F355484

General Info

Members Datasets Scaffolds Average Seq Length
243 157 486 159

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100440803|Ga0068871_1004408032
Length 192
Sequence MTGNMATAPANRDRNPGIIDKDTPISREHKEHTNVKPKNTICLWFDKDAQEAAIFYAATFPDSKVTAVHEAPGDFPGGKKGDVLTVEFTVVGIPCLGLNGGPAFRQSEAFSFQIATDNQEETDRYWNAIVGNGGTESACGWCKDRWGLSWQITPRALTDALAAGGSEAKRAFEVMMTMKKIDVAAIEAARRG

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
92 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
114 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
115 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
116 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
122 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
123 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
124 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
156 2818991467 Bosea vestrisii 3192 Isolate Unclassified
157 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.88
Nodule 0.82
Rhizoplane 7
Rhizosphere 84.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100440803 3300006358 Bacteria 1166
2 JGI25150J39212_1003061 3300002774 Bacteria 4003
3 Ga0065712_10069397 3300005290 Bacteria 7383
4 Ga0065712_10256491 3300005290 Bacteria 947
5 Ga0065715_10745206 3300005293 Bacteria 611
6 Ga0070658_10174233 3300005327 Bacteria 1808
7 Ga0070683_100139563 3300005329 Bacteria 2296
8 Ga0070683_100279589 3300005329 Bacteria 1588
9 Ga0070680_100240502 3300005336 Bacteria 1530
10 Ga0070680_100319896 3300005336 Bacteria 1317
11 Ga0070682_100163545 3300005337 Bacteria 1539
12 Ga0068868_100033648 3300005338 Bacteria 3952
13 Ga0070671_100064098 3300005355 Bacteria 3061
14 Ga0070671_100138745 3300005355 Bacteria 2051
15 Ga0070671_100146983 3300005355 Bacteria 1990
16 Ga0070671_100196150 3300005355 Bacteria 1712
17 Ga0070673_100051604 3300005364 Bacteria 3223
18 Ga0070673_100059853 3300005364 Bacteria 3016
19 Ga0070673_100210596 3300005364 Bacteria 1679
20 Ga0070659_100834219 3300005366 Bacteria 803
21 Ga0070667_100296314 3300005367 Bacteria 1455
22 Ga0070663_100206322 3300005455 Bacteria 1537
23 Ga0070678_100012064 3300005456 Bacteria 5355
24 Ga0070678_100089261 3300005456 Bacteria 2359
25 Ga0070662_100022414 3300005457 Bacteria 4324
26 Ga0070681_10023881 3300005458 Bacteria 6155
27 Ga0070681_10304604 3300005458 Bacteria 1503
28 Ga0068853_100369471 3300005539 Bacteria 1338
29 Ga0068853_100440943 3300005539 Bacteria 1224
30 Ga0070672_100177719 3300005543 Bacteria 1773
31 Ga0070665_100451779 3300005548 Bacteria 1295
32 Ga0068855_101595819 3300005563 Bacteria 668
33 Ga0070664_100808819 3300005564 Bacteria 877
34 Ga0068857_100187772 3300005577 Bacteria 1882
35 Ga0068863_100164815 3300005841 Bacteria 2125
36 Ga0068863_101499757 3300005841 Bacteria 683
37 Ga0068858_100054725 3300005842 Bacteria 3690
38 Ga0081455_10662302 3300005937 Bacteria 670
39 Ga0075365_10055373 3300006038 Bacteria 2632
40 Ga0075369_10049123 3300006186 Bacteria 1822
41 Ga0097621_100024917 3300006237 Bacteria 4677
42 Ga0068871_100065015 3300006358 Bacteria 2987
43 Ga0068871_100307470 3300006358 Bacteria 1393
44 Ga0075430_100105807 3300006846 Bacteria 2348
45 Ga0075431_100261589 3300006847 Bacteria 1755
46 Ga0075431_100638663 3300006847 Bacteria 1046
47 Ga0068865_100088782 3300006881 Bacteria 2237
48 Ga0099826_10030416 3300006948 Bacteria 3922
49 Ga0111539_10005464 3300009094 Bacteria 16439
50 Ga0111539_10064555 3300009094 Bacteria 4330
51 Ga0105245_10251822 3300009098 Bacteria 1716
52 Ga0105245_10367274 3300009098 Bacteria 1430
53 Ga0105245_10484412 3300009098 Bacteria 1251
54 Ga0105241_10052416 3300009174 Bacteria 3115
55 Ga0105242_10584142 3300009176 Bacteria 1076
56 Ga0105242_11191944 3300009176 Bacteria 780
57 Ga0105248_10029540 3300009177 Bacteria 6115
58 Ga0105248_10080823 3300009177 Bacteria 3654
59 Ga0105248_11667119 3300009177 Bacteria 723
60 Ga0105249_10612775 3300009553 Bacteria 1144
61 Ga0105239_10120128 3300010375 Bacteria 2917
62 Ga0157373_10055191 3300013100 Bacteria 2822
63 Ga0157369_10113635 3300013105 Bacteria 2876
64 Ga0157374_10112241 3300013296 Bacteria 2623
65 Ga0157374_10265665 3300013296 Bacteria 1691
66 Ga0157374_10467417 3300013296 Bacteria 1264
67 Ga0163162_10014358 3300013306 Bacteria 7741
68 Ga0163162_10185308 3300013306 Bacteria 2208
69 Ga0163162_10437821 3300013306 Bacteria 1439
70 Ga0163162_10496287 3300013306 Bacteria 1351
71 Ga0157375_10704935 3300013308 Bacteria 1163
72 Ga0163163_10187116 3300014325 Bacteria 2118
73 Ga0163163_10357396 3300014325 Bacteria 1517
74 Ga0157380_10832751 3300014326 Bacteria 943
75 Ga0157379_10276608 3300014968 Bacteria 1527
76 Ga0157376_10121735 3300014969 Bacteria 2314
77 Ga0157376_10404891 3300014969 Bacteria 1320
78 Ga0157376_10774937 3300014969 Bacteria 970
79 Ga0157376_10857751 3300014969 Bacteria 924
80 Ga0163161_10274698 3300017792 Bacteria 1320
81 Ga0163161_12033424 3300017792 Bacteria 511
82 Ga0207705_10169190 3300025909 Bacteria 1645
83 Ga0207707_10155572 3300025912 Bacteria 1999
84 Ga0207707_10248050 3300025912 Bacteria 1547
85 Ga0207660_10136238 3300025917 Bacteria 1874
86 Ga0207652_10193630 3300025921 Bacteria 1829
87 Ga0207659_10400783 3300025926 Bacteria 1147
88 Ga0207687_10317307 3300025927 Bacteria 1260
89 Ga0207644_10054872 3300025931 Bacteria 2870
90 Ga0207644_10078694 3300025931 Bacteria 2431
91 Ga0207644_10340483 3300025931 Bacteria 1216
92 Ga0207706_10229493 3300025933 Bacteria 1625
93 Ga0207669_10744069 3300025937 Bacteria 809
94 Ga0207711_10633971 3300025941 Bacteria 997
95 Ga0207711_10687907 3300025941 Bacteria 954
96 Ga0207661_10909400 3300025944 Bacteria 810
97 Ga0207679_10089075 3300025945 Bacteria 2381
98 Ga0207651_10017281 3300025960 Bacteria 4257
99 Ga0207651_10043919 3300025960 Bacteria 2987
100 Ga0207658_10634181 3300025986 Bacteria 962
101 Ga0207677_10053450 3300026023 Bacteria 2749
102 Ga0207639_10231508 3300026041 Bacteria 1602
103 Ga0207639_10339905 3300026041 Bacteria 1338
104 Ga0207678_10794349 3300026067 Bacteria 835
105 Ga0207702_10922805 3300026078 Bacteria 865
106 Ga0207641_10029919 3300026088 Bacteria 4506
107 Ga0207641_10146504 3300026088 Bacteria 2135
108 Ga0207641_11875520 3300026088 Bacteria 601
109 Ga0207676_10332919 3300026095 Bacteria 1398
110 Ga0207683_10118720 3300026121 Bacteria 2373
111 Ga0209974_10114219 3300027876 Bacteria 952
112 Ga0207428_10110762 3300027907 Bacteria 2113
113 Ga0268264_10212882 3300028381 Bacteria 1775
114 Ga0307515_10109372 3300028794 Bacteria 3246
115 Ga0265339_10101314 3300031249 Bacteria 1498
116 Ga0307516_10355050 3300031730 Bacteria 1131
117 Ga0307413_10392540 3300031824 Bacteria 1085
118 Ga0307413_10526807 3300031824 Bacteria 954
119 Ga0307412_10225721 3300031911 Bacteria 1439
120 Ga0307415_100363469 3300032126 Bacteria 1223
121 Ga0307415_101045157 3300032126 Bacteria 762
122 Ga0307415_101821661 3300032126 Bacteria 589
123 Ga0373946_0518290 3300035171 Bacteria 613
124 Ga0373927_0594133 3300035695 Bacteria 732
125 Ga0373933_0195212 3300035724 Bacteria 1294
126 Ga0373937_0201588 3300036401 Bacteria 1870
127 Ga0395900_0090173 3300037418 Bacteria 3151
128 Ga0395901_0076964 3300038443 Bacteria 3481
129 Ga0451807_1493573 3300041486 Bacteria 1017
130 Ga0451833_0471330 3300041491 Bacteria 621
131 Ga0451837_1296518 3300041494 Bacteria 540
132 Ga0451839_0165818 3300041496 Bacteria 612
133 Ga0439433_0057899 3300041999 Bacteria 921
134 Ga0450901_002990 3300042533 Bacteria 1784
135 Ga0451577_0000595 3300042876 Bacteria 58048
136 Ga0451577_0056316 3300042876 Bacteria 3506
137 Ga0451577_0297263 3300042876 Bacteria 1463
138 Ga0466965_0286310 3300044683 Bacteria 891
139 Ga0453684_0000327 3300044712 Bacteria 200341
140 Ga0453684_0073019 3300044712 Bacteria 4327
141 Ga0453684_0181663 3300044712 Bacteria 2469
142 Ga0451576_0051431 3300045051 Bacteria 4320
143 Ga0466967_0051328 3300045976 Bacteria 3614
144 Ga0495629_0011949 3300046459 Bacteria 6297
145 Ga0495651_0221473 3300046462 Bacteria 1309
146 Ga0495652_0092652 3300046529 Bacteria 2468
147 Ga0495587_0033911 3300046536 Bacteria 3080
148 Ga0495645_0037819 3300046543 Bacteria 3518
149 Ga0495613_0156906 3300046689 Bacteria 1621
150 Ga0495600_0159154 3300046809 Bacteria 1460
151 Ga0495674_0202178 3300047319 Bacteria 1648
152 Ga0495672_0000242 3300047320 Bacteria 76766
153 Ga0495676_0657590 3300047321 Bacteria 680
154 Ga0495684_0675583 3300047471 Bacteria 688
155 Ga0495686_0000007 3300047472 Bacteria 732622
156 Ga0496101_0072698 3300048904 Bacteria 2525
157 Ga0496101_0101149 3300048904 Bacteria 2158
158 Ga0496101_0755444 3300048904 Bacteria 767
159 Ga0496102_0014891 3300048905 Bacteria 6766
160 Ga0496104_0142071 3300048907 Bacteria 2306
161 Ga0496104_0285761 3300048907 Bacteria 1562
162 Ga0496105_0039758 3300048908 Bacteria 3878
163 Ga0496105_0277244 3300048908 Bacteria 1353
164 Ga0496106_0499786 3300048909 Bacteria 977
165 Ga0496107_0394231 3300048910 Bacteria 1030
166 Ga0496108_0228588 3300048911 Bacteria 1617
167 Ga0496109_0133248 3300048912 Bacteria 2321
168 Ga0496112_0082744 3300048915 Bacteria 3174
169 Ga0496112_0087329 3300048915 Bacteria 3085
170 Ga0496113_0019304 3300048916 Bacteria 4766
171 Ga0496114_0000004 3300048917 Bacteria 591126
172 Ga0496117_0095097 3300048920 Bacteria 1905
173 Ga0496117_0552674 3300048920 Bacteria 548
174 Ga0496122_0138891 3300048925 Bacteria 1524
175 Ga0496123_0039712 3300048926 Bacteria 3288
176 Ga0496126_0377478 3300048929 Bacteria 1155
177 Ga0501032_0032809 3300049569 Bacteria 3558
178 Ga0501032_0035206 3300049569 Bacteria 3425
179 Ga0501032_0223361 3300049569 Bacteria 1225
180 Ga0501032_0477707 3300049569 Bacteria 797
181 Ga0501033_0047571 3300049570 Bacteria 3189
182 Ga0501033_0066532 3300049570 Bacteria 2650
183 Ga0501034_0000071 3300049571 Bacteria 180636
184 Ga0501034_0000104 3300049571 Bacteria 155848
185 Ga0501034_0004999 3300049571 Bacteria 14589
