F355628
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 243 | 188 | 237 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300014969|Ga0157376_10111716|Ga0157376_101117161 |
| Length | 325 |
| Sequence | MHDNDLPDLPCYLYGEFIRLRDAKVSVMDRGFIFGDGVYEVVPVYAGRPFRFEHHMARLDRSLGELRIANPMTHGQWRELADRLIADFAASLGRPVAQTDQLVYLQVTRGVAMRDHAMLPGLKPTVFAMSNRITPPGAADRANGVACVSADDFRWKKAHIKSVSLLGSVMARQISVDAGAAETVMFRDGFLSEAAAANVWVVKGGVVIGPPRDNLVLEGIRYGLIGELCRDSGIGFQLRRIARDEVFAADELLLSNASKEILPVTRLDGRPIGTGRPGPIYEKLYAGYQREKVNHPRSGLRPPPPQGGATSGPAKPVPRSPANKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 3 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 4 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 48 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 51 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 67 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 81 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 114 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 118 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 119 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 122 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 123 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 124 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 127 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 128 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 130 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 131 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 132 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 133 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 134 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 137 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 138 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 139 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 140 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 154 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 161 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 162 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 163 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 164 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 176 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 177 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 178 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 179 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 180 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 181 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 182 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 184 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 185 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 186 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 187 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 188 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.53 |
| Metatranscriptomes | 0 |
| Isolates | 2.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.87 |
| Nodule | 0 |
| Rhizoplane | 5.76 |
| Rhizosphere | 62.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1000040 | 3300002705 | Bacteria | 106617 |
| 2 | JGI25154J39366_1000060 | 3300002738 | Bacteria | 106617 |
| 3 | JGI25157J39369_1000058 | 3300002741 | Bacteria | 106617 |
| 4 | JGI25159J45721_1005752 | 3300002987 | Bacteria | 3835 |
| 5 | JGI25159J45721_1008761 | 3300002987 | Bacteria | 2746 |
| 6 | JGI25160J50197_1000198 | 3300003354 | Bacteria | 50243 |
| 7 | JGI25161J50226_1000021 | 3300003374 | Bacteria | 163584 |
| 8 | Ga0055526_1002001 | 3300003771 | Bacteria | 14042 |
| 9 | Ga0055526_1013484 | 3300003771 | Bacteria | 3451 |
| 10 | Ga0055537_1000265 | 3300003773 | Bacteria | 38230 |
| 11 | Ga0055524_1000338 | 3300003775 | Bacteria | 43287 |
| 12 | Ga0055524_1001001 | 3300003775 | Bacteria | 17617 |
| 13 | Ga0055534_1003904 | 3300003784 | Bacteria | 4521 |
| 14 | Ga0055528_1001252 | 3300003790 | Bacteria | 16135 |
| 15 | Ga0055530_10005110 | 3300003791 | Bacteria | 6420 |
| 16 | Ga0055540_1000274 | 3300003792 | Bacteria | 46571 |
| 17 | Ga0055531_10001023 | 3300003794 | Bacteria | 22138 |
| 18 | Ga0055531_10003006 | 3300003794 | Bacteria | 10943 |
| 19 | Ga0055543_1000107 | 3300004625 | Bacteria | 71784 |
| 20 | Ga0065165_1012553 | 3300005262 | Bacteria | 3442 |
| 21 | Ga0065715_10109686 | 3300005293 | Bacteria | 2657 |
| 22 | Ga0070658_10237365 | 3300005327 | Bacteria | 1545 |
| 23 | Ga0070670_100021726 | 3300005331 | Bacteria | 5519 |
| 24 | Ga0070670_100259134 | 3300005331 | Bacteria | 1516 |
