Ga0307513_104857432 | 185 |
| 207 | 3300031507 | Ga0307509_10174317 | Ga0307509_101743172 | 185 |
| 208 | 3300031911 | Ga0307412_10094073 | Ga0307412_100940732 | 185 |
| 209 | 3300039437 | Ga0436365_1534476 | Ga0436365_1534476_206_766 | 185 |
| 210 | 3300041509 | Ga0451843_1169828 | Ga0451843_1169828_91_651 | 185 |
| 211 | 3300042001 | Ga0439441_059679 | Ga0439441_059679_120_680 | 185 |
| 212 | 3300044712 | Ga0453684_0096188 | Ga0453684_0096188_1645_2205 | 185 |
| 213 | 3300046537 | Ga0495598_0087575 | Ga0495598_0087575_323_916 | 185 |
| 214 | 3300046539 | Ga0495621_0034432 | Ga0495621_0034432_474_1034 | 185 |
| 215 | 3300046539 | Ga0495621_0225660 | Ga0495621_0225660_56_649 | 185 |
| 216 | 3300047320 | Ga0495672_0048991 | Ga0495672_0048991_1596_2156 | 185 |
| 217 | 3300049569 | Ga0501032_0044738 | Ga0501032_0044738_1645_2205 | 185 |
| 218 | 3300049571 | Ga0501034_0076899 | Ga0501034_0076899_607_1167 | 185 |
| 219 | 3300049573 | Ga0501037_0019761 | Ga0501037_0019761_3467_4027 | 185 |
| 220 | 3300049574 | Ga0501038_0005909 | Ga0501038_0005909_1239_1799 | 185 |
| 221 | 3300049575 | Ga0501039_0125305 | Ga0501039_0125305_885_1445 | 185 |
| 222 | 3300049579 | Ga0501043_0062294 | Ga0501043_0062294_1086_1646 | 185 |
| 223 | 3300049580 | Ga0501046_0019608 | Ga0501046_0019608_1203_1763 | 185 |
| 224 | 3300049581 | Ga0501047_0005143 | Ga0501047_0005143_1233_1793 | 185 |
| 225 | 3300049583 | Ga0501067_0048077 | Ga0501067_0048077_1408_1968 | 185 |
| 226 | 3300049584 | Ga0501068_0038333 | Ga0501068_0038333_742_1302 | 185 |
| 227 | 3300049589 | Ga0501073_0002414 | Ga0501073_0002414_2997_3557 | 185 |
| 228 | 3300049590 | Ga0501074_0064741 | Ga0501074_0064741_235_795 | 185 |
| 229 | 3300049741 | Ga0501079_0680110 | Ga0501079_0680110_95_655 | 185 |
| 230 | 3300049742 | Ga0501080_0000609 | Ga0501080_0000609_10534_11094 | 185 |
| 231 | 3300049744 | Ga0501083_0113275 | Ga0501083_0113275_1063_1623 | 185 |
| 232 | 3300049822 | Ga0501035_0303252 | Ga0501035_0303252_392_952 | 185 |
| 233 | 3300050493 | nmdc:mga0k408_282503_c1 | nmdc:mga0k408_282503_c1_108_668 | 185 |
| 234 | 3300050493 | nmdc:mga0k408_97056_c1 | nmdc:mga0k408_97056_c1_969_1529 | 185 |
| 235 | 3300050507 | nmdc:mga05p37_3553_c1 | nmdc:mga05p37_3553_c1_9888_10448 | 185 |
| 236 | 3300050509 | nmdc:mga0qj67_754498_c1 | nmdc:mga0qj67_754498_c1_31_591 | 185 |
| 237 | 3300050510 | nmdc:mga06r32_1452231_c1 | nmdc:mga06r32_1452231_c1_43_603 | 185 |
| 238 | 3300050511 | nmdc:mga08y16_168790_c1 | nmdc:mga08y16_168790_c1_1530_2090 | 185 |
| 239 | 3300053092 | Ga0500583_0000120 | Ga0500583_0000120_23027_23587 | 185 |
| 240 | 3300053139 | Ga0500568_0000609 | Ga0500568_0000609_6353_6910 | 185 |
| 241 | 3300053163 | Ga0500639_236193 | Ga0500639_236193_38_598 | 185 |
| 242 | 3300053727 | Ga0500611_120228 | Ga0500611_120228_64_624 | 185 |
| 243 | 3300060353 | Ga0501082_0010004 | Ga0501082_0010004_5238_5798 | 185 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dzt-assembly1.cif.gz_B | rmlc from salmonella typhimurium | 0.9709 | 2 | 175 |
| 3ryk-assembly1.cif.gz_B | 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound | 0.9705 | 2 | 174 |
| 7pvi-assembly1.cif.gz_BBB | dtdp-sugar epimerase | 0.9699 | 2 | 185 |
| 6c46-assembly2.cif.gz_C | crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 | 0.9693 | 1 | 174 |
| 2ixh-assembly1.cif.gz_A | rmlc p aeruginosa with dtdp-rhamnose | 0.9689 | 1 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9675 | 1 | 176 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9668 | 1 | 176 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9641 | 2 | 174 | 2.60.120.10 |
| 6dinA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9546 | 2 | 181 | 2.60.120.10 |
| 1ofnB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9493 | 1 | 176 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9PK35-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9953 | 44 | 179 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
| AF-A0A1Y3NSB4-F1-model_v4 | RmlD-like substrate binding domain-containing protein | 0.994 | 1 | 174 |
GO:0005829
GO:0006556 GO:0008830 GO:0008831 GO:0019305 GO:0045226 |
| AF-A0A350YWE6-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9935 | 1 | 136 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
| AF-A0A350MPY5-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.9923 | 2 | 148 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A2E6AY78-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) | 0.992 | 41 | 179 |
GO:0000271
GO:0005829 GO:0008830 GO:0019305 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar