F355628

General Info

Members Datasets Scaffolds Average Seq Length
243 188 237 294

Family's Representative Sequence

Representative Sequence 3300014969|Ga0157376_10111716|Ga0157376_101117161
Length 325
Sequence MHDNDLPDLPCYLYGEFIRLRDAKVSVMDRGFIFGDGVYEVVPVYAGRPFRFEHHMARLDRSLGELRIANPMTHGQWRELADRLIADFAASLGRPVAQTDQLVYLQVTRGVAMRDHAMLPGLKPTVFAMSNRITPPGAADRANGVACVSADDFRWKKAHIKSVSLLGSVMARQISVDAGAAETVMFRDGFLSEAAAANVWVVKGGVVIGPPRDNLVLEGIRYGLIGELCRDSGIGFQLRRIARDEVFAADELLLSNASKEILPVTRLDGRPIGTGRPGPIYEKLYAGYQREKVNHPRSGLRPPPPQGGATSGPAKPVPRSPANKT

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
3 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
4 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
68 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
129 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
133 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
151 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
180 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
181 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
188 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.87
Nodule 0
Rhizoplane 5.76
Rhizosphere 62.14
Stem 0
Stem Tuber 0
Unclassified 8.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000040 3300002705 Bacteria 106617
2 JGI25154J39366_1000060 3300002738 Bacteria 106617
3 JGI25157J39369_1000058 3300002741 Bacteria 106617
4 JGI25159J45721_1005752 3300002987 Bacteria 3835
5 JGI25159J45721_1008761 3300002987 Bacteria 2746
6 JGI25160J50197_1000198 3300003354 Bacteria 50243
7 JGI25161J50226_1000021 3300003374 Bacteria 163584
8 Ga0055526_1002001 3300003771 Bacteria 14042
9 Ga0055526_1013484 3300003771 Bacteria 3451
10 Ga0055537_1000265 3300003773 Bacteria 38230
11 Ga0055524_1000338 3300003775 Bacteria 43287
12 Ga0055524_1001001 3300003775 Bacteria 17617
13 Ga0055534_1003904 3300003784 Bacteria 4521
14 Ga0055528_1001252 3300003790 Bacteria 16135
15 Ga0055530_10005110 3300003791 Bacteria 6420
16 Ga0055540_1000274 3300003792 Bacteria 46571
17 Ga0055531_10001023 3300003794 Bacteria 22138
18 Ga0055531_10003006 3300003794 Bacteria 10943
19 Ga0055543_1000107 3300004625 Bacteria 71784
20 Ga0065165_1012553 3300005262 Bacteria 3442
21 Ga0065715_10109686 3300005293 Bacteria 2657
22 Ga0070658_10237365 3300005327 Bacteria 1545
23 Ga0070670_100021726 3300005331 Bacteria 5519
24 Ga0070670_100259134 3300005331 Bacteria 1516
25 Ga0068869_100000007 3300005334 Bacteria 78820
26 Ga0068868_100049628 3300005338 Bacteria 3294
27 Ga0070689_100017953 3300005340 Bacteria 5202
28 Ga0070668_100011276 3300005347 Bacteria 6656
29 Ga0070673_100039686 3300005364 Bacteria 3605
30 Ga0070667_100000332 3300005367 Bacteria 52616
31 Ga0070709_10042631 3300005434 Bacteria 2804
32 Ga0070662_100056848 3300005457 Bacteria 2841
33 Ga0070681_10002150 3300005458 Bacteria 17921
34 Ga0068867_100000694 3300005459 Bacteria 22406
35 Ga0070679_100004108 3300005530 Bacteria 13421
36 Ga0070679_100004470 3300005530 Bacteria 12914
37 Ga0068853_100239623 3300005539 Bacteria 1662
38 Ga0068855_100002511 3300005563 Bacteria 22597
39 Ga0068855_100154992 3300005563 Bacteria 2603
40 Ga0068855_100161898 3300005563 Bacteria 2539
41 Ga0068857_100001549 3300005577 Bacteria 18409
42 Ga0068857_100098667 3300005577 Bacteria 2620
43 Ga0068856_100184650 3300005614 Bacteria 2099
44 Ga0068859_100000241 3300005617 Bacteria 53802
45 Ga0068864_100004428 3300005618 Bacteria 11542
46 Ga0068866_10099096 3300005718 Bacteria 1604
47 Ga0068870_10002462 3300005840 Bacteria 7715
48 Ga0068863_100002079 3300005841 Bacteria 19853
49 Ga0068858_100000331 3300005842 Bacteria 50044
50 Ga0068860_100001594 3300005843 Bacteria 24359
51 Ga0068862_100007775 3300005844 Bacteria 8865
52 Ga0075365_10023655 3300006038 Bacteria 3867
53 Ga0075363_100032958 3300006048 Bacteria 2694
54 Ga0075362_10007084 3300006177 Bacteria 4219
55 Ga0075362_10160040 3300006177 Bacteria 1084
56 Ga0075366_10007032 3300006195 Bacteria 6191
57 Ga0075366_10101179 3300006195 Bacteria 1729
58 Ga0075434_100210569 3300006871 Bacteria 1964
59 Ga0097620_100000241 3300006931 Bacteria 53802
60 Ga0105240_10011576 3300009093 Bacteria 12274
61 Ga0105240_10508550 3300009093 Bacteria 1338
62 Ga0111539_10219629 3300009094 Bacteria 2214
63 Ga0105245_10064056 3300009098 Bacteria 3322
64 Ga0105247_10062547 3300009101 Bacteria 2309
65 Ga0105241_10084034 3300009174 Bacteria 2498
66 Ga0105248_10005176 3300009177 Bacteria 14379
67 Ga0105237_10167359 3300009545 Bacteria 2197
68 Ga0105239_10054644 3300010375 Bacteria 4381
69 Ga0105239_10363937 3300010375 Bacteria 1634
70 Ga0157373_10001519 3300013100 Bacteria 17693
71 Ga0157372_10086758 3300013307 Bacteria 3551
72 Ga0157375_10013427 3300013308 Bacteria 7288
73 Ga0157379_10000142 3300014968 Bacteria 51727
74 Ga0157376_10111716 3300014969 Bacteria 2407
75 Ga0213872_10000367 3300021361 Bacteria 38078
76 Ga0209435_100019 3300025206 Bacteria 260989
77 Ga0209646_1000038 3300025246 Bacteria 353982
78 Ga0209026_1000048 3300025250 Bacteria 257264
79 Ga0209759_1000038 3300025256 Bacteria 257264
80 Ga0209565_1000309 3300025263 Bacteria 45428
81 Ga0209565_1002905 3300025263 Bacteria 5856
82 Ga0209673_1000088 3300025273 Bacteria 204629
83 Ga0209673_1014574 3300025273 Bacteria 3035
84 Ga0209130_1000103 3300025284 Bacteria 137115
85 Ga0209130_1004160 3300025284 Bacteria 5665
86 Ga0209675_1000133 3300025291 Bacteria 101207
87 Ga0209675_1016392 3300025291 Bacteria 2160
88 Ga0209676_1000073 3300025292 Bacteria 305947
89 Ga0209676_1002105 3300025292 Bacteria 15331
90 Ga0209025_1012041 3300025294 Bacteria 5604
91 Ga0209025_1039332 3300025294 Bacteria 2064
92 Ga0209564_1000702 3300025295 Bacteria 49036
93 Ga0209564_1001205 3300025295 Bacteria 29514
94 Ga0209564_1007939 3300025295 Bacteria 5345
95 Ga0209758_1014270 3300025297 Bacteria 4242
96 Ga0209050_1000008 3300025298 Bacteria 1144179
97 Ga0209256_1000096 3300025299 Bacteria 204629
98 Ga0207426_1000586 3300025302 Bacteria 48467
99 Ga0209051_1000005 3300025303 Bacteria 1142353
100 Ga0209051_1000263 3300025303 Bacteria 87839
101 Ga0209257_1000031 3300025304 Bacteria 688770
102 Ga0209257_1000108 3300025304 Bacteria 240229
103 Ga0209257_1010849 3300025304 Bacteria 4511
104 Ga0207710_10047714 3300025900 Unclassified 1915
105 Ga0207643_10003861 3300025908 Bacteria 8061
106 Ga0207707_10015161 3300025912 Bacteria 6710
107 Ga0207695_10182687 3300025913 Bacteria 2018
108 Ga0207695_10507862 3300025913 Bacteria 1087
109 Ga0207652_10023009 3300025921 Bacteria 5162
110 Ga0207652_10042793 3300025921 Bacteria 3856
111 Ga0207652_10056312 3300025921 Bacteria 3385
112 Ga0207646_10357830 3300025922 Bacteria 1319
113 Ga0207650_10005808 3300025925 Bacteria 8421
114 Ga0207706_10070739 3300025933 Bacteria 3069
115 Ga0207704_10035305 3300025938 Bacteria 2863
116 Ga0207711_10006783 3300025941 Bacteria 9621
117 Ga0207689_10000458 3300025942 Bacteria 38330
118 Ga0207667_10122865 3300025949 Bacteria 2675
119 Ga0207667_10184464 3300025949 Bacteria 2142
120 Ga0207651_10144882 3300025960 Bacteria 1840
121 Ga0207668_10005825 3300025972 Bacteria 7259
122 Ga0207677_10035087 3300026023 Bacteria 3253
123 Ga0207677_10049000 3300026023 Bacteria 2847
124 Ga0207703_10000195 3300026035 Bacteria 70480
125 Ga0207639_10005606 3300026041 Bacteria 8493
126 Ga0207639_10229543 3300026041 Bacteria 1608
127 Ga0207641_10001364 3300026088 Bacteria 24178
128 Ga0207648_10001099 3300026089 Bacteria 30331
129 Ga0207676_10000356 3300026095 Bacteria 39134
130 Ga0207674_10007909 3300026116 Bacteria 12349
131 Ga0207674_10077156 3300026116 Bacteria 3338
132 Ga0207675_100002598 3300026118 Bacteria 17876
133 Ga0209970_1000134 3300027614 Bacteria 11104
134 Ga0209983_1010313 3300027665 Bacteria 1909
135 Ga0209974_10006651 3300027876 Bacteria 4021
136 Ga0268265_10003712 3300028380 Bacteria 10865
137 Ga0268264_10000466 3300028381 Bacteria 55015
138 Ga0307515_10000664 3300028794 Bacteria 79458
139 Ga0307513_10000028 3300031456 Bacteria 193264
140 Ga0307513_10038516 3300031456 Bacteria 5307
141 Ga0307513_10053201 3300031456 Bacteria 4354
142 Ga0307513_10238797 3300031456 Bacteria 1624
143 Ga0307408_100061364 3300031548 Bacteria 2744
144 Ga0307514_10000530 3300031649 Bacteria 74660
145 Ga0307516_10001642 3300031730 Bacteria 30785
146 Ga0307405_10046654 3300031731 Bacteria 2664
147 Ga0307413_10093579 3300031824 Bacteria 1965
148 Ga0307410_10020349 3300031852 Bacteria 4057
149 Ga0307406_10002772 3300031901 Bacteria 9568
150 Ga0307411_10044441 3300032005 Bacteria 2850
151 Ga0307411_10278804 3300032005 Bacteria 1329
152 Ga0307415_100475548 3300032126 Bacteria 1086
153 Ga0395900_0224826 3300037418 Bacteria 1890
154 Ga0395900_0291752 3300037418 Bacteria 1620
155 Ga0395898_0008325 3300037466 Bacteria 10964
156 Ga0395905_0001870 3300037471 Bacteria 24233
157 Ga0395905_0020746 3300037471 Bacteria 6221
158 Ga0395905_0062358 3300037471 Bacteria 3487
159 Ga0395905_0086309 3300037471 Bacteria 2941
160 Ga0395905_0182066 3300037471 Bacteria 1973
161 Ga0395905_0249090 3300037471 Bacteria 1659
162 Ga0436361_0730639 3300039447 Bacteria 1815
163 Ga0436361_0851270 3300039447 Bacteria 59752
164 Ga0439461_0033981 3300041410 Bacteria 1075
165 Ga0451802_0547687 3300041460 Bacteria 3814
166 Ga0451807_1515277 3300041486 Bacteria 1742
167 Ga0451843_1585006 3300041509 Bacteria 1480
168 Ga0439433_0036603 3300041999 Bacteria 1134
169 Ga0439449_0000443 3300042007 Bacteria 15378
170 Ga0439462_0001121 3300042015 Bacteria 5807
171 Ga0439446_0006260 3300042156 Bacteria 3098
172 Ga0451577_0070480 3300042876 Bacteria 3117
173 Ga0466969_0020878 3300044656 Bacteria 3387
174 Ga0453683_0002680 3300044673 Bacteria 13598
175 Ga0466965_0008443 3300044683 Bacteria 4766
176 Ga0466966_0011393 3300044684 Bacteria 5897
177 Ga0466961_0006669 3300044693 Bacteria 7342
178 Ga0466964_0027371 3300044706 Bacteria 2238
179 Ga0453684_0043393 3300044712 Bacteria 6044
180 Ga0466968_0000688 3300044735 Bacteria 11662
181 Ga0466970_0010244 3300044765 Bacteria 4754
182 Ga0466970_0255534 3300044765 Bacteria 982
183 Ga0466959_0104555 3300045049 Bacteria 2025
184 Ga0451576_0004699 3300045051 Bacteria 17568
185 Ga0451576_0045414 3300045051 Bacteria 4627
186 Ga0495643_0003756 3300046522 Bacteria 10987
187 Ga0495663_0068686 3300046525 Bacteria 1125
188 Ga0495656_0017786 3300046615 Bacteria 2718
189 Ga0495669_0014409 3300046684 Bacteria 3380
190 Ga0495687_015829 3300047443 Bacteria 3816
191 Ga0495677_0070564 3300047445 Bacteria 1302
192 Ga0496101_0110143 3300048904 Bacteria 2072
193 Ga0496102_0002929 3300048905 Bacteria 14482
194 Ga0496102_0018662 3300048905 Bacteria 6100
195 Ga0496103_0083530 3300048906 Bacteria 2011
196 Ga0496103_0363652 3300048906 Bacteria 930
197 Ga0496105_0147633 3300048908 Bacteria 1934
198 Ga0496106_0384071 3300048909 Bacteria 1128
199 Ga0496108_0018489 3300048911 Bacteria 5706
200 Ga0496108_0309427 3300048911 Bacteria 1376
201 Ga0496109_0022353 3300048912 Bacteria 5601
202 Ga0496110_0028199 3300048913 Bacteria 4819
203 Ga0496114_0172774 3300048917 Bacteria 1884
204 Ga0496121_0068371 3300048924 Bacteria 2874
205 Ga0496124_0000007 3300048927 Bacteria 883534
206 Ga0501033_0091106 3300049570 Bacteria 2230
207 Ga0501034_0098151 3300049571 Bacteria 2925
208 Ga0501034_0217992 3300049571 Bacteria 1861
209 Ga0501038_0028417 3300049574 Bacteria 4969
210 Ga0501039_0278625 3300049575 Bacteria 1315
211 Ga0501043_0199235 3300049579 Bacteria 1555
212 Ga0501067_0002581 3300049583 Bacteria 10009
213 Ga0501070_0002347 3300049586 Bacteria 16618
214 Ga0501072_0015924 3300049588 Bacteria 5765
215 Ga0501073_0009184 3300049589 Bacteria 7293
216 Ga0501080_0004558 3300049742 Bacteria 12351
217 Ga0501080_0121577 3300049742 Bacteria 2419
218 Ga0501080_0214501 3300049742 Bacteria 1763
219 Ga0501080_0333794 3300049742 Bacteria 1371
220 Ga0501083_0029399 3300049744 Bacteria 3780
221 Ga0501083_0137962 3300049744 Bacteria 1597
222 Ga0501035_0070434 3300049822 Bacteria 3097
223 nmdc:mga0k408_2400_c1 3300050493 Bacteria 9965
224 nmdc:mga0k408_34072_c1 3300050493 Bacteria 2914
225 nmdc:mga07m45_113694_c1 3300050496 Bacteria 1560
226 nmdc:mga07m45_124566_c1 3300050496 Bacteria 1490
227 Ga0500651_0002762 3300053093 Bacteria 9395
228 Ga0500618_001595 3300053125 Bacteria 9861
229 Ga0500586_030293 3300053145 Bacteria 1778
230 Ga0500619_000116 3300053154 Bacteria 21263
231 Ga0500645_001311 3300053730 Bacteria 12909
232 Ga0500645_011111 3300053730 Bacteria 2951
233 Ga0501084_0121842 3300054114 Bacteria 2193
234 Ga0500661_006245 3300055283 Bacteria 2219
235 Ga0590071_002620 3300059421 Bacteria 4521
236 Ga0590075_013555 3300059424 Bacteria 1990
237 Ga0530510_0183962 3300061734 Bacteria 1550

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0182066 Ga0395905_0182066_711_1559 259
2 3300005434 Ga0070709_10042631 Ga0070709_100426312 260
3 3300049742 Ga0501080_0333794 Ga0501080_0333794_343_1203 260
4 3300044765 Ga0466970_0255534 Ga0466970_0255534_156_965 267
5 3300049570 Ga0501033_0091106 Ga0501033_0091106_11_853 278
6 3300041509 Ga0451843_1585006 Ga0451843_1585006_526_1422 279
7 iso_pu_bacteria 2834641062 2834645156 280
8 iso_pu_bacteria 8003400568 8003403624 280
9 iso_pu_bacteria 8048746797 8048749820 280
10 3300005293 Ga0065715_10109686 Ga0065715_101096862 281
11 3300005331 Ga0070670_100021726 Ga0070670_1000217265 281
12 3300005331 Ga0070670_100259134 Ga0070670_1002591341 281
13 3300005334 Ga0068869_100000007 Ga0068869_10000000755 281
14 3300005338 Ga0068868_100049628 Ga0068868_1000496283 281
15 3300005340 Ga0070689_100017953 Ga0070689_1000179534 281
16 3300005347 Ga0070668_100011276 Ga0070668_1000112765 281
17 3300005364 Ga0070673_100039686 Ga0070673_1000396861 281
18 3300005367 Ga0070667_100000332 Ga0070667_10000033229 281
19 3300005457 Ga0070662_100056848 Ga0070662_1000568483 281
20 3300005458 Ga0070681_10002150 Ga0070681_1000215016 281
21 3300005459 Ga0068867_100000694 Ga0068867_1000006945 281
22 3300005530 Ga0070679_100004470 Ga0070679_10000447014 281
23 3300005539 Ga0068853_100239623 Ga0068853_1002396232 281
24 3300005563 Ga0068855_100154992 Ga0068855_1001549923 281
25 3300005577 Ga0068857_100001549 Ga0068857_1000015499 281
26 3300005577 Ga0068857_100098667 Ga0068857_1000986672 281
27 3300005614 Ga0068856_100184650 Ga0068856_1001846502 281
28 3300005617 Ga0068859_100000241 Ga0068859_10000024124 281
29 3300005718 Ga0068866_10099096 Ga0068866_100990962 281
30 3300005840 Ga0068870_10002462 Ga0068870_100024622 281
31 3300005841 Ga0068863_100002079 Ga0068863_1000020799 281
32 3300005842 Ga0068858_100000331 Ga0068858_10000033123 281
33 3300005843 Ga0068860_100001594 Ga0068860_10000159422 281
34 3300005844 Ga0068862_100007775 Ga0068862_1000077754 281
35 3300006871 Ga0075434_100210569 Ga0075434_1002105692 281
36 3300006931 Ga0097620_100000241 Ga0097620_10000024124 281
37 3300009094 Ga0111539_10219629 Ga0111539_102196292 281
38 3300010375 Ga0105239_10363937 Ga0105239_103639371 281
39 3300013100 Ga0157373_10001519 Ga0157373_1000151919 281
40 3300013307 Ga0157372_10086758 Ga0157372_100867582 281
41 3300025908 Ga0207643_10003861 Ga0207643_100038612 281
42 3300025912 Ga0207707_10015161 Ga0207707_100151612 281
43 3300025921 Ga0207652_10042793 Ga0207652_100427933 281
44 3300025922 Ga0207646_10357830 Ga0207646_103578302 281
45 3300025925 Ga0207650_10005808 Ga0207650_100058086 281
46 3300025933 Ga0207706_10070739 Ga0207706_100707393 281
47 3300025938 Ga0207704_10035305 Ga0207704_100353052 281
48 3300025941 Ga0207711_10006783 Ga0207711_1000678312 281
49 3300025942 Ga0207689_10000458 Ga0207689_1000045814 281
50 3300025949 Ga0207667_10122865 Ga0207667_101228653 281
51 3300025960 Ga0207651_10144882 Ga0207651_101448821 281
52 3300025972 Ga0207668_10005825 Ga0207668_100058255 281
53 3300026023 Ga0207677_10049000 Ga0207677_100490003 281
54 3300026035 Ga0207703_10000195 Ga0207703_1000019546 281
55 3300026041 Ga0207639_10005606 Ga0207639_1000560611 281
56 3300026041 Ga0207639_10229543 Ga0207639_102295432 281
57 3300026088 Ga0207641_10001364 Ga0207641_100013645 281
58 3300026089 Ga0207648_10001099 Ga0207648_1000109925 281
59 3300026095 Ga0207676_10000356 Ga0207676_1000035621 281
60 3300026116 Ga0207674_10007909 Ga0207674_100079093 281
61 3300026116 Ga0207674_10077156 Ga0207674_100771562 281
62 3300026118 Ga0207675_100002598 Ga0207675_1000025987 281
63 3300028380 Ga0268265_10003712 Ga0268265_1000371214 281
64 3300028381 Ga0268264_10000466 Ga0268264_1000046632 281
65 3300031731 Ga0307405_10046654 Ga0307405_100466541 281
66 3300031824 Ga0307413_10093579 Ga0307413_100935792 281
67 3300031852 Ga0307410_10020349 Ga0307410_100203493 281
68 3300032005 Ga0307411_10044441 Ga0307411_100444414 281
69 3300032005 Ga0307411_10278804 Ga0307411_102788041 281
70 3300032126 Ga0307415_100475548 Ga0307415_1004755481 281
71 3300039447 Ga0436361_0730639 Ga0436361_0730639_452_1297 281
72 3300044683 Ga0466965_0008443 Ga0466965_0008443_3082_3927 281
73 3300044706 Ga0466964_0027371 Ga0466964_0027371_216_1061 281
74 3300044735 Ga0466968_0000688 Ga0466968_0000688_6168_7013 281
75 3300047443 Ga0495687_015829 Ga0495687_015829_1609_2457 281
76 3300048905 Ga0496102_0002929 Ga0496102_0002929_7930_8775 281
77 3300048906 Ga0496103_0363652 Ga0496103_0363652_14_859 281
78 3300049571 Ga0501034_0098151 Ga0501034_0098151_578_1453 281
79 3300049583 Ga0501067_0002581 Ga0501067_0002581_1462_2337 281
80 3300049586 Ga0501070_0002347 Ga0501070_0002347_9567_10442 281
81 3300049588 Ga0501072_0015924 Ga0501072_0015924_18_893 281
82 3300049589 Ga0501073_0009184 Ga0501073_0009184_1375_2250 281
83 3300049742 Ga0501080_0004558 Ga0501080_0004558_1489_2364 281
84 3300049742 Ga0501080_0214501 Ga0501080_0214501_455_1324 281
85 3300049744 Ga0501083_0029399 Ga0501083_0029399_2147_3016 281
86 3300049744 Ga0501083_0137962 Ga0501083_0137962_247_1122 281
87 3300053125 Ga0500618_001595 Ga0500618_001595_2612_3457 281
88 3300054114 Ga0501084_0121842 Ga0501084_0121842_142_1017 281
89 3300061734 Ga0530510_0183962 Ga0530510_0183962_84_959 281
90 iso_pu_bacteria 2857542790 2857543909 281
91 3300009093 Ga0105240_10508550 Ga0105240_105085501 283
92 3300025913 Ga0207695_10507862 Ga0207695_105078622 283
93 iso_pu_bacteria 2881101125 2881102094 283
94 3300037418 Ga0395900_0291752 Ga0395900_0291752_652_1545 285
95 3300048924 Ga0496121_0068371 Ga0496121_0068371_1800_2666 285
96 3300048927 Ga0496124_0000007 Ga0496124_0000007_235882_236748 285
97 3300048904 Ga0496101_0110143 Ga0496101_0110143_277_1152 286
98 3300048908 Ga0496105_0147633 Ga0496105_0147633_58_933 286
99 3300048911 Ga0496108_0309427 Ga0496108_0309427_227_1102 286
100 3300048913 Ga0496110_0028199 Ga0496110_0028199_2444_3319 286
101 3300021361 Ga0213872_10000367 Ga0213872_1000036730 288
102 3300027614 Ga0209970_1000134 Ga0209970_100013413 288
103 3300027665 Ga0209983_1010313 Ga0209983_10103132 288
104 3300027876 Ga0209974_10006651 Ga0209974_100066513 288
105 3300039447 Ga0436361_0851270 Ga0436361_0851270_40013_40882 288
106 3300042156 Ga0439446_0006260 Ga0439446_0006260_216_1091 288
107 3300053154 Ga0500619_000116 Ga0500619_000116_15479_16354 288
108 3300005618 Ga0068864_100004428 Ga0068864_1000044281 289
109 3300009098 Ga0105245_10064056 Ga0105245_100640563 289
110 3300009101 Ga0105247_10062547 Ga0105247_100625472 289
111 3300009177 Ga0105248_10005176 Ga0105248_1000517613 289
112 3300009545 Ga0105237_10167359 Ga0105237_101673592 289
113 3300013308 Ga0157375_10013427 Ga0157375_100134279 289
114 3300014968 Ga0157379_10000142 Ga0157379_100001429 289
115 3300025900 Ga0207710_10047714 Ga0207710_100477142 289
116 3300046522 Ga0495643_0003756 Ga0495643_0003756_2273_3241 289
117 3300048905 Ga0496102_0018662 Ga0496102_0018662_2139_3065 289
118 3300048906 Ga0496103_0083530 Ga0496103_0083530_14_940 289
119 3300048909 Ga0496106_0384071 Ga0496106_0384071_34_960 289
120 3300048911 Ga0496108_0018489 Ga0496108_0018489_2589_3515 289
121 3300048912 Ga0496109_0022353 Ga0496109_0022353_3789_4715 289
122 3300048917 Ga0496114_0172774 Ga0496114_0172774_223_1107 291
123 3300003794 Ga0055531_10001023 Ga0055531_100010238 292
124 3300006195 Ga0075366_10007032 Ga0075366_100070326 292
125 3300025273 Ga0209673_1014574 Ga0209673_10145744 292
126 3300025303 Ga0209051_1000263 Ga0209051_10002634 292
127 3300025304 Ga0209257_1000108 Ga0209257_100010896 292
128 3300044712 Ga0453684_0043393 Ga0453684_0043393_3240_4148 292
129 3300049571 Ga0501034_0217992 Ga0501034_0217992_515_1396 292
130 3300049574 Ga0501038_0028417 Ga0501038_0028417_216_1097 292
131 3300049579 Ga0501043_0199235 Ga0501043_0199235_487_1371 292
132 3300049742 Ga0501080_0121577 Ga0501080_0121577_511_1392 292
133 3300050493 nmdc:mga0k408_2400_c1 nmdc:mga0k408_2400_c1_3715_4605 292
134 3300050496 nmdc:mga07m45_113694_c1 nmdc:mga07m45_113694_c1_327_1211 292
135 3300050496 nmdc:mga07m45_124566_c1 nmdc:mga07m45_124566_c1_596_1477 292
136 3300053145 Ga0500586_030293 Ga0500586_030293_62_964 292
137 3300006177 Ga0075362_10160040 Ga0075362_101600402 293
138 3300031730 Ga0307516_10001642 Ga0307516_1000164221 293
139 3300037418 Ga0395900_0224826 Ga0395900_0224826_257_1144 293
140 3300037471 Ga0395905_0249090 Ga0395905_0249090_428_1315 293
141 3300041410 Ga0439461_0033981 Ga0439461_0033981_107_991 293
142 3300041460 Ga0451802_0547687 Ga0451802_0547687_2324_3229 293
143 3300041999 Ga0439433_0036603 Ga0439433_0036603_151_1035 293
144 3300042007 Ga0439449_0000443 Ga0439449_0000443_6271_7155 293
145 3300042015 Ga0439462_0001121 Ga0439462_0001121_3708_4592 293
146 3300044673 Ga0453683_0002680 Ga0453683_0002680_740_1624 293
147 3300045051 Ga0451576_0004699 Ga0451576_0004699_4053_4937 293
148 3300049575 Ga0501039_0278625 Ga0501039_0278625_262_1146 293
149 3300049822 Ga0501035_0070434 Ga0501035_0070434_656_1591 293
150 3300059421 Ga0590071_002620 Ga0590071_002620_607_1512 293
151 3300059424 Ga0590075_013555 Ga0590075_013555_135_1019 293
152 3300005530 Ga0070679_100004108 Ga0070679_10000410814 294
153 3300005563 Ga0068855_100002511 Ga0068855_1000025117 294