| 25 | Ga0068869_100000007 | 3300005334 | Bacteria | 78820 |
| 26 | Ga0068868_100049628 | 3300005338 | Bacteria | 3294 |
| 27 | Ga0070689_100017953 | 3300005340 | Bacteria | 5202 |
| 28 | Ga0070668_100011276 | 3300005347 | Bacteria | 6656 |
| 29 | Ga0070673_100039686 | 3300005364 | Bacteria | 3605 |
| 30 | Ga0070667_100000332 | 3300005367 | Bacteria | 52616 |
| 31 | Ga0070709_10042631 | 3300005434 | Bacteria | 2804 |
| 32 | Ga0070662_100056848 | 3300005457 | Bacteria | 2841 |
| 33 | Ga0070681_10002150 | 3300005458 | Bacteria | 17921 |
| 34 | Ga0068867_100000694 | 3300005459 | Bacteria | 22406 |
| 35 | Ga0070679_100004108 | 3300005530 | Bacteria | 13421 |
| 36 | Ga0070679_100004470 | 3300005530 | Bacteria | 12914 |
| 37 | Ga0068853_100239623 | 3300005539 | Bacteria | 1662 |
| 38 | Ga0068855_100002511 | 3300005563 | Bacteria | 22597 |
| 39 | Ga0068855_100154992 | 3300005563 | Bacteria | 2603 |
| 40 | Ga0068855_100161898 | 3300005563 | Bacteria | 2539 |
| 41 | Ga0068857_100001549 | 3300005577 | Bacteria | 18409 |
| 42 | Ga0068857_100098667 | 3300005577 | Bacteria | 2620 |
| 43 | Ga0068856_100184650 | 3300005614 | Bacteria | 2099 |
| 44 | Ga0068859_100000241 | 3300005617 | Bacteria | 53802 |
| 45 | Ga0068864_100004428 | 3300005618 | Bacteria | 11542 |
| 46 | Ga0068866_10099096 | 3300005718 | Bacteria | 1604 |
| 47 | Ga0068870_10002462 | 3300005840 | Bacteria | 7715 |
| 48 | Ga0068863_100002079 | 3300005841 | Bacteria | 19853 |
| 49 | Ga0068858_100000331 | 3300005842 | Bacteria | 50044 |
| 50 | Ga0068860_100001594 | 3300005843 | Bacteria | 24359 |
| 51 | Ga0068862_100007775 | 3300005844 | Bacteria | 8865 |
| 52 | Ga0075365_10023655 | 3300006038 | Bacteria | 3867 |
| 53 | Ga0075363_100032958 | 3300006048 | Bacteria | 2694 |
| 54 | Ga0075362_10007084 | 3300006177 | Bacteria | 4219 |
| 55 | Ga0075362_10160040 | 3300006177 | Bacteria | 1084 |
| 56 | Ga0075366_10007032 | 3300006195 | Bacteria | 6191 |
| 57 | Ga0075366_10101179 | 3300006195 | Bacteria | 1729 |
| 58 | Ga0075434_100210569 | 3300006871 | Bacteria | 1964 |
| 59 | Ga0097620_100000241 | 3300006931 | Bacteria | 53802 |
| 60 | Ga0105240_10011576 | 3300009093 | Bacteria | 12274 |
| 61 | Ga0105240_10508550 | 3300009093 | Bacteria | 1338 |
| 62 | Ga0111539_10219629 | 3300009094 | Bacteria | 2214 |
| 63 | Ga0105245_10064056 | 3300009098 | Bacteria | 3322 |
| 64 | Ga0105247_10062547 | 3300009101 | Bacteria | 2309 |
| 65 | Ga0105241_10084034 | 3300009174 | Bacteria | 2498 |
| 66 | Ga0105248_10005176 | 3300009177 | Bacteria | 14379 |
| 67 | Ga0105237_10167359 | 3300009545 | Bacteria | 2197 |
| 68 | Ga0105239_10054644 | 3300010375 | Bacteria | 4381 |
| 69 | Ga0105239_10363937 | 3300010375 | Bacteria | 1634 |
| 70 | Ga0157373_10001519 | 3300013100 | Bacteria | 17693 |
| 71 | Ga0157372_10086758 | 3300013307 | Bacteria | 3551 |
| 72 | Ga0157375_10013427 | 3300013308 | Bacteria | 7288 |
| 73 | Ga0157379_10000142 | 3300014968 | Bacteria | 51727 |
| 74 | Ga0157376_10111716 | 3300014969 | Bacteria | 2407 |
| 75 | Ga0213872_10000367 | 3300021361 | Bacteria | 38078 |
| 76 | Ga0209435_100019 | 3300025206 | Bacteria | 260989 |
| 77 | Ga0209646_1000038 | 3300025246 | Bacteria | 353982 |
| 78 | Ga0209026_1000048 | 3300025250 | Bacteria | 257264 |
| 79 | Ga0209759_1000038 | 3300025256 | Bacteria | 257264 |
| 80 | Ga0209565_1000309 | 3300025263 | Bacteria | 45428 |
| 81 | Ga0209565_1002905 | 3300025263 | Bacteria | 5856 |
| 82 | Ga0209673_1000088 | 3300025273 | Bacteria | 204629 |
| 83 | Ga0209673_1014574 | 3300025273 | Bacteria | 3035 |
| 84 | Ga0209130_1000103 | 3300025284 | Bacteria | 137115 |
| 85 | Ga0209130_1004160 | 3300025284 | Bacteria | 5665 |
| 86 | Ga0209675_1000133 | 3300025291 | Bacteria | 101207 |
| 87 | Ga0209675_1016392 | 3300025291 | Bacteria | 2160 |
| 88 | Ga0209676_1000073 | 3300025292 | Bacteria | 305947 |
| 89 | Ga0209676_1002105 | 3300025292 | Bacteria | 15331 |
| 90 | Ga0209025_1012041 | 3300025294 | Bacteria | 5604 |
| 91 | Ga0209025_1039332 | 3300025294 | Bacteria | 2064 |
| 92 | Ga0209564_1000702 | 3300025295 | Bacteria | 49036 |
| 93 | Ga0209564_1001205 | 3300025295 | Bacteria | 29514 |
| 94 | Ga0209564_1007939 | 3300025295 | Bacteria | 5345 |
| 95 | Ga0209758_1014270 | 3300025297 | Bacteria | 4242 |
| 96 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 97 | Ga0209256_1000096 | 3300025299 | Bacteria | 204629 |
| 98 | Ga0207426_1000586 | 3300025302 | Bacteria | 48467 |
| 99 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 100 | Ga0209051_1000263 | 3300025303 | Bacteria | 87839 |
| 101 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 102 | Ga0209257_1000108 | 3300025304 | Bacteria | 240229 |
| 103 | Ga0209257_1010849 | 3300025304 | Bacteria | 4511 |
| 104 | Ga0207710_10047714 | 3300025900 | Unclassified | 1915 |
| 105 | Ga0207643_10003861 | 3300025908 | Bacteria | 8061 |
| 106 | Ga0207707_10015161 | 3300025912 | Bacteria | 6710 |
| 107 | Ga0207695_10182687 | 3300025913 | Bacteria | 2018 |
| 108 | Ga0207695_10507862 | 3300025913 | Bacteria | 1087 |
| 109 | Ga0207652_10023009 | 3300025921 | Bacteria | 5162 |
| 110 | Ga0207652_10042793 | 3300025921 | Bacteria | 3856 |
| 111 | Ga0207652_10056312 | 3300025921 | Bacteria | 3385 |
| 112 | Ga0207646_10357830 | 3300025922 | Bacteria | 1319 |
| 113 | Ga0207650_10005808 | 3300025925 | Bacteria | 8421 |
| 114 | Ga0207706_10070739 | 3300025933 | Bacteria | 3069 |
| 115 | Ga0207704_10035305 | 3300025938 | Bacteria | 2863 |
| 116 | Ga0207711_10006783 | 3300025941 | Bacteria | 9621 |
| 117 | Ga0207689_10000458 | 3300025942 | Bacteria | 38330 |
| 118 | Ga0207667_10122865 | 3300025949 | Bacteria | 2675 |
| 119 | Ga0207667_10184464 | 3300025949 | Bacteria | 2142 |
| 120 | Ga0207651_10144882 | 3300025960 | Bacteria | 1840 |
| 121 | Ga0207668_10005825 | 3300025972 | Bacteria | 7259 |
| 122 | Ga0207677_10035087 | 3300026023 | Bacteria | 3253 |
| 123 | Ga0207677_10049000 | 3300026023 | Bacteria | 2847 |
| 124 | Ga0207703_10000195 | 3300026035 | Bacteria | 70480 |
| 125 | Ga0207639_10005606 | 3300026041 | Bacteria | 8493 |
| 126 | Ga0207639_10229543 | 3300026041 | Bacteria | 1608 |
| 127 | Ga0207641_10001364 | 3300026088 | Bacteria | 24178 |
| 128 | Ga0207648_10001099 | 3300026089 | Bacteria | 30331 |
| 129 | Ga0207676_10000356 | 3300026095 | Bacteria | 39134 |
| 130 | Ga0207674_10007909 | 3300026116 | Bacteria | 12349 |
| 131 | Ga0207674_10077156 | 3300026116 | Bacteria | 3338 |
| 132 | Ga0207675_100002598 | 3300026118 | Bacteria | 17876 |
| 133 | Ga0209970_1000134 | 3300027614 | Bacteria | 11104 |
| 134 | Ga0209983_1010313 | 3300027665 | Bacteria | 1909 |
| 135 | Ga0209974_10006651 | 3300027876 | Bacteria | 4021 |
| 136 | Ga0268265_10003712 | 3300028380 | Bacteria | 10865 |
| 137 | Ga0268264_10000466 | 3300028381 | Bacteria | 55015 |
| 138 | Ga0307515_10000664 | 3300028794 | Bacteria | 79458 |
| 139 | Ga0307513_10000028 | 3300031456 | Bacteria | 193264 |
| 140 | Ga0307513_10038516 | 3300031456 | Bacteria | 5307 |
| 141 | Ga0307513_10053201 | 3300031456 | Bacteria | 4354 |
| 142 | Ga0307513_10238797 | 3300031456 | Bacteria | 1624 |
| 143 | Ga0307408_100061364 | 3300031548 | Bacteria | 2744 |
| 144 | Ga0307514_10000530 | 3300031649 | Bacteria | 74660 |
| 145 | Ga0307516_10001642 | 3300031730 | Bacteria | 30785 |
| 146 | Ga0307405_10046654 | 3300031731 | Bacteria | 2664 |
| 147 | Ga0307413_10093579 | 3300031824 | Bacteria | 1965 |
| 148 | Ga0307410_10020349 | 3300031852 | Bacteria | 4057 |
| 149 | Ga0307406_10002772 | 3300031901 | Bacteria | 9568 |
| 150 | Ga0307411_10044441 | 3300032005 | Bacteria | 2850 |
| 151 | Ga0307411_10278804 | 3300032005 | Bacteria | 1329 |
| 152 | Ga0307415_100475548 | 3300032126 | Bacteria | 1086 |
| 153 | Ga0395900_0224826 | 3300037418 | Bacteria | 1890 |
| 154 | Ga0395900_0291752 | 3300037418 | Bacteria | 1620 |
| 155 | Ga0395898_0008325 | 3300037466 | Bacteria | 10964 |
| 156 | Ga0395905_0001870 | 3300037471 | Bacteria | 24233 |
| 157 | Ga0395905_0020746 | 3300037471 | Bacteria | 6221 |
| 158 | Ga0395905_0062358 | 3300037471 | Bacteria | 3487 |
| 159 | Ga0395905_0086309 | 3300037471 | Bacteria | 2941 |
| 160 | Ga0395905_0182066 | 3300037471 | Bacteria | 1973 |
| 161 | Ga0395905_0249090 | 3300037471 | Bacteria | 1659 |
| 162 | Ga0436361_0730639 | 3300039447 | Bacteria | 1815 |
| 163 | Ga0436361_0851270 | 3300039447 | Bacteria | 59752 |
| 164 | Ga0439461_0033981 | 3300041410 | Bacteria | 1075 |
| 165 | Ga0451802_0547687 | 3300041460 | Bacteria | 3814 |
| 166 | Ga0451807_1515277 | 3300041486 | Bacteria | 1742 |
| 167 | Ga0451843_1585006 | 3300041509 | Bacteria | 1480 |
| 168 | Ga0439433_0036603 | 3300041999 | Bacteria | 1134 |
| 169 | Ga0439449_0000443 | 3300042007 | Bacteria | 15378 |
| 170 | Ga0439462_0001121 | 3300042015 | Bacteria | 5807 |
| 171 | Ga0439446_0006260 | 3300042156 | Bacteria | 3098 |
| 172 | Ga0451577_0070480 | 3300042876 | Bacteria | 3117 |
| 173 | Ga0466969_0020878 | 3300044656 | Bacteria | 3387 |
| 174 | Ga0453683_0002680 | 3300044673 | Bacteria | 13598 |
| 175 | Ga0466965_0008443 | 3300044683 | Bacteria | 4766 |
| 176 | Ga0466966_0011393 | 3300044684 | Bacteria | 5897 |
| 177 | Ga0466961_0006669 | 3300044693 | Bacteria | 7342 |
| 178 | Ga0466964_0027371 | 3300044706 | Bacteria | 2238 |
| 179 | Ga0453684_0043393 | 3300044712 | Bacteria | 6044 |
| 180 | Ga0466968_0000688 | 3300044735 | Bacteria | 11662 |
| 181 | Ga0466970_0010244 | 3300044765 | Bacteria | 4754 |
| 182 | Ga0466970_0255534 | 3300044765 | Bacteria | 982 |
| 183 | Ga0466959_0104555 | 3300045049 | Bacteria | 2025 |
| 184 | Ga0451576_0004699 | 3300045051 | Bacteria | 17568 |
| 185 | Ga0451576_0045414 | 3300045051 | Bacteria | 4627 |
| 186 | Ga0495643_0003756 | 3300046522 | Bacteria | 10987 |
| 187 | Ga0495663_0068686 | 3300046525 | Bacteria | 1125 |
| 188 | Ga0495656_0017786 | 3300046615 | Bacteria | 2718 |
| 189 | Ga0495669_0014409 | 3300046684 | Bacteria | 3380 |
| 190 | Ga0495687_015829 | 3300047443 | Bacteria | 3816 |
| 191 | Ga0495677_0070564 | 3300047445 | Bacteria | 1302 |
| 192 | Ga0496101_0110143 | 3300048904 | Bacteria | 2072 |
| 193 | Ga0496102_0002929 | 3300048905 | Bacteria | 14482 |
| 194 | Ga0496102_0018662 | 3300048905 | Bacteria | 6100 |
| 195 | Ga0496103_0083530 | 3300048906 | Bacteria | 2011 |
| 196 | Ga0496103_0363652 | 3300048906 | Bacteria | 930 |
| 197 | Ga0496105_0147633 | 3300048908 | Bacteria | 1934 |
| 198 | Ga0496106_0384071 | 3300048909 | Bacteria | 1128 |
| 199 | Ga0496108_0018489 | 3300048911 | Bacteria | 5706 |
| 200 | Ga0496108_0309427 | 3300048911 | Bacteria | 1376 |
| 201 | Ga0496109_0022353 | 3300048912 | Bacteria | 5601 |
| 202 | Ga0496110_0028199 | 3300048913 | Bacteria | 4819 |
| 203 | Ga0496114_0172774 | 3300048917 | Bacteria | 1884 |
| 204 | Ga0496121_0068371 | 3300048924 | Bacteria | 2874 |
| 205 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 206 | Ga0501033_0091106 | 3300049570 | Bacteria | 2230 |
| 207 | Ga0501034_0098151 | 3300049571 | Bacteria | 2925 |
| 208 | Ga0501034_0217992 | 3300049571 | Bacteria | 1861 |
| 209 | Ga0501038_0028417 | 3300049574 | Bacteria | 4969 |
| 210 | Ga0501039_0278625 | 3300049575 | Bacteria | 1315 |
| 211 | Ga0501043_0199235 | 3300049579 | Bacteria | 1555 |
| 212 | Ga0501067_0002581 | 3300049583 | Bacteria | 10009 |
| 213 | Ga0501070_0002347 | 3300049586 | Bacteria | 16618 |
| 214 | Ga0501072_0015924 | 3300049588 | Bacteria | 5765 |
| 215 | Ga0501073_0009184 | 3300049589 | Bacteria | 7293 |
| 216 | Ga0501080_0004558 | 3300049742 | Bacteria | 12351 |
| 217 | Ga0501080_0121577 | 3300049742 | Bacteria | 2419 |
| 218 | Ga0501080_0214501 | 3300049742 | Bacteria | 1763 |
| 219 | Ga0501080_0333794 | 3300049742 | Bacteria | 1371 |
| 220 | Ga0501083_0029399 | 3300049744 | Bacteria | 3780 |
| 221 | Ga0501083_0137962 | 3300049744 | Bacteria | 1597 |
| 222 | Ga0501035_0070434 | 3300049822 | Bacteria | 3097 |
| 223 | nmdc:mga0k408_2400_c1 | 3300050493 | Bacteria | 9965 |
| 224 | nmdc:mga0k408_34072_c1 | 3300050493 | Bacteria | 2914 |
| 225 | nmdc:mga07m45_113694_c1 | 3300050496 | Bacteria | 1560 |
| 226 | nmdc:mga07m45_124566_c1 | 3300050496 | Bacteria | 1490 |
| 227 | Ga0500651_0002762 | 3300053093 | Bacteria | 9395 |
| 228 | Ga0500618_001595 | 3300053125 | Bacteria | 9861 |
| 229 | Ga0500586_030293 | 3300053145 | Bacteria | 1778 |
| 230 | Ga0500619_000116 | 3300053154 | Bacteria | 21263 |
| 231 | Ga0500645_001311 | 3300053730 | Bacteria | 12909 |
| 232 | Ga0500645_011111 | 3300053730 | Bacteria | 2951 |
| 233 | Ga0501084_0121842 | 3300054114 | Bacteria | 2193 |
| 234 | Ga0500661_006245 | 3300055283 | Bacteria | 2219 |
| 235 | Ga0590071_002620 | 3300059421 | Bacteria | 4521 |
| 236 | Ga0590075_013555 | 3300059424 | Bacteria | 1990 |
| 237 | Ga0530510_0183962 | 3300061734 | Bacteria | 1550 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037471 | Ga0395905_0182066 | Ga0395905_0182066_711_1559 | 259 |
| 2 | 3300005434 | Ga0070709_10042631 | Ga0070709_100426312 | 260 |
| 3 | 3300049742 | Ga0501080_0333794 | Ga0501080_0333794_343_1203 | 260 |
| 4 | 3300044765 | Ga0466970_0255534 | Ga0466970_0255534_156_965 | 267 |
| 5 | 3300049570 | Ga0501033_0091106 | Ga0501033_0091106_11_853 | 278 |
| 6 | 3300041509 | Ga0451843_1585006 | Ga0451843_1585006_526_1422 | 279 |
| 7 | iso_pu_bacteria | 2834641062 | 2834645156 | 280 |
| 8 | iso_pu_bacteria | 8003400568 | 8003403624 | 280 |
| 9 | iso_pu_bacteria | 8048746797 | 8048749820 | 280 |
| 10 | 3300005293 | Ga0065715_10109686 | Ga0065715_101096862 | 281 |
| 11 | 3300005331 | Ga0070670_100021726 | Ga0070670_1000217265 | 281 |
| 12 | 3300005331 | Ga0070670_100259134 | Ga0070670_1002591341 | 281 |
| 13 | 3300005334 | Ga0068869_100000007 | Ga0068869_10000000755 | 281 |
| 14 | 3300005338 | Ga0068868_100049628 | Ga0068868_1000496283 | 281 |
| 15 | 3300005340 | Ga0070689_100017953 | Ga0070689_1000179534 | 281 |