186 Ga0501034_0126984 3300049571 Bacteria 2535
187 Ga0501034_0667244 3300049571 Bacteria 940
188 Ga0501036_0095566 3300049572 Bacteria 2512
189 Ga0501036_0512631 3300049572 Bacteria 998
190 Ga0501037_0000712 3300049573 Bacteria 25281
191 Ga0501037_0018150 3300049573 Bacteria 5183
192 Ga0501037_0419355 3300049573 Bacteria 916
193 Ga0501042_0049785 3300049578 Bacteria 2990
194 Ga0501043_0199050 3300049579 Bacteria 1556
195 Ga0501043_0251052 3300049579 Bacteria 1362
196 Ga0501046_0138733 3300049580 Bacteria 1841
197 Ga0501047_0000824 3300049581 Bacteria 32137
198 Ga0501047_0001794 3300049581 Bacteria 20777
199 Ga0501047_0081453 3300049581 Bacteria 3111
200 Ga0501047_0288168 3300049581 Bacteria 1486
201 Ga0501047_0311213 3300049581 Bacteria 1415
202 Ga0501047_0506713 3300049581 Bacteria 1033
203 Ga0501047_0631235 3300049581 Bacteria 891
204 Ga0501047_0714880 3300049581 Bacteria 819
205 Ga0501048_0048857 3300049582 Bacteria 3017
206 Ga0501067_0000875 3300049583 Bacteria 16166
207 Ga0501067_0130937 3300049583 Bacteria 1396
208 Ga0501070_0807807 3300049586 Bacteria 736
209 Ga0501072_1290578 3300049588 Bacteria 566
210 Ga0501073_0000001 3300049589 Bacteria 677932
211 Ga0501073_0044136 3300049589 Bacteria 3141
212 Ga0501073_0331626 3300049589 Bacteria 1050
213 Ga0501074_0245008 3300049590 Bacteria 1275
214 Ga0501076_0126296 3300049592 Bacteria 2073
215 Ga0501077_0056684 3300049593 Bacteria 2487
216 Ga0501080_0009674 3300049742 Bacteria 8801
217 Ga0501083_0075917 3300049744 Bacteria 2231
218 Ga0501035_0000506 3300049822 Bacteria 43989
219 Ga0501035_0044490 3300049822 Bacteria 3998
220 Ga0501035_0267440 3300049822 Bacteria 1448
221 Ga0501035_0675300 3300049822 Bacteria 835
222 Ga0501044_0012788 3300049823 Bacteria 9090
223 Ga0501044_0013200 3300049823 Bacteria 8946
224 nmdc:mga0k408_865640_c1 3300050493 Bacteria 525
225 nmdc:mga0qj67_112833_c1 3300050509 Bacteria 2194
226 nmdc:mga06r32_172040_c1 3300050510 Bacteria 2150
227 nmdc:mga06r32_488248_c1 3300050510 Bacteria 1209
228 nmdc:mga08y16_36165_c1 3300050511 Bacteria 5186
229 nmdc:mga08y16_56757_c1 3300050511 Bacteria 4092
230 nmdc:mga08x19_925376_c1 3300050514 Bacteria 619
231 Ga0495595_0148977 3300053084 Bacteria 1151
232 Ga0495595_0444424 3300053084 Bacteria 659
233 Ga0500604_0178426 3300053151 Bacteria 727
234 Ga0500616_0087727 3300053153 Bacteria 1548
235 Ga0500616_0164231 3300053153 Bacteria 1015
236 Ga0501084_0059326 3300054114 Bacteria 3202
237 Ga0501084_0195803 3300054114 Bacteria 1705
238 Ga0501084_0280057 3300054114 Bacteria 1408
239 Ga0501084_0765589 3300054114 Bacteria 813
240 Ga0501082_0001140 3300060353 Bacteria 23441
241 Ga0501082_0153516 3300060353 Bacteria 2000
242 2819716901 2818991467 Bacteria 5893227
243 2869167491 2869162929 Bacteria 6399702
244 Ga0068871_100440803
245 JGI25150J39212_1003061
246 Ga0065712_10069397
247 Ga0065712_10256491
248 Ga0065715_10745206
249 Ga0070658_10174233
250 Ga0070683_100139563
251 Ga0070683_100279589
252 Ga0070680_100240502
253 Ga0070680_100319896
254 Ga0070682_100163545
255 Ga0068868_100033648
256 Ga0070671_100064098
257 Ga0070671_100138745
258 Ga0070671_100146983
259 Ga0070671_100196150
260 Ga0070673_100051604
261 Ga0070673_100059853
262 Ga0070673_100210596
263 Ga0070659_100834219
264 Ga0070667_100296314
265 Ga0070663_100206322
266 Ga0070678_100012064
267 Ga0070678_100089261
268 Ga0070662_100022414
269 Ga0070681_10023881
270 Ga0070681_10304604
271 Ga0068853_100369471
272 Ga0068853_100440943
273 Ga0070672_100177719
274 Ga0070665_100451779
275 Ga0068855_101595819
276 Ga0070664_100808819
277 Ga0068857_100187772
278 Ga0068863_100164815
279 Ga0068863_101499757
280 Ga0068858_100054725
281 Ga0081455_10662302
282 Ga0075365_10055373
283 Ga0075369_10049123
284 Ga0097621_100024917
285 Ga0068871_100065015
286 Ga0068871_100307470
287 Ga0075430_100105807
288 Ga0075431_100261589
289 Ga0075431_100638663
290 Ga0068865_100088782
291 Ga0099826_10030416
292 Ga0111539_10005464
293 Ga0111539_10064555
294 Ga0105245_10251822
295 Ga0105245_10367274
296 Ga0105245_10484412
297 Ga0105241_10052416
298 Ga0105242_10584142
299 Ga0105242_11191944
300 Ga0105248_10029540
301 Ga0105248_10080823
302 Ga0105248_11667119
303 Ga0105249_10612775
304 Ga0105239_10120128
305 Ga0157373_10055191
306 Ga0157369_10113635
307 Ga0157374_10112241
308 Ga0157374_10265665
309 Ga0157374_10467417
310 Ga0163162_10014358
311 Ga0163162_10185308
312 Ga0163162_10437821
313 Ga0163162_10496287
314 Ga0157375_10704935
315 Ga0163163_10187116
316 Ga0163163_10357396
317 Ga0157380_10832751
318 Ga0157379_10276608
319 Ga0157376_10121735
320 Ga0157376_10404891
321 Ga0157376_10774937
322 Ga0157376_10857751
323 Ga0163161_10274698
324 Ga0163161_12033424
325 Ga0207705_10169190
326 Ga0207707_10155572
327 Ga0207707_10248050
328 Ga0207660_10136238
329 Ga0207652_10193630
330 Ga0207659_10400783
331 Ga0207687_10317307
332 Ga0207644_10054872
333 Ga0207644_10078694
334 Ga0207644_10340483
335 Ga0207706_10229493
336 Ga0207669_10744069
337 Ga0207711_10633971
338 Ga0207711_10687907
339 Ga0207661_10909400
340 Ga0207679_10089075
341 Ga0207651_10017281
342 Ga0207651_10043919
343 Ga0207658_10634181
344 Ga0207677_10053450
345 Ga0207639_10231508
346 Ga0207639_10339905
347 Ga0207678_10794349
348 Ga0207702_10922805
349 Ga0207641_10029919
350 Ga0207641_10146504
351 Ga0207641_11875520
352 Ga0207676_10332919
353 Ga0207683_10118720
354 Ga0209974_10114219
355 Ga0207428_10110762
356 Ga0268264_10212882
357 Ga0307515_10109372
358 Ga0265339_10101314
359 Ga0307516_10355050
360 Ga0307413_10392540
361 Ga0307413_10526807
362 Ga0307412_10225721
363 Ga0307415_100363469
364 Ga0307415_101045157
365 Ga0307415_101821661
366 Ga0373946_0518290
367 Ga0373927_0594133
368 Ga0373933_0195212
369 Ga0373937_0201588
370 Ga0395900_0090173
371 Ga0395901_0076964
372 Ga0451807_1493573
373 Ga0451833_0471330
374 Ga0451837_1296518
375 Ga0451839_0165818
376 Ga0439433_0057899
377 Ga0450901_002990
378 Ga0451577_0000595
379 Ga0451577_0056316
380 Ga0451577_0297263
381 Ga0466965_0286310
382 Ga0453684_0000327
383 Ga0453684_0073019
384 Ga0453684_0181663
385 Ga0451576_0051431
386 Ga0466967_0051328
387 Ga0495629_0011949
388 Ga0495651_0221473
389 Ga0495652_0092652
390 Ga0495587_0033911
391 Ga0495645_0037819
392 Ga0495613_0156906
393 Ga0495600_0159154
394 Ga0495674_0202178
395 Ga0495672_0000242
396 Ga0495676_0657590
397 Ga0495684_0675583
398 Ga0495686_0000007
399 Ga0496101_0072698
400 Ga0496101_0101149
401 Ga0496101_0755444
402 Ga0496102_0014891
403 Ga0496104_0142071
404 Ga0496104_0285761
405 Ga0496105_0039758
406 Ga0496105_0277244
407 Ga0496106_0499786
408 Ga0496107_0394231
409 Ga0496108_0228588
410 Ga0496109_0133248
411 Ga0496112_0082744
412 Ga0496112_0087329
413 Ga0496113_0019304
414 Ga0496114_0000004
415 Ga0496117_0095097
416 Ga0496117_0552674
417 Ga0496122_0138891
418 Ga0496123_0039712
419 Ga0496126_0377478
420 Ga0501032_0032809
421 Ga0501032_0035206
422 Ga0501032_0223361
423 Ga0501032_0477707
424 Ga0501033_0047571
425 Ga0501033_0066532
426 Ga0501034_0000071
427 Ga0501034_0000104
428 Ga0501034_0004999
429 Ga0501034_0126984
430 Ga0501034_0667244
431 Ga0501036_0095566
432 Ga0501036_0512631
433 Ga0501037_0000712
434 Ga0501037_0018150
435 Ga0501037_0419355
436 Ga0501042_0049785
437 Ga0501043_0199050
438 Ga0501043_0251052
439 Ga0501046_0138733
440 Ga0501047_0000824
441 Ga0501047_0001794
442 Ga0501047_0081453
443 Ga0501047_0288168
444 Ga0501047_0311213
445 Ga0501047_0506713
446 Ga0501047_0631235
447 Ga0501047_0714880
448 Ga0501048_0048857
449 Ga0501067_0000875
450 Ga0501067_0130937
451 Ga0501070_0807807
452 Ga0501072_1290578
453 Ga0501073_0000001
454 Ga0501073_0044136
455 Ga0501073_0331626
456 Ga0501074_0245008
457 Ga0501076_0126296
458 Ga0501077_0056684
459 Ga0501080_0009674
460 Ga0501083_0075917
461 Ga0501035_0000506
462 Ga0501035_0044490
463 Ga0501035_0267440
464 Ga0501035_0675300
465 Ga0501044_0012788
466 Ga0501044_0013200
467 nmdc:mga0k408_865640_c1
468 nmdc:mga0qj67_112833_c1
469 nmdc:mga06r32_172040_c1
470 nmdc:mga06r32_488248_c1
471 nmdc:mga08y16_36165_c1
472 nmdc:mga08y16_56757_c1
473 nmdc:mga08x19_925376_c1
474 Ga0495595_0148977
475 Ga0495595_0444424
476 Ga0500604_0178426
477 Ga0500616_0087727
478 Ga0500616_0164231
479 Ga0501084_0059326
480 Ga0501084_0195803
481 Ga0501084_0280057
482 Ga0501084_0765589
483 Ga0501082_0001140
484 Ga0501082_0153516
485 2819716901
486 2869167491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

37

153

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.7986 1 117
1tsj-assembly1.cif.gz_A crystal structure of protein from staphylococcus aureus 0.755 1 117
8bxl-assembly3.cif.gz_E patulin synthase from penicillium expansum 0.711 28 64
8ckb-assembly1.cif.gz_E002 asymmetric reconstruction of the crass001 virion 0.6661 78 119
1kmz-assembly1.cif.gz_A molecular basis of mitomycin c resictance in streptomyces: crystal structures of the mrd protein with and without a drug derivative 0.6287 5 119
ID Description Score Start End Superfamily
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8708 78 119 3.30.720.110
af_A0A1D8PQM9_7_118_1.10.8.1290 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1, domain 1 0.8198 122 151 1.10.8.1290
af_Q9Y7Y8_3_120_1.10.8.1290 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1, domain 1 0.7867 122 151 1.10.8.1290
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7719 7 64 3.30.720.100
1tsjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7204 1 117 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A519PAD1-F1-model_v4 deleted 0.9875 1 60
AF-A0A435UWU8-F1-model_v4 deleted 0.9815 78 152
AF-A0A1G4T9J9-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9794 78 152 GO:0008168
GO:0032259
AF-H0FSF1-F1-model_v4 PhnB-like domain-containing protein 0.9744 78 152
AF-A0A531K413-F1-model_v4 VOC family protein 0.9741 1 60

Map