154 3300005563 Ga0068855_100161898 Ga0068855_1001618983 294
155 3300006038 Ga0075365_10023655 Ga0075365_100236556 294
156 3300009093 Ga0105240_10011576 Ga0105240_1001157611 294
157 3300009174 Ga0105241_10084034 Ga0105241_100840343 294
158 3300010375 Ga0105239_10054644 Ga0105239_100546443 294
159 3300014969 Ga0157376_10111716 Ga0157376_101117161 294
160 3300025913 Ga0207695_10182687 Ga0207695_101826872 294
161 3300025921 Ga0207652_10023009 Ga0207652_100230092 294
162 3300025921 Ga0207652_10056312 Ga0207652_100563123 294
163 3300026023 Ga0207677_10035087 Ga0207677_100350874 294
164 3300037466 Ga0395898_0008325 Ga0395898_0008325_6208_7104 294
165 3300037471 Ga0395905_0020746 Ga0395905_0020746_24_920 294
166 3300037471 Ga0395905_0062358 Ga0395905_0062358_899_1786 294
167 3300042876 Ga0451577_0070480 Ga0451577_0070480_432_1373 294
168 3300044656 Ga0466969_0020878 Ga0466969_0020878_808_1698 294
169 3300044684 Ga0466966_0011393 Ga0466966_0011393_3966_4856 294
170 3300044693 Ga0466961_0006669 Ga0466961_0006669_1153_2043 294
171 3300044765 Ga0466970_0010244 Ga0466970_0010244_2889_3779 294
172 3300045049 Ga0466959_0104555 Ga0466959_0104555_807_1697 294
173 3300045051 Ga0451576_0045414 Ga0451576_0045414_1576_2517 294
174 3300005327 Ga0070658_10237365 Ga0070658_102373651 295
175 3300025949 Ga0207667_10184464 Ga0207667_101844644 295
176 3300037471 Ga0395905_0001870 Ga0395905_0001870_6852_7748 295
177 3300037471 Ga0395905_0086309 Ga0395905_0086309_1988_2878 295
178 3300046525 Ga0495663_0068686 Ga0495663_0068686_153_1049 295
179 3300046615 Ga0495656_0017786 Ga0495656_0017786_346_1242 295
180 3300046684 Ga0495669_0014409 Ga0495669_0014409_2233_3129 295
181 3300047445 Ga0495677_0070564 Ga0495677_0070564_64_960 295
182 3300050493 nmdc:mga0k408_34072_c1 nmdc:mga0k408_34072_c1_747_1637 295
183 iso_pu_bacteria 2511231002 2511244966 296
184 3300031456 Ga0307513_10000028 Ga0307513_1000002860 297
185 3300053093 Ga0500651_0002762 Ga0500651_0002762_2922_3842 297
186 3300028794 Ga0307515_10000664 Ga0307515_1000066428 298
187 3300031456 Ga0307513_10053201 Ga0307513_100532013 298
188 3300031649 Ga0307514_10000530 Ga0307514_1000053063 298
189 3300002987 JGI25159J45721_1008761 JGI25159J45721_10087614 299
190 3300003771 Ga0055526_1002001 Ga0055526_100200115 299
191 3300003773 Ga0055537_1000265 Ga0055537_10002654 299
192 3300003775 Ga0055524_1000338 Ga0055524_100033852 299
193 3300003775 Ga0055524_1001001 Ga0055524_10010019 299
194 3300003784 Ga0055534_1003904 Ga0055534_10039047 299
195 3300003790 Ga0055528_1001252 Ga0055528_100125214 299
196 3300003791 Ga0055530_10005110 Ga0055530_100051104 299
197 3300003792 Ga0055540_1000274 Ga0055540_10002749 299
198 3300003794 Ga0055531_10003006 Ga0055531_100030065 299
199 3300025263 Ga0209565_1000309 Ga0209565_10003097 299
200 3300025273 Ga0209673_1000088 Ga0209673_1000088154 299
201 3300025291 Ga0209675_1000133 Ga0209675_100013332 299
202 3300025292 Ga0209676_1000073 Ga0209676_1000073257 299
203 3300025294 Ga0209025_1039332 Ga0209025_10393323 299
204 3300025295 Ga0209564_1001205 Ga0209564_10012058 299
205 3300025298 Ga0209050_1000008 Ga0209050_1000008805 299
206 3300025299 Ga0209256_1000096 Ga0209256_100009653 299
207 3300025303 Ga0209051_1000005 Ga0209051_1000005805 299
208 3300025304 Ga0209257_1000031 Ga0209257_1000031395 299
209 3300002987 JGI25159J45721_1005752 JGI25159J45721_10057522 300
210 3300003354 JGI25160J50197_1000198 JGI25160J50197_10001989 300
211 3300003374 JGI25161J50226_1000021 JGI25161J50226_1000021112 300
212 3300003771 Ga0055526_1013484 Ga0055526_10134843 300
213 3300004625 Ga0055543_1000107 Ga0055543_100010710 300
214 3300005262 Ga0065165_1012553 Ga0065165_10125534 300
215 3300006048 Ga0075363_100032958 Ga0075363_1000329582 300
216 3300006177 Ga0075362_10007084 Ga0075362_100070843 300
217 3300006195 Ga0075366_10101179 Ga0075366_101011792 300
218 3300025263 Ga0209565_1002905 Ga0209565_10029057 300
219 3300025284 Ga0209130_1000103 Ga0209130_100010352 300
220 3300025284 Ga0209130_1004160 Ga0209130_10041604 300
221 3300025291 Ga0209675_1016392 Ga0209675_10163922 300
222 3300025292 Ga0209676_1002105 Ga0209676_100210518 300
223 3300025294 Ga0209025_1012041 Ga0209025_10120416 300
224 3300025295 Ga0209564_1000702 Ga0209564_100070251 300
225 3300025295 Ga0209564_1007939 Ga0209564_10079395 300
226 3300025297 Ga0209758_1014270 Ga0209758_10142705 300
227 3300025302 Ga0207426_1000586 Ga0207426_100058652 300
228 3300025304 Ga0209257_1010849 Ga0209257_10108495 300
229 3300031456 Ga0307513_10238797 Ga0307513_102387973 300
230 3300031548 Ga0307408_100061364 Ga0307408_1000613642 300
231 3300031901 Ga0307406_10002772 Ga0307406_100027726 300
232 3300055283 Ga0500661_006245 Ga0500661_006245_659_1561 300
233 3300002705 JGI25156J39149_1000040 JGI25156J39149_100004065 301
234 3300002738 JGI25154J39366_1000060 JGI25154J39366_100006053 301
235 3300002741 JGI25157J39369_1000058 JGI25157J39369_100005853 301
236 3300025206 Ga0209435_100019 Ga0209435_10001953 301
237 3300025246 Ga0209646_1000038 Ga0209646_100003853 301
238 3300025250 Ga0209026_1000048 Ga0209026_100004853 301
239 3300025256 Ga0209759_1000038 Ga0209759_1000038191 301
240 3300031456 Ga0307513_10038516 Ga0307513_100385166 301
241 3300041486 Ga0451807_1515277 Ga0451807_1515277_446_1351 301
242 3300053730 Ga0500645_001311 Ga0500645_001311_2798_3703 301
243 3300053730 Ga0500645_011111 Ga0500645_011111_241_1146 301

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

37

267

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tm5-assembly1.cif.gz_A-2 x-ray crystal structure of a d-amino acid aminotransferase from burkholderia thailandensis e264 bound to the co-factor pyridoxal phosphate 0.9464 13 300
1g2w-assembly1.cif.gz_B e177s mutant of the pyridoxal-5'-phosphate enzyme d-amino acid aminotransferase 0.9454 13 298
4daa-assembly1.cif.gz_A crystallographic structure of d-amino acid aminotransferase in pyridoxal-5'-phosphate (plp) form 0.9442 13 298
5daa-assembly1.cif.gz_B e177k mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate 0.942 13 298
2dab-assembly1.cif.gz_A l201a mutant of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate 0.9361 13 297
ID Description Score Start End Superfamily
4pbcB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9899 167 300 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9743 138 300 3.20.10.10
3lqsA02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9479 139 297 3.20.10.10
4m0jB02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9423 138 300 3.20.10.10
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9252 13 135 3.30.470.10
ID Description Score Start End GO Terms
AF-A0A660NIT6-F1-model_v4 D-amino acid aminotransferase 0.9884 164 300 GO:0005829
GO:0008483
GO:0046394
AF-A0A1I3DGV3-F1-model_v4 D-alanine transaminase 0.977 11 301 GO:0003824
GO:0005829
GO:0046394
AF-A0A1J5BHS3-F1-model_v4 D-amino acid aminotransferase 0.9735 104 301 GO:0005829
GO:0008483
GO:0046394
AF-A0A4Y1Z9P1-F1-model_v4 D-alanine aminotransferase (EC 2.6.1.21) 0.9733 152 300 GO:0005829
GO:0046394
GO:0047810
AF-A0A3G8H0P2-F1-model_v4 D-amino acid aminotransferase 0.9725 9 300 GO:0005829
GO:0008483
GO:0046394

Feature Viewer

pLDDT pTM Quality
90.14 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map