| 16 | 3300005347 | Ga0070668_100011276 | Ga0070668_1000112765 | 281 |
| 17 | 3300005364 | Ga0070673_100039686 | Ga0070673_1000396861 | 281 |
| 18 | 3300005367 | Ga0070667_100000332 | Ga0070667_10000033229 | 281 |
| 19 | 3300005457 | Ga0070662_100056848 | Ga0070662_1000568483 | 281 |
| 20 | 3300005458 | Ga0070681_10002150 | Ga0070681_1000215016 | 281 |
| 21 | 3300005459 | Ga0068867_100000694 | Ga0068867_1000006945 | 281 |
| 22 | 3300005530 | Ga0070679_100004470 | Ga0070679_10000447014 | 281 |
| 23 | 3300005539 | Ga0068853_100239623 | Ga0068853_1002396232 | 281 |
| 24 | 3300005563 | Ga0068855_100154992 | Ga0068855_1001549923 | 281 |
| 25 | 3300005577 | Ga0068857_100001549 | Ga0068857_1000015499 | 281 |
| 26 | 3300005577 | Ga0068857_100098667 | Ga0068857_1000986672 | 281 |
| 27 | 3300005614 | Ga0068856_100184650 | Ga0068856_1001846502 | 281 |
| 28 | 3300005617 | Ga0068859_100000241 | Ga0068859_10000024124 | 281 |
| 29 | 3300005718 | Ga0068866_10099096 | Ga0068866_100990962 | 281 |
| 30 | 3300005840 | Ga0068870_10002462 | Ga0068870_100024622 | 281 |
| 31 | 3300005841 | Ga0068863_100002079 | Ga0068863_1000020799 | 281 |
| 32 | 3300005842 | Ga0068858_100000331 | Ga0068858_10000033123 | 281 |
| 33 | 3300005843 | Ga0068860_100001594 | Ga0068860_10000159422 | 281 |
| 34 | 3300005844 | Ga0068862_100007775 | Ga0068862_1000077754 | 281 |
| 35 | 3300006871 | Ga0075434_100210569 | Ga0075434_1002105692 | 281 |
| 36 | 3300006931 | Ga0097620_100000241 | Ga0097620_10000024124 | 281 |
| 37 | 3300009094 | Ga0111539_10219629 | Ga0111539_102196292 | 281 |
| 38 | 3300010375 | Ga0105239_10363937 | Ga0105239_103639371 | 281 |
| 39 | 3300013100 | Ga0157373_10001519 | Ga0157373_1000151919 | 281 |
| 40 | 3300013307 | Ga0157372_10086758 | Ga0157372_100867582 | 281 |
| 41 | 3300025908 | Ga0207643_10003861 | Ga0207643_100038612 | 281 |
| 42 | 3300025912 | Ga0207707_10015161 | Ga0207707_100151612 | 281 |
| 43 | 3300025921 | Ga0207652_10042793 | Ga0207652_100427933 | 281 |
| 44 | 3300025922 | Ga0207646_10357830 | Ga0207646_103578302 | 281 |
| 45 | 3300025925 | Ga0207650_10005808 | Ga0207650_100058086 | 281 |
| 46 | 3300025933 | Ga0207706_10070739 | Ga0207706_100707393 | 281 |
| 47 | 3300025938 | Ga0207704_10035305 | Ga0207704_100353052 | 281 |
| 48 | 3300025941 | Ga0207711_10006783 | Ga0207711_1000678312 | 281 |
| 49 | 3300025942 | Ga0207689_10000458 | Ga0207689_1000045814 | 281 |
| 50 | 3300025949 | Ga0207667_10122865 | Ga0207667_101228653 | 281 |
| 51 | 3300025960 | Ga0207651_10144882 | Ga0207651_101448821 | 281 |
| 52 | 3300025972 | Ga0207668_10005825 | Ga0207668_100058255 | 281 |
| 53 | 3300026023 | Ga0207677_10049000 | Ga0207677_100490003 | 281 |
| 54 | 3300026035 | Ga0207703_10000195 | Ga0207703_1000019546 | 281 |
| 55 | 3300026041 | Ga0207639_10005606 | Ga0207639_1000560611 | 281 |
| 56 | 3300026041 | Ga0207639_10229543 | Ga0207639_102295432 | 281 |
| 57 | 3300026088 | Ga0207641_10001364 | Ga0207641_100013645 | 281 |
| 58 | 3300026089 | Ga0207648_10001099 | Ga0207648_1000109925 | 281 |
| 59 | 3300026095 | Ga0207676_10000356 | Ga0207676_1000035621 | 281 |
| 60 | 3300026116 | Ga0207674_10007909 | Ga0207674_100079093 | 281 |
| 61 | 3300026116 | Ga0207674_10077156 | Ga0207674_100771562 | 281 |
| 62 | 3300026118 | Ga0207675_100002598 | Ga0207675_1000025987 | 281 |
| 63 | 3300028380 | Ga0268265_10003712 | Ga0268265_1000371214 | 281 |
| 64 | 3300028381 | Ga0268264_10000466 | Ga0268264_1000046632 | 281 |
| 65 | 3300031731 | Ga0307405_10046654 | Ga0307405_100466541 | 281 |
| 66 | 3300031824 | Ga0307413_10093579 | Ga0307413_100935792 | 281 |
| 67 | 3300031852 | Ga0307410_10020349 | Ga0307410_100203493 | 281 |
| 68 | 3300032005 | Ga0307411_10044441 | Ga0307411_100444414 | 281 |
| 69 | 3300032005 | Ga0307411_10278804 | Ga0307411_102788041 | 281 |
| 70 | 3300032126 | Ga0307415_100475548 | Ga0307415_1004755481 | 281 |
| 71 | 3300039447 | Ga0436361_0730639 | Ga0436361_0730639_452_1297 | 281 |
| 72 | 3300044683 | Ga0466965_0008443 | Ga0466965_0008443_3082_3927 | 281 |
| 73 | 3300044706 | Ga0466964_0027371 | Ga0466964_0027371_216_1061 | 281 |
| 74 | 3300044735 | Ga0466968_0000688 | Ga0466968_0000688_6168_7013 | 281 |
| 75 | 3300047443 | Ga0495687_015829 | Ga0495687_015829_1609_2457 | 281 |
| 76 | 3300048905 | Ga0496102_0002929 | Ga0496102_0002929_7930_8775 | 281 |
| 77 | 3300048906 | Ga0496103_0363652 | Ga0496103_0363652_14_859 | 281 |
| 78 | 3300049571 | Ga0501034_0098151 | Ga0501034_0098151_578_1453 | 281 |
| 79 | 3300049583 | Ga0501067_0002581 | Ga0501067_0002581_1462_2337 | 281 |
| 80 | 3300049586 | Ga0501070_0002347 | Ga0501070_0002347_9567_10442 | 281 |
| 81 | 3300049588 | Ga0501072_0015924 | Ga0501072_0015924_18_893 | 281 |
| 82 | 3300049589 | Ga0501073_0009184 | Ga0501073_0009184_1375_2250 | 281 |
| 83 | 3300049742 | Ga0501080_0004558 | Ga0501080_0004558_1489_2364 | 281 |
| 84 | 3300049742 | Ga0501080_0214501 | Ga0501080_0214501_455_1324 | 281 |
| 85 | 3300049744 | Ga0501083_0029399 | Ga0501083_0029399_2147_3016 | 281 |
| 86 | 3300049744 | Ga0501083_0137962 | Ga0501083_0137962_247_1122 | 281 |
| 87 | 3300053125 | Ga0500618_001595 | Ga0500618_001595_2612_3457 | 281 |
| 88 | 3300054114 | Ga0501084_0121842 | Ga0501084_0121842_142_1017 | 281 |
| 89 | 3300061734 | Ga0530510_0183962 | Ga0530510_0183962_84_959 | 281 |
| 90 | iso_pu_bacteria | 2857542790 | 2857543909 | 281 |
| 91 | 3300009093 | Ga0105240_10508550 | Ga0105240_105085501 | 283 |
| 92 | 3300025913 | Ga0207695_10507862 | Ga0207695_105078622 | 283 |
| 93 | iso_pu_bacteria | 2881101125 | 2881102094 | 283 |
| 94 | 3300037418 | Ga0395900_0291752 | Ga0395900_0291752_652_1545 | 285 |
| 95 | 3300048924 | Ga0496121_0068371 | Ga0496121_0068371_1800_2666 | 285 |
| 96 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_235882_236748 | 285 |
| 97 | 3300048904 | Ga0496101_0110143 | Ga0496101_0110143_277_1152 | 286 |
| 98 | 3300048908 | Ga0496105_0147633 | Ga0496105_0147633_58_933 | 286 |
| 99 | 3300048911 | Ga0496108_0309427 | Ga0496108_0309427_227_1102 | 286 |
| 100 | 3300048913 | Ga0496110_0028199 | Ga0496110_0028199_2444_3319 | 286 |
| 101 | 3300021361 | Ga0213872_10000367 | Ga0213872_1000036730 | 288 |
| 102 | 3300027614 | Ga0209970_1000134 | Ga0209970_100013413 | 288 |
| 103 | 3300027665 | Ga0209983_1010313 | Ga0209983_10103132 | 288 |
| 104 | 3300027876 | Ga0209974_10006651 | Ga0209974_100066513 | 288 |
| 105 | 3300039447 | Ga0436361_0851270 | Ga0436361_0851270_40013_40882 | 288 |
| 106 | 3300042156 | Ga0439446_0006260 | Ga0439446_0006260_216_1091 | 288 |
| 107 | 3300053154 | Ga0500619_000116 | Ga0500619_000116_15479_16354 | 288 |
| 108 | 3300005618 | Ga0068864_100004428 | Ga0068864_1000044281 | 289 |
| 109 | 3300009098 | Ga0105245_10064056 | Ga0105245_100640563 | 289 |
| 110 | 3300009101 | Ga0105247_10062547 | Ga0105247_100625472 | 289 |
| 111 | 3300009177 | Ga0105248_10005176 | Ga0105248_1000517613 | 289 |
| 112 | 3300009545 | Ga0105237_10167359 | Ga0105237_101673592 | 289 |
| 113 | 3300013308 | Ga0157375_10013427 | Ga0157375_100134279 | 289 |
| 114 | 3300014968 | Ga0157379_10000142 | Ga0157379_100001429 | 289 |
| 115 | 3300025900 | Ga0207710_10047714 | Ga0207710_100477142 | 289 |
| 116 | 3300046522 | Ga0495643_0003756 | Ga0495643_0003756_2273_3241 | 289 |
| 117 | 3300048905 | Ga0496102_0018662 | Ga0496102_0018662_2139_3065 | 289 |
| 118 | 3300048906 | Ga0496103_0083530 | Ga0496103_0083530_14_940 | 289 |
| 119 | 3300048909 | Ga0496106_0384071 | Ga0496106_0384071_34_960 | 289 |
| 120 | 3300048911 | Ga0496108_0018489 | Ga0496108_0018489_2589_3515 | 289 |
| 121 | 3300048912 | Ga0496109_0022353 | Ga0496109_0022353_3789_4715 | 289 |
| 122 | 3300048917 | Ga0496114_0172774 | Ga0496114_0172774_223_1107 | 291 |
| 123 | 3300003794 | Ga0055531_10001023 | Ga0055531_100010238 | 292 |
| 124 | 3300006195 | Ga0075366_10007032 | Ga0075366_100070326 | 292 |
| 125 | 3300025273 | Ga0209673_1014574 | Ga0209673_10145744 | 292 |
| 126 | 3300025303 | Ga0209051_1000263 | Ga0209051_10002634 | 292 |
| 127 | 3300025304 | Ga0209257_1000108 | Ga0209257_100010896 | 292 |
| 128 | 3300044712 | Ga0453684_0043393 | Ga0453684_0043393_3240_4148 | 292 |
| 129 | 3300049571 | Ga0501034_0217992 | Ga0501034_0217992_515_1396 | 292 |
| 130 | 3300049574 | Ga0501038_0028417 | Ga0501038_0028417_216_1097 | 292 |
| 131 | 3300049579 | Ga0501043_0199235 | Ga0501043_0199235_487_1371 | 292 |
| 132 | 3300049742 | Ga0501080_0121577 | Ga0501080_0121577_511_1392 | 292 |
| 133 | 3300050493 | nmdc:mga0k408_2400_c1 | nmdc:mga0k408_2400_c1_3715_4605 | 292 |
| 134 | 3300050496 | nmdc:mga07m45_113694_c1 | nmdc:mga07m45_113694_c1_327_1211 | 292 |
| 135 | 3300050496 | nmdc:mga07m45_124566_c1 | nmdc:mga07m45_124566_c1_596_1477 | 292 |
| 136 | 3300053145 | Ga0500586_030293 | Ga0500586_030293_62_964 | 292 |
| 137 | 3300006177 | Ga0075362_10160040 | Ga0075362_101600402 | 293 |
| 138 | 3300031730 | Ga0307516_10001642 | Ga0307516_1000164221 | 293 |
| 139 | 3300037418 | Ga0395900_0224826 | Ga0395900_0224826_257_1144 | 293 |
| 140 | 3300037471 | Ga0395905_0249090 | Ga0395905_0249090_428_1315 | 293 |
| 141 | 3300041410 | Ga0439461_0033981 | Ga0439461_0033981_107_991 | 293 |
