F355444

General Info

Members Datasets Scaffolds Average Seq Length
243 163 238 188

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100369685|Ga0068862_1003696852
Length 209
Sequence VIKLKKEFIGAYNMPFIQTPISNLLVFEPKIHEDSRGYFFESFNLQTFRAEGIDINFVQDNQSSSKYGVIRGLHYQLNPSAQVKLIRVLSGRILDVVVDIRKGSPTFGKNFSVELTAENKKQLFVPAGLAHGFSVLSEEAEVLYKCDSFYNKDSEAGILYNDPSLNIDWKIPAEKEIVSEKDKGLPLFAECRNNFIWNENKVQNTGNRG

Samples

Sample ID Description Type Environment
1 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
2 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2671180694 Paenibacillus sp. A3 Isolate Unclassified
5 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
113 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
128 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
158 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
159 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
160 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
161 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
162 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 0.41
Rhizosphere 89.3
Stem 0
Stem Tuber 0
Unclassified 4.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000611 3300002459 Bacteria 9290
2 JGI25406J46586_10004895 3300003203 Bacteria 6222
3 rootH1_10183992 3300003323 Bacteria 1519
4 rootH1_10207743 3300003323 Bacteria 2190
5 Ga0065714_10046969 3300005288 Bacteria 689
6 Ga0065704_10169157 3300005289 Bacteria 1302
7 Ga0065712_10008503 3300005290 Bacteria 3134
8 Ga0065712_10016228 3300005290 Bacteria 2706
9 Ga0065715_10121072 3300005293 Bacteria 2231
10 Ga0065707_10680682 3300005295 Bacteria 649
11 Ga0070690_100052089 3300005330 Bacteria 2615
12 Ga0070670_100061004 3300005331 Bacteria 3238
13 Ga0070670_100076421 3300005331 Bacteria 2877
14 Ga0070670_101031550 3300005331 Bacteria 749
15 Ga0070677_10067032 3300005333 Bacteria 1498
16 Ga0068869_100037896 3300005334 Bacteria 3431
17 Ga0068869_100395470 3300005334 Bacteria 1135
18 Ga0068869_100629815 3300005334 Bacteria 909
19 Ga0070666_10144398 3300005335 Unclassified 1658
20 Ga0070682_100000101 3300005337 Bacteria 76535
21 Ga0070689_100096077 3300005340 Bacteria 2341
22 Ga0070689_100241527 3300005340 Unclassified 1487
23 Ga0070687_100058529 3300005343 Bacteria 2025
24 Ga0070687_100208283 3300005343 Unclassified 1189
25 Ga0070669_100046405 3300005353 Bacteria 3168
26 Ga0070669_100047502 3300005353 Bacteria 3131
27 Ga0070673_100056502 3300005364 Bacteria 3097
28 Ga0070673_100101023 3300005364 Bacteria 2375
29 Ga0070673_100473393 3300005364 Bacteria 1130
30 Ga0070673_100555015 3300005364 Bacteria 1044
31 Ga0070688_100024394 3300005365 Bacteria 3569
32 Ga0070701_10071128 3300005438 Bacteria 1860
33 Ga0070705_100460748 3300005440 Unclassified 956
34 Ga0070694_100201949 3300005444 Bacteria 1482
35 Ga0070678_100970388 3300005456 Unclassified 780
36 Ga0070662_101127327 3300005457 Bacteria 673
37 Ga0068867_100271589 3300005459 Bacteria 1386
38 Ga0070685_10108623 3300005466 Bacteria 1705
39 Ga0070698_100005764 3300005471 Bacteria 13543
40 Ga0070684_100187985 3300005535 Bacteria 1879
41 Ga0068853_100004753 3300005539 Bacteria 10558
42 Ga0070672_100393654 3300005543 Unclassified 1187
43 Ga0070665_100000008 3300005548 Bacteria 606341
44 Ga0070704_100040346 3300005549 Bacteria 3213
45 Ga0070704_101166927 3300005549 Unclassified 701
46 Ga0068857_100178297 3300005577 Bacteria 1933
47 Ga0068857_101530300 3300005577 Unclassified 650
48 Ga0068854_100545884 3300005578 Bacteria 982
49 Ga0068852_100120388 3300005616 Bacteria 2402
50 Ga0068852_101119714 3300005616 Bacteria 808
51 Ga0068859_100121426 3300005617 Bacteria 2679
52 Ga0068859_100786942 3300005617 Bacteria 1039
53 Ga0068864_100048758 3300005618 Bacteria 3642
54 Ga0068864_100466611 3300005618 Unclassified 1210
55 Ga0068861_100005893 3300005719 Bacteria 8329
56 Ga0068861_101140988 3300005719 Unclassified 751
57 Ga0068851_10068773 3300005834 Bacteria 1828
58 Ga0068851_10069741 3300005834 Bacteria 1816
59 Ga0068863_100075894 3300005841 Bacteria 3180
60 Ga0068860_100000029 3300005843 Bacteria 259192
61 Ga0068860_100140603 3300005843 Bacteria 2320
62 Ga0068860_100469955 3300005843 Bacteria 1252
63 Ga0068860_101643004 3300005843 Unclassified 664
64 Ga0068862_100369685 3300005844 Unclassified 1334
65 Ga0068862_100378682 3300005844 Bacteria 1319
66 Ga0075366_10062783 3300006195 Bacteria 2208
67 Ga0075370_10357186 3300006353 Bacteria 873
68 Ga0068871_100232203 3300006358 Bacteria 1601
69 Ga0075428_100052075 3300006844 Bacteria 4488
70 Ga0075430_100593420 3300006846 Bacteria 914
71 Ga0075431_100127863 3300006847 Bacteria 2622
72 Ga0075429_100005315 3300006880 Bacteria 11083
73 Ga0097620_100121425 3300006931 Bacteria 2679
74 Ga0097620_100786776 3300006931 Bacteria 1039
75 Ga0105240_10601699 3300009093 Bacteria 1210
76 Ga0105240_10688331 3300009093 Bacteria 1117
77 Ga0111539_10138953 3300009094 Bacteria 2845
78 Ga0111539_11870700 3300009094 Bacteria 696
79 Ga0105245_10450899 3300009098 Bacteria 1295
80 Ga0105242_10002400 3300009176 Bacteria 14740
81 Ga0105242_10042029 3300009176 Bacteria 3689
82 Ga0105242_10195440 3300009176 Bacteria 1794
83 Ga0105238_10057019 3300009551 Bacteria 3917
84 Ga0105238_10473672 3300009551 Bacteria 1251
85 Ga0105238_10947334 3300009551 Bacteria 880
86 Ga0105238_11565789 3300009551 Unclassified 689
87 Ga0105249_10006698 3300009553 Bacteria 10035
88 Ga0105249_10009044 3300009553 Bacteria 8706
89 Ga0105249_10096659 3300009553 Bacteria 2772
90 Ga0105249_10267973 3300009553 Bacteria 1700
91 Ga0105239_10020869 3300010375 Bacteria 7227
92 Ga0157371_10353280 3300013102 Unclassified 1070
93 Ga0157378_10058147 3300013297 Bacteria 3448
94 Ga0157378_10449663 3300013297 Bacteria 1278
95 Ga0163162_10000423 3300013306 Bacteria 39010
96 Ga0163162_10033676 3300013306 Bacteria 5092
97 Ga0163162_10555607 3300013306 Unclassified 1276
98 Ga0157375_10074137 3300013308 Bacteria 3424
99 Ga0157375_10661752 3300013308 Bacteria 1200
100 Ga0163163_10665790 3300014325 Bacteria 1104
101 Ga0163163_11281391 3300014325 Unclassified 795
102 Ga0157380_10017367 3300014326 Bacteria 5325
103 Ga0157380_10140915 3300014326 Bacteria 2072
104 Ga0157380_10143104 3300014326 Bacteria 2057
105 Ga0157380_11457534 3300014326 Bacteria 736
106 Ga0157377_10002480 3300014745 Bacteria 8165
107 Ga0157376_10174448 3300014969 Bacteria 1960
108 Ga0157376_10415708 3300014969 Unclassified 1304
109 Ga0157376_11598344 3300014969 Bacteria 686
110 Ga0163161_10053027 3300017792 Bacteria 2940
111 Ga0213876_10277220 3300021384 Bacteria 891
112 Ga0207697_10026089 3300025315 Unclassified 2390
113 Ga0207682_10018849 3300025893 Bacteria 2699
114 Ga0207680_10239526 3300025903 Unclassified 1250
115 Ga0207647_10055707 3300025904 Bacteria 2429
116 Ga0207645_10145618 3300025907 Bacteria 1544
117 Ga0207645_10368515 3300025907 Bacteria 963
118 Ga0207643_10048898 3300025908 Bacteria 2396
119 Ga0207695_10028280 3300025913 Bacteria 6223
120 Ga0207695_10782046 3300025913 Bacteria 834
121 Ga0207671_10049931 3300025914 Bacteria 3098
122 Ga0207662_10062043 3300025918 Bacteria 2245
123 Ga0207681_10389604 3300025923 Unclassified 1123
124 Ga0207681_10846643 3300025923 Unclassified 765
125 Ga0207694_10117417 3300025924 Bacteria 2121
126 Ga0207650_10059065 3300025925 Bacteria 2857