| 142 | 3300041460 | Ga0451802_0547687 | Ga0451802_0547687_2324_3229 | 293 |
| 143 | 3300041999 | Ga0439433_0036603 | Ga0439433_0036603_151_1035 | 293 |
| 144 | 3300042007 | Ga0439449_0000443 | Ga0439449_0000443_6271_7155 | 293 |
| 145 | 3300042015 | Ga0439462_0001121 | Ga0439462_0001121_3708_4592 | 293 |
| 146 | 3300044673 | Ga0453683_0002680 | Ga0453683_0002680_740_1624 | 293 |
| 147 | 3300045051 | Ga0451576_0004699 | Ga0451576_0004699_4053_4937 | 293 |
| 148 | 3300049575 | Ga0501039_0278625 | Ga0501039_0278625_262_1146 | 293 |
| 149 | 3300049822 | Ga0501035_0070434 | Ga0501035_0070434_656_1591 | 293 |
| 150 | 3300059421 | Ga0590071_002620 | Ga0590071_002620_607_1512 | 293 |
| 151 | 3300059424 | Ga0590075_013555 | Ga0590075_013555_135_1019 | 293 |
| 152 | 3300005530 | Ga0070679_100004108 | Ga0070679_10000410814 | 294 |
| 153 | 3300005563 | Ga0068855_100002511 | Ga0068855_1000025117 | 294 |
| 154 | 3300005563 | Ga0068855_100161898 | Ga0068855_1001618983 | 294 |
| 155 | 3300006038 | Ga0075365_10023655 | Ga0075365_100236556 | 294 |
| 156 | 3300009093 | Ga0105240_10011576 | Ga0105240_1001157611 | 294 |
| 157 | 3300009174 | Ga0105241_10084034 | Ga0105241_100840343 | 294 |
| 158 | 3300010375 | Ga0105239_10054644 | Ga0105239_100546443 | 294 |
| 159 | 3300014969 | Ga0157376_10111716 | Ga0157376_101117161 | 294 |
| 160 | 3300025913 | Ga0207695_10182687 | Ga0207695_101826872 | 294 |
| 161 | 3300025921 | Ga0207652_10023009 | Ga0207652_100230092 | 294 |
| 162 | 3300025921 | Ga0207652_10056312 | Ga0207652_100563123 | 294 |
| 163 | 3300026023 | Ga0207677_10035087 | Ga0207677_100350874 | 294 |
| 164 | 3300037466 | Ga0395898_0008325 | Ga0395898_0008325_6208_7104 | 294 |
| 165 | 3300037471 | Ga0395905_0020746 | Ga0395905_0020746_24_920 | 294 |
| 166 | 3300037471 | Ga0395905_0062358 | Ga0395905_0062358_899_1786 | 294 |
| 167 | 3300042876 | Ga0451577_0070480 | Ga0451577_0070480_432_1373 | 294 |
| 168 | 3300044656 | Ga0466969_0020878 | Ga0466969_0020878_808_1698 | 294 |
| 169 | 3300044684 | Ga0466966_0011393 | Ga0466966_0011393_3966_4856 | 294 |
| 170 | 3300044693 | Ga0466961_0006669 | Ga0466961_0006669_1153_2043 | 294 |
| 171 | 3300044765 | Ga0466970_0010244 | Ga0466970_0010244_2889_3779 | 294 |
| 172 | 3300045049 | Ga0466959_0104555 | Ga0466959_0104555_807_1697 | 294 |
| 173 | 3300045051 | Ga0451576_0045414 | Ga0451576_0045414_1576_2517 | 294 |
| 174 | 3300005327 | Ga0070658_10237365 | Ga0070658_102373651 | 295 |
| 175 | 3300025949 | Ga0207667_10184464 | Ga0207667_101844644 | 295 |
| 176 | 3300037471 | Ga0395905_0001870 | Ga0395905_0001870_6852_7748 | 295 |
| 177 | 3300037471 | Ga0395905_0086309 | Ga0395905_0086309_1988_2878 | 295 |
| 178 | 3300046525 | Ga0495663_0068686 | Ga0495663_0068686_153_1049 | 295 |
| 179 | 3300046615 | Ga0495656_0017786 | Ga0495656_0017786_346_1242 | 295 |
| 180 | 3300046684 | Ga0495669_0014409 | Ga0495669_0014409_2233_3129 | 295 |
| 181 | 3300047445 | Ga0495677_0070564 | Ga0495677_0070564_64_960 | 295 |
| 182 | 3300050493 | nmdc:mga0k408_34072_c1 | nmdc:mga0k408_34072_c1_747_1637 | 295 |
| 183 | iso_pu_bacteria | 2511231002 | 2511244966 | 296 |
| 184 | 3300031456 | Ga0307513_10000028 | Ga0307513_1000002860 | 297 |
| 185 | 3300053093 | Ga0500651_0002762 | Ga0500651_0002762_2922_3842 | 297 |
| 186 | 3300028794 | Ga0307515_10000664 | Ga0307515_1000066428 | 298 |
| 187 | 3300031456 | Ga0307513_10053201 | Ga0307513_100532013 | 298 |
| 188 | 3300031649 | Ga0307514_10000530 | Ga0307514_1000053063 | 298 |
| 189 | 3300002987 | JGI25159J45721_1008761 | JGI25159J45721_10087614 | 299 |
| 190 | 3300003771 | Ga0055526_1002001 | Ga0055526_100200115 | 299 |
| 191 | 3300003773 | Ga0055537_1000265 | Ga0055537_10002654 | 299 |
| 192 | 3300003775 | Ga0055524_1000338 | Ga0055524_100033852 | 299 |
| 193 | 3300003775 | Ga0055524_1001001 | Ga0055524_10010019 | 299 |
| 194 | 3300003784 | Ga0055534_1003904 | Ga0055534_10039047 | 299 |
| 195 | 3300003790 | Ga0055528_1001252 | Ga0055528_100125214 | 299 |
| 196 | 3300003791 | Ga0055530_10005110 | Ga0055530_100051104 | 299 |
| 197 | 3300003792 | Ga0055540_1000274 | Ga0055540_10002749 | 299 |
| 198 | 3300003794 | Ga0055531_10003006 | Ga0055531_100030065 | 299 |
| 199 | 3300025263 | Ga0209565_1000309 | Ga0209565_10003097 | 299 |
| 200 | 3300025273 | Ga0209673_1000088 | Ga0209673_1000088154 | 299 |
| 201 | 3300025291 | Ga0209675_1000133 | Ga0209675_100013332 | 299 |
| 202 | 3300025292 | Ga0209676_1000073 | Ga0209676_1000073257 | 299 |
| 203 | 3300025294 | Ga0209025_1039332 | Ga0209025_10393323 | 299 |
| 204 | 3300025295 | Ga0209564_1001205 | Ga0209564_10012058 | 299 |