127 Ga0207650_10208464 3300025925 Unclassified 1569
128 Ga0207650_10359157 3300025925 Bacteria 1200
129 Ga0207650_10599027 3300025925 Bacteria 927
130 Ga0207706_10288335 3300025933 Unclassified 1431
131 Ga0207686_10000715 3300025934 Bacteria 20597
132 Ga0207686_10078304 3300025934 Bacteria 2149
133 Ga0207686_10109900 3300025934 Bacteria 1857
134 Ga0207670_10009038 3300025936 Bacteria 5657
135 Ga0207691_10009967 3300025940 Bacteria 9126
136 Ga0207689_10035121 3300025942 Bacteria 4164
137 Ga0207689_10047854 3300025942 Bacteria 3528
138 Ga0207651_10014803 3300025960 Bacteria 4515
139 Ga0207651_10036157 3300025960 Bacteria 3221
140 Ga0207651_10371331 3300025960 Unclassified 1210
141 Ga0207712_10001188 3300025961 Bacteria 17998
142 Ga0207712_10002851 3300025961 Bacteria 11074
143 Ga0207712_10014921 3300025961 Bacteria 5003
144 Ga0207712_10053260 3300025961 Bacteria 2838
145 Ga0207640_10209040 3300025981 Unclassified 1485
146 Ga0207640_10475415 3300025981 Bacteria 1035
147 Ga0207658_10169377 3300025986 Bacteria 1798
148 Ga0207658_10272238 3300025986 Unclassified 1448
149 Ga0207703_10633839 3300026035 Bacteria 1013
150 Ga0207639_10002436 3300026041 Bacteria 12511
151 Ga0207639_10024079 3300026041 Bacteria 4402
152 Ga0207639_10318891 3300026041 Bacteria 1379
153 Ga0207639_10480289 3300026041 Bacteria 1132
154 Ga0207708_10183476 3300026075 Unclassified 1662
155 Ga0207702_10606842 3300026078 Unclassified 1074
156 Ga0207641_10000213 3300026088 Bacteria 75051
157 Ga0207641_10018145 3300026088 Bacteria 5766
158 Ga0207648_10069357 3300026089 Bacteria 3072
159 Ga0207648_10193421 3300026089 Bacteria 1804
160 Ga0207676_10016401 3300026095 Bacteria 5364
161 Ga0207674_10063414 3300026116 Bacteria 3730
162 Ga0207674_10378502 3300026116 Bacteria 1368
163 Ga0207675_100011637 3300026118 Bacteria 8227
164 Ga0207683_10149149 3300026121 Bacteria 2110
165 Ga0207698_10846645 3300026142 Bacteria 919
166 Ga0207428_10198410 3300027907 Bacteria 1510
167 Ga0268266_10000016 3300028379 Bacteria 629101
168 Ga0268265_10114481 3300028380 Bacteria 2209
169 Ga0268265_10244984 3300028380 Bacteria 1584
170 Ga0268264_10000072 3300028381 Bacteria 260791
171 Ga0268264_10007515 3300028381 Bacteria 9093
172 Ga0268264_10149431 3300028381 Bacteria 2093
173 Ga0268264_10927185 3300028381 Bacteria 875
174 Ga0268264_10979609 3300028381 Bacteria 851
175 Ga0307517_10000697 3300028786 Bacteria 57970
176 Ga0307513_10485743 3300031456 Bacteria 954
177 Ga0307509_10174317 3300031507 Bacteria 2025
178 Ga0316576_10004720 3300031727 Bacteria 8223
179 Ga0316576_10009509 3300031727 Bacteria 6278
180 Ga0316578_10043047 3300031728 Bacteria 2621
181 Ga0316577_10147464 3300031733 Bacteria 1326
182 Ga0307412_10094073 3300031911 Bacteria 2104
183 Ga0316574_0085022 3300035398 Bacteria 2013
184 Ga0316584_0002337 3300036712 Bacteria 11957
185 Ga0395905_0129711 3300037471 Bacteria 2371
186 Ga0400483_152004 3300039062 Bacteria 1590
187 Ga0436365_1534476 3300039437 Bacteria 874
188 Ga0451843_1169828 3300041509 Bacteria 790
189 Ga0439441_059679 3300042001 Bacteria 801
190 Ga0451577_0302238 3300042876 Bacteria 1450
191 Ga0453683_0354325 3300044673 Unclassified 943
192 Ga0453684_0096188 3300044712 Bacteria 3639
193 Ga0453684_0709378 3300044712 Bacteria 1092
194 Ga0495648_0003626 3300046524 Bacteria 13516
195 Ga0495598_0087575 3300046537 Bacteria 1010
196 Ga0495621_0034432 3300046539 Bacteria 1750
197 Ga0495621_0225660 3300046539 Bacteria 759
198 Ga0495625_0214841 3300046660 Bacteria 1263
199 Ga0495672_0048991 3300047320 Bacteria 2503
200 Ga0495687_000004 3300047443 Bacteria 779298
201 Ga0495686_0178108 3300047472 Unclassified 1233
202 Ga0496109_0267242 3300048912 Bacteria 1611
203 Ga0501032_0044738 3300049569 Bacteria 2996
204 Ga0501034_0076899 3300049571 Bacteria 3344
205 Ga0501034_0889789 3300049571 Bacteria 779
206 Ga0501037_0019761 3300049573 Bacteria 4971
207 Ga0501038_0005909 3300049574 Bacteria 11311
208 Ga0501039_0125305 3300049575 Bacteria 2015
209 Ga0501043_0062294 3300049579 Bacteria 2928
210 Ga0501046_0019608 3300049580 Bacteria 5607
211 Ga0501047_0005143 3300049581 Bacteria 12276
212 Ga0501067_0048077 3300049583 Bacteria 2366
213 Ga0501068_0038333 3300049584 Bacteria 2871
214 Ga0501073_0002414 3300049589 Bacteria 13987
215 Ga0501074_0064741 3300049590 Bacteria 2632
216 Ga0501079_0680110 3300049741 Bacteria 810
217 Ga0501080_0000609 3300049742 Bacteria 28337
218 Ga0501080_0607253 3300049742 Bacteria 971
219 Ga0501083_0113275 3300049744 Bacteria 1782
220 Ga0501035_0303252 3300049822 Bacteria 1345
221 nmdc:mga0k408_110218_c1 3300050493 Bacteria 1627
222 nmdc:mga0k408_282503_c1 3300050493 Bacteria 991
223 nmdc:mga0k408_97056_c1 3300050493 Bacteria 1735
224 nmdc:mga05p37_3553_c1 3300050507 Bacteria 18203
225 nmdc:mga0qj67_754498_c1 3300050509 Bacteria 772
226 nmdc:mga06r32_1452231_c1 3300050510 Bacteria 627
227 nmdc:mga08y16_168790_c1 3300050511 Bacteria 2273
228 nmdc:mga0a205_306218_c1 3300050515 Bacteria 1461
229 nmdc:mga0a205_752285_c1 3300050515 Unclassified 823
230 Ga0500583_0000120 3300053092 Bacteria 37819
231 Ga0500583_0000866 3300053092 Bacteria 8739
232 Ga0500618_116878 3300053125 Bacteria 603
233 Ga0500561_0172913 3300053137 Bacteria 678
234 Ga0500568_0000609 3300053139 Bacteria 25906
235 Ga0500622_0002131 3300053156 Bacteria 14740
236 Ga0500639_236193 3300053163 Bacteria 747
237 Ga0500611_120228 3300053727 Bacteria 699
238 Ga0501082_0010004 3300060353 Bacteria 8178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2563366752 2563930271 151
2 3300037471 Ga0395905_0129711 Ga0395905_0129711_1846_2355 168
3 iso_pu_bacteria 2846952575 2846958563 168
4 3300053137 Ga0500561_0172913 Ga0500561_0172913_139_651 169
5 3300025914 Ga0207671_10049931 Ga0207671_100499312 173
6 3300028381 Ga0268264_10007515 Ga0268264_100075152 173
7 3300053125 Ga0500618_116878 Ga0500618_116878_63_590 174
8 3300005535 Ga0070684_100187985 Ga0070684_1001879852 177
9 3300005616 Ga0068852_100120388 Ga0068852_1001203882 177
10 3300009098 Ga0105245_10450899 Ga0105245_104508992 177
11 3300014326 Ga0157380_11457534 Ga0157380_114575342 177
12 3300026078 Ga0207702_10606842 Ga0207702_106068422 177
13 3300048912 Ga0496109_0267242 Ga0496109_0267242_946_1500 177
14 iso_pu_bacteria 2671180694 2673818020 177
15 iso_pu_bacteria 2597490356 2599102538 180
16 3300031727 Ga0316576_10004720 Ga0316576_100047205 181
17 3300031728 Ga0316578_10043047 Ga0316578_100430473 181
18 3300031733 Ga0316577_10147464 Ga0316577_101474642 181
19 3300036712 Ga0316584_0002337 Ga0316584_0002337_10240_10788 181
20 3300050515 nmdc:mga0a205_752285_c1 nmdc:mga0a205_752285_c1_204_752 181
21 3300003203 JGI25406J46586_10004895 JGI25406J46586_100048953 182
22 3300005438 Ga0070701_10071128 Ga0070701_100711282 182
23 3300005440 Ga0070705_100460748 Ga0070705_1004607482 182
24 3300005444 Ga0070694_100201949 Ga0070694_1002019492 182
25 3300005549 Ga0070704_101166927 Ga0070704_1011669271 182
26 3300005577 Ga0068857_101530300 Ga0068857_1015303001 182
27 3300009094 Ga0111539_11870700 Ga0111539_118707001 182
28 3300028786 Ga0307517_10000697 Ga0307517_1000069735 182
29 3300031727 Ga0316576_10009509 Ga0316576_100095095 182
30 3300039062 Ga0400483_152004 Ga0400483_152004_390_938 182
31 3300042876 Ga0451577_0302238 Ga0451577_0302238_653_1204 182
32 3300044673 Ga0453683_0354325 Ga0453683_0354325_49_603 182
33 3300044712 Ga0453684_0709378 Ga0453684_0709378_295_846 182
34 3300049571 Ga0501034_0889789 Ga0501034_0889789_165_740 182
35 3300049742 Ga0501080_0607253 Ga0501080_0607253_46_621 182
36 3300050515 nmdc:mga0a205_306218_c1 nmdc:mga0a205_306218_c1_792_1343 182
37 iso_pu_bacteria 2554235469 2556063744 182
38 3300003323 rootH1_10183992 rootH1_101839922 184
39 3300005335 Ga0070666_10144398 Ga0070666_101443982 184
40 3300005457 Ga0070662_101127327 Ga0070662_1011273271 184
41 3300005548 Ga0070665_100000008 Ga0070665_100000008347 184
42 3300005577 Ga0068857_100178297 Ga0068857_1001782972 184
43 3300005843 Ga0068860_100000029 Ga0068860_100000029181 184
44 3300005843 Ga0068860_100469955 Ga0068860_1004699552 184
45 3300006353 Ga0075370_10357186 Ga0075370_103571862 184
46 3300006358 Ga0068871_100232203 Ga0068871_1002322032 184
47 3300009093 Ga0105240_10688331 Ga0105240_106883312 184
48 3300009551 Ga0105238_10947334 Ga0105238_109473342 184
49 3300009551 Ga0105238_11565789 Ga0105238_115657891 184
50 3300013297 Ga0157378_10449663 Ga0157378_104496632 184
51 3300013306 Ga0163162_10000423 Ga0163162_100004237 184
52 3300025903 Ga0207680_10239526 Ga0207680_102395262 184
53 3300025913 Ga0207695_10782046 Ga0207695_107820462 184
54 3300025986 Ga0207658_10169377 Ga0207658_101693772 184
55 3300026116 Ga0207674_10378502 Ga0207674_103785022 184
56 3300028379 Ga0268266_10000016 Ga0268266_10000016345 184
57 3300028381 Ga0268264_10000072 Ga0268264_10000072182 184
58 3300028381 Ga0268264_10927185 Ga0268264_109271852 184
59 3300035398 Ga0316574_0085022 Ga0316574_0085022_83_637 184
60 3300046524 Ga0495648_0003626 Ga0495648_0003626_5886_6440 184
61 3300046660 Ga0495625_0214841 Ga0495625_0214841_657_1211 184
62 3300047443 Ga0495687_000004 Ga0495687_000004_475593_476147 184
63 3300047472 Ga0495686_0178108 Ga0495686_0178108_309_863 184
64 3300050493 nmdc:mga0k408_110218_c1 nmdc:mga0k408_110218_c1_975_1529 184
65 3300053092 Ga0500583_0000866 Ga0500583_0000866_3557_4111 184
66 3300053156 Ga0500622_0002131 Ga0500622_0002131_11346_11900 184
67 3300002459 JGI24751J29686_10000611 JGI24751J29686_100006112 185
68 3300003323 rootH1_10207743 rootH1_102077432 185
69 3300005288 Ga0065714_10046969 Ga0065714_100469691 185
70 3300005289 Ga0065704_10169157 Ga0065704_101691572 185
71 3300005290 Ga0065712_10008503 Ga0065712_100085032 185
72 3300005290 Ga0065712_10016228 Ga0065712_100162283 185
73 3300005293 Ga0065715_10121072 Ga0065715_101210722 185
74 3300005295 Ga0065707_10680682 Ga0065707_106806821 185
75 3300005330 Ga0070690_100052089 Ga0070690_1000520892 185
76 3300005331 Ga0070670_100061004 Ga0070670_1000610042 185
77 3300005331 Ga0070670_100076421 Ga0070670_1000764213 185
78 3300005331 Ga0070670_101031550 Ga0070670_1010315502 185
79 3300005333 Ga0070677_10067032 Ga0070677_100670322 185
80 3300005334 Ga0068869_100037896 Ga0068869_1000378963 185
81 3300005334 Ga0068869_100395470 Ga0068869_1003954702 185
82 3300005334 Ga0068869_100629815 Ga0068869_1006298152 185
83 3300005337 Ga0070682_100000101 Ga0070682_10000010127 185
84 3300005340 Ga0070689_100096077 Ga0070689_1000960771 185
85 3300005340 Ga0070689_100241527 Ga0070689_1002415272 185
86 3300005343 Ga0070687_100058529 Ga0070687_1000585292 185
87 3300005343 Ga0070687_100208283 Ga0070687_1002082832 185
88 3300005353 Ga0070669_100046405 Ga0070669_1000464051 185
89 3300005353 Ga0070669_100047502 Ga0070669_1000475024 185
90 3300005364 Ga0070673_100056502 Ga0070673_1000565022 185
91 3300005364 Ga0070673_100101023 Ga0070673_1001010233 185
92 3300005364 Ga0070673_100473393 Ga0070673_1004733932 185
93 3300005364 Ga0070673_100555015 Ga0070673_1005550152 185
94 3300005365 Ga0070688_100024394 Ga0070688_1000243942 185
95 3300005456 Ga0070678_100970388 Ga0070678_1009703881 185
96 3300005459 Ga0068867_100271589 Ga0068867_1002715892 185
97 3300005466 Ga0070685_10108623 Ga0070685_101086232 185
98 3300005471 Ga0070698_100005764 Ga0070698_1000057645 185
99 3300005539 Ga0068853_100004753 Ga0068853_1000047533 185
100 3300005543 Ga0070672_100393654 Ga0070672_1003936542 185
101 3300005549 Ga0070704_100040346 Ga0070704_1000403463 185
102 3300005578 Ga0068854_100545884 Ga0068854_1005458842 185
103 3300005616 Ga0068852_101119714 Ga0068852_1011197142 185
104 3300005617 Ga0068859_100121426 Ga0068859_1001214263 185
105 3300005617 Ga0068859_100786942 Ga0068859_1007869422 185
106 3300005618 Ga0068864_100048758 Ga0068864_1000487582 185
107 3300005618 Ga0068864_100466611 Ga0068864_1004666112 185
108 3300005719 Ga0068861_100005893 Ga0068861_1000058934 185
109 3300005719 Ga0068861_101140988 Ga0068861_1011409881 185
110 3300005834 Ga0068851_10068773 Ga0068851_100687732 185
111 3300005834 Ga0068851_10069741 Ga0068851_100697412 185
112 3300005841 Ga0068863_100075894 Ga0068863_1000758943 185
113 3300005843 Ga0068860_100140603 Ga0068860_1001406032 185
114 3300005843 Ga0068860_101643004 Ga0068860_1016430041 185
115 3300005844 Ga0068862_100369685 Ga0068862_1003696852 185
116 3300005844 Ga0068862_100378682 Ga0068862_1003786822 185
117 3300006195 Ga0075366_10062783 Ga0075366_100627833 185
118 3300006844 Ga0075428_100052075 Ga0075428_1000520752 185
119 3300006846 Ga0075430_100593420 Ga0075430_1005934202 185
120 3300006847 Ga0075431_100127863 Ga0075431_1001278632 185
121 3300006880 Ga0075429_100005315 Ga0075429_10000531512 185
122 3300006931 Ga0097620_100121425 Ga0097620_1001214252 185
123 3300006931 Ga0097620_100786776 Ga0097620_1007867762 185
124 3300009093 Ga0105240_10601699 Ga0105240_106016991 185
125 3300009094 Ga0111539_10138953 Ga0111539_101389533 185
126 3300009176 Ga0105242_10002400 Ga0105242_100024007 185
127 3300009176 Ga0105242_10042029 Ga0105242_100420294 185
128 3300009176 Ga0105242_10195440 Ga0105242_101954402 185
129 3300009551 Ga0105238_10057019 Ga0105238_100570192 185
130 3300009551 Ga0105238_10473672 Ga0105238_104736722 185
131 3300009553 Ga0105249_10006698 Ga0105249_100066984 185
132 3300009553 Ga0105249_10009044 Ga0105249_100090445 185
133 3300009553 Ga0105249_10096659 Ga0105249_100966593 185
134 3300009553 Ga0105249_10267973 Ga0105249_102679732 185
135 3300010375 Ga0105239_10020869 Ga0105239_100208694 185
136 3300013102 Ga0157371_10353280 Ga0157371_103532802 185
137 3300013297 Ga0157378_10058147 Ga0157378_100581473 185
138 3300013306 Ga0163162_10033676 Ga0163162_100336765 185
139 3300013306 Ga0163162_10555607 Ga0163162_105556072 185
140 3300013308 Ga0157375_10074137 Ga0157375_100741372 185
141 3300013308 Ga0157375_10661752 Ga0157375_106617522 185
142 3300014325 Ga0163163_10665790 Ga0163163_106657902 185
143 3300014325 Ga0163163_11281391 Ga0163163_112813912 185
144 3300014326 Ga0157380_10017367 Ga0157380_100173674 185
145 3300014326 Ga0157380_10140915 Ga0157380_101409152 185
146 3300014326 Ga0157380_10143104 Ga0157380_101431042 185
147 3300014745 Ga0157377_10002480 Ga0157377_100024803 185
148 3300014969 Ga0157376_10174448 Ga0157376_101744482 185
149 3300014969 Ga0157376_10415708 Ga0157376_104157082 185
150 3300014969 Ga0157376_11598344 Ga0157376_115983441 185
151 3300017792 Ga0163161_10053027 Ga0163161_100530273 185
152 3300021384 Ga0213876_10277220 Ga0213876_102772202 185
153 3300025315 Ga0207697_10026089 Ga0207697_100260892 185
154 3300025893 Ga0207682_10018849 Ga0207682_100188492 185
155 3300025904 Ga0207647_10055707 Ga0207647_100557072 185
156 3300025907 Ga0207645_10145618 Ga0207645_101456182 185
157 3300025907 Ga0207645_10368515 Ga0207645_103685152 185
158 3300025908 Ga0207643_10048898 Ga0207643_100488983 185
159 3300025913 Ga0207695_10028280 Ga0207695_100282803 185
160 3300025918 Ga0207662_10062043 Ga0207662_100620433 185
161 3300025923 Ga0207681_10389604 Ga0207681_103896042 185
162 3300025923 Ga0207681_10846643 Ga0207681_108466432 185
163 3300025924 Ga0207694_10117417 Ga0207694_101174172 185
164 3300025925 Ga0207650_10059065 Ga0207650_100590652 185
165 3300025925 Ga0207650_10208464 Ga0207650_102084642 185
166 3300025925 Ga0207650_10359157 Ga0207650_103591572 185
167 3300025925 Ga0207650_10599027 Ga0207650_105990272 185
168 3300025933 Ga0207706_10288335 Ga0207706_102883352 185
169 3300025934 Ga0207686_10000715 Ga0207686_100007159 185
170 3300025934 Ga0207686_10078304 Ga0207686_100783041 185
171 3300025934 Ga0207686_10109900 Ga0207686_101099003 185
172 3300025936 Ga0207670_10009038 Ga0207670_100090382 185
173 3300025940 Ga0207691_10009967 Ga0207691_100099676 185
174 3300025942 Ga0207689_10035121 Ga0207689_100351213 185
175 3300025942 Ga0207689_10047854 Ga0207689_100478543 185
176 3300025960 Ga0207651_10014803 Ga0207651_100148034 185
177 3300025960 Ga0207651_10036157 Ga0207651_100361571 185
178 3300025960 Ga0207651_10371331 Ga0207651_103713312 185
179 3300025961 Ga0207712_10001188 Ga0207712_1000118813 185
180 3300025961 Ga0207712_10002851 Ga0207712_1000285110 185
181 3300025961 Ga0207712_10014921 Ga0207712_100149214 185
182 3300025961 Ga0207712_10053260 Ga0207712_100532603 185
183 3300025981 Ga0207640_10209040 Ga0207640_102090402 185
184 3300025981 Ga0207640_10475415 Ga0207640_104754152 185
185 3300025986 Ga0207658_10272238 Ga0207658_102722382 185
186 3300026035 Ga0207703_10633839 Ga0207703_106338392 185
187 3300026041 Ga0207639_10002436 Ga0207639_100024363 185
188 3300026041 Ga0207639_10024079 Ga0207639_100240792 185
189 3300026041 Ga0207639_10318891 Ga0207639_103188912 185
190 3300026041 Ga0207639_10480289 Ga0207639_104802892 185
191 3300026075 Ga0207708_10183476 Ga0207708_101834762 185
192 3300026088 Ga0207641_10000213 Ga0207641_1000021368 185
193 3300026088 Ga0207641_10018145 Ga0207641_100181455 185
194 3300026089 Ga0207648_10069357 Ga0207648_100693573 185
195 3300026089 Ga0207648_10193421 Ga0207648_101934213 185
196 3300026095 Ga0207676_10016401 Ga0207676_100164014 185
197 3300026116 Ga0207674_10063414 Ga0207674_100634142 185
198 3300026118 Ga0207675_100011637 Ga0207675_1000116373 185
199 3300026121 Ga0207683_10149149 Ga0207683_101491491 185
200 3300026142 Ga0207698_10846645 Ga0207698_108466452 185
201 3300027907 Ga0207428_10198410 Ga0207428_101984102 185
202 3300028380 Ga0268265_10114481 Ga0268265_101144814 185
203 3300028380 Ga0268265_10244984 Ga0268265_102449841 185
204 3300028381 Ga0268264_10149431 Ga0268264_101494312 185
205 3300028381 Ga0268264_10979609 Ga0268264_109796091 185
206 3300031456 Ga0307513_10485743 Ga0307513_104857432 185
207 3300031507 Ga0307509_10174317 Ga0307509_101743172 185
208 3300031911 Ga0307412_10094073 Ga0307412_100940732 185
209 3300039437 Ga0436365_1534476 Ga0436365_1534476_206_766 185
210 3300041509 Ga0451843_1169828 Ga0451843_1169828_91_651 185
211 3300042001 Ga0439441_059679 Ga0439441_059679_120_680 185
212 3300044712 Ga0453684_0096188 Ga0453684_0096188_1645_2205 185
213 3300046537 Ga0495598_0087575 Ga0495598_0087575_323_916 185
214 3300046539 Ga0495621_0034432 Ga0495621_0034432_474_1034 185
215 3300046539 Ga0495621_0225660 Ga0495621_0225660_56_649 185
216 3300047320 Ga0495672_0048991 Ga0495672_0048991_1596_2156 185
217 3300049569 Ga0501032_0044738 Ga0501032_0044738_1645_2205 185
218 3300049571 Ga0501034_0076899 Ga0501034_0076899_607_1167 185
219 3300049573 Ga0501037_0019761 Ga0501037_0019761_3467_4027 185
220 3300049574 Ga0501038_0005909 Ga0501038_0005909_1239_1799 185
221 3300049575 Ga0501039_0125305 Ga0501039_0125305_885_1445 185
222 3300049579 Ga0501043_0062294 Ga0501043_0062294_1086_1646 185
223 3300049580 Ga0501046_0019608 Ga0501046_0019608_1203_1763 185
224 3300049581 Ga0501047_0005143 Ga0501047_0005143_1233_1793 185
225 3300049583 Ga0501067_0048077 Ga0501067_0048077_1408_1968 185
226 3300049584 Ga0501068_0038333 Ga0501068_0038333_742_1302 185
227 3300049589 Ga0501073_0002414 Ga0501073_0002414_2997_3557 185
228 3300049590 Ga0501074_0064741 Ga0501074_0064741_235_795 185
229 3300049741 Ga0501079_0680110 Ga0501079_0680110_95_655 185
230 3300049742 Ga0501080_0000609 Ga0501080_0000609_10534_11094 185
231 3300049744 Ga0501083_0113275 Ga0501083_0113275_1063_1623 185
232 3300049822 Ga0501035_0303252 Ga0501035_0303252_392_952 185
233 3300050493 nmdc:mga0k408_282503_c1 nmdc:mga0k408_282503_c1_108_668 185
234 3300050493 nmdc:mga0k408_97056_c1 nmdc:mga0k408_97056_c1_969_1529 185
235 3300050507 nmdc:mga05p37_3553_c1 nmdc:mga05p37_3553_c1_9888_10448 185
236 3300050509 nmdc:mga0qj67_754498_c1 nmdc:mga0qj67_754498_c1_31_591 185
237 3300050510 nmdc:mga06r32_1452231_c1 nmdc:mga06r32_1452231_c1_43_603 185
238 3300050511 nmdc:mga08y16_168790_c1 nmdc:mga08y16_168790_c1_1530_2090 185
239 3300053092 Ga0500583_0000120 Ga0500583_0000120_23027_23587 185
240 3300053139 Ga0500568_0000609 Ga0500568_0000609_6353_6910 185
241 3300053163 Ga0500639_236193 Ga0500639_236193_38_598 185
242 3300053727 Ga0500611_120228 Ga0500611_120228_64_624 185
243 3300060353 Ga0501082_0010004 Ga0501082_0010004_5238_5798 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

18

190

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dzt-assembly1.cif.gz_B rmlc from salmonella typhimurium 0.9709 2 175
3ryk-assembly1.cif.gz_B 1.63 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase (rfbc) from bacillus anthracis str. ames with tdp and ppi bound 0.9705 2 174
7pvi-assembly1.cif.gz_BBB dtdp-sugar epimerase 0.9699 2 185
6c46-assembly2.cif.gz_C crystal structure of dtdp-4-dehydrorhamnose 3,5-epimerase from elizabethkingia anophelis nuhp1 0.9693 1 174
2ixh-assembly1.cif.gz_A rmlc p aeruginosa with dtdp-rhamnose 0.9689 1 177
ID Description Score Start End Superfamily
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9675 1 176 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9668 1 176 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9641 2 174 2.60.120.10
6dinA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9546 2 181 2.60.120.10
1ofnB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9493 1 176 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7X9PK35-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9953 44 179 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A1Y3NSB4-F1-model_v4 RmlD-like substrate binding domain-containing protein 0.994 1 174 GO:0005829
GO:0006556
GO:0008830
GO:0008831
GO:0019305
GO:0045226
AF-A0A350YWE6-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9935 1 136 GO:0000271
GO:0005829
GO:0008830
GO:0019305
AF-A0A350MPY5-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.9923 2 148 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A2E6AY78-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13) (Thymidine diphospho-4-keto-rhamnose 3,5-epimerase) 0.992 41 179 GO:0000271
GO:0005829
GO:0008830
GO:0019305

Feature Viewer

pLDDT pTM Quality
97.34 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map