| 205 | 3300025298 | Ga0209050_1000008 | Ga0209050_1000008805 | 299 |
| 206 | 3300025299 | Ga0209256_1000096 | Ga0209256_100009653 | 299 |
| 207 | 3300025303 | Ga0209051_1000005 | Ga0209051_1000005805 | 299 |
| 208 | 3300025304 | Ga0209257_1000031 | Ga0209257_1000031395 | 299 |
| 209 | 3300002987 | JGI25159J45721_1005752 | JGI25159J45721_10057522 | 300 |
| 210 | 3300003354 | JGI25160J50197_1000198 | JGI25160J50197_10001989 | 300 |
| 211 | 3300003374 | JGI25161J50226_1000021 | JGI25161J50226_1000021112 | 300 |
| 212 | 3300003771 | Ga0055526_1013484 | Ga0055526_10134843 | 300 |
| 213 | 3300004625 | Ga0055543_1000107 | Ga0055543_100010710 | 300 |
| 214 | 3300005262 | Ga0065165_1012553 | Ga0065165_10125534 | 300 |
| 215 | 3300006048 | Ga0075363_100032958 | Ga0075363_1000329582 | 300 |
| 216 | 3300006177 | Ga0075362_10007084 | Ga0075362_100070843 | 300 |
| 217 | 3300006195 | Ga0075366_10101179 | Ga0075366_101011792 | 300 |
| 218 | 3300025263 | Ga0209565_1002905 | Ga0209565_10029057 | 300 |
| 219 | 3300025284 | Ga0209130_1000103 | Ga0209130_100010352 | 300 |
| 220 | 3300025284 | Ga0209130_1004160 | Ga0209130_10041604 | 300 |
| 221 | 3300025291 | Ga0209675_1016392 | Ga0209675_10163922 | 300 |
| 222 | 3300025292 | Ga0209676_1002105 | Ga0209676_100210518 | 300 |
| 223 | 3300025294 | Ga0209025_1012041 | Ga0209025_10120416 | 300 |
| 224 | 3300025295 | Ga0209564_1000702 | Ga0209564_100070251 | 300 |
| 225 | 3300025295 | Ga0209564_1007939 | Ga0209564_10079395 | 300 |
| 226 | 3300025297 | Ga0209758_1014270 | Ga0209758_10142705 | 300 |
| 227 | 3300025302 | Ga0207426_1000586 | Ga0207426_100058652 | 300 |
| 228 | 3300025304 | Ga0209257_1010849 | Ga0209257_10108495 | 300 |
| 229 | 3300031456 | Ga0307513_10238797 | Ga0307513_102387973 | 300 |
| 230 | 3300031548 | Ga0307408_100061364 | Ga0307408_1000613642 | 300 |
| 231 | 3300031901 | Ga0307406_10002772 | Ga0307406_100027726 | 300 |
| 232 | 3300055283 | Ga0500661_006245 | Ga0500661_006245_659_1561 | 300 |
| 233 | 3300002705 | JGI25156J39149_1000040 | JGI25156J39149_100004065 | 301 |
| 234 | 3300002738 | JGI25154J39366_1000060 | JGI25154J39366_100006053 | 301 |
| 235 | 3300002741 | JGI25157J39369_1000058 | JGI25157J39369_100005853 | 301 |
| 236 | 3300025206 | Ga0209435_100019 | Ga0209435_10001953 | 301 |
| 237 | 3300025246 | Ga0209646_1000038 | Ga0209646_100003853 | 301 |
| 238 | 3300025250 | Ga0209026_1000048 | Ga0209026_100004853 | 301 |
| 239 | 3300025256 | Ga0209759_1000038 | Ga0209759_1000038191 | 301 |
| 240 | 3300031456 | Ga0307513_10038516 | Ga0307513_100385166 | 301 |
| 241 | 3300041486 | Ga0451807_1515277 | Ga0451807_1515277_446_1351 | 301 |
| 242 | 3300053730 | Ga0500645_001311 | Ga0500645_001311_2798_3703 | 301 |
| 243 | 3300053730 | Ga0500645_011111 | Ga0500645_011111_241_1146 | 301 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tm5-assembly1.cif.gz_A-2 | x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate | 0.9464 | 13 | 300 |
| 1g2w-assembly1.cif.gz_B | e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase | 0.9454 | 13 | 298 |
| 4daa-assembly1.cif.gz_A | crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form | 0.9442 | 13 | 298 |
| 5daa-assembly1.cif.gz_B | e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate | 0.942 | 13 | 298 |
| 2dab-assembly1.cif.gz_A | l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate | 0.9361 | 13 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pbcB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9899 | 167 | 300 | 3.20.10.10 |
| 4m0jB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9743 | 138 | 300 | 3.20.10.10 |
| 3lqsA02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9479 | 139 | 297 | 3.20.10.10 |
| 4m0jB02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9423 | 138 | 300 | 3.20.10.10 |
| af_Q2FXI0_1_119_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9252 | 13 | 135 | 3.30.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660NIT6-F1-model_v4 | D-amino acid aminotransferase | 0.9884 | 164 | 300 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A1I3DGV3-F1-model_v4 | D-alanine transaminase | 0.977 | 11 | 301 |
GO:0003824
GO:0005829 GO:0046394 |
| AF-A0A1J5BHS3-F1-model_v4 | D-amino acid aminotransferase | 0.9735 | 104 | 301 |
GO:0005829
GO:0008483 GO:0046394 |
| AF-A0A4Y1Z9P1-F1-model_v4 | D-alanine aminotransferase (EC 2.6.1.21) | 0.9733 | 152 | 300 |
GO:0005829
GO:0046394 GO:0047810 |
| AF-A0A3G8H0P2-F1-model_v4 | D-amino acid aminotransferase | 0.9725 | 9 | 300 |
GO:0005829
GO:0008483 GO:0046394 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar