F355879

General Info

Members Datasets Scaffolds Average Seq Length
243 174 486 319

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0000054|Ga0495606_0000054_32932_33975
Length 347
Sequence MTTLGANLRRRQWPHQKQQKGAVQLTQLRRLGTTDLHIAPLVLGGNVFSWTLDKQASFAVLDAFAAAGGTLIDTADAYSVWVPGHVGGESESLIGEWLKKSGKRNTMLIATKVGELPGEGGEKLAPARIAAACDASLKRLGVDQIDLYFAHHDDENTPQEEVLGAFAKLVEAGKVRALGASNFSAARLKSANEIALANGLPEFQALQPEYNLVSRHTFEGDLQNYCVAKTIGAVPYFGLAAGFLTGKYRSAADLGKSVRGRRMAPFIEGKGLAVLAAMDAIAEDTGATLAQIALAWLAAQQGITAPIASATSPAQVEELAGSMALSLSPTQLDALTLASAGASLSVM

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
147 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
162 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
165 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
166 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
167 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
168 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
169 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
170 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
171 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
172 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
173 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
174 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0.82
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 1.23
Bulb 0
Endosphere 12.35
Nodule 0
Rhizoplane 2.06
Rhizosphere 76.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0000054 3300046507 Bacteria 200380
2 JGI24752J21851_1000407 3300001976 Bacteria 5889
3 JGI24735J21928_10002566 3300002067 Bacteria 6282
4 JGI25150J39212_1001113 3300002774 Bacteria 8088
5 JGI25153J46596_10000253 3300003215 Bacteria 43821
6 Ga0055526_1015744 3300003771 Bacteria 3015
7 Ga0055537_1001769 3300003773 Bacteria 7909
8 Ga0055536_1021688 3300003781 Bacteria 1940
9 Ga0055540_1004406 3300003792 Bacteria 6366
10 Ga0055540_1005915 3300003792 Bacteria 4993
11 Ga0065165_1014413 3300005262 Bacteria 3072
12 Ga0070658_10111855 3300005327 Bacteria 2263
13 Ga0070683_100040441 3300005329 Bacteria 4287
14 Ga0070690_100060008 3300005330 Bacteria 2447
15 Ga0070677_10001128 3300005333 Bacteria 8594
16 Ga0070677_10013104 3300005333 Bacteria 2892
17 Ga0070677_10078103 3300005333 Bacteria 1410
18 Ga0070666_10009812 3300005335 Bacteria 5980
19 Ga0070680_100000081 3300005336 Bacteria 52556
20 Ga0070660_100001321 3300005339 Bacteria 16883
21 Ga0070660_100010425 3300005339 Bacteria 6568
22 Ga0070689_100095355 3300005340 Bacteria 2350
23 Ga0070661_100000009 3300005344 Bacteria 181351
24 Ga0070692_10009916 3300005345 Bacteria 4314
25 Ga0070668_100020418 3300005347 Bacteria 4999
26 Ga0070669_100091133 3300005353 Bacteria 2286
27 Ga0070675_100000199 3300005354 Bacteria 37845
28 Ga0070675_100022786 3300005354 Bacteria 5004
29 Ga0070675_100035240 3300005354 Bacteria 4065
30 Ga0070673_100008889 3300005364 Bacteria 6712
31 Ga0070673_100038837 3300005364 Bacteria 3639
32 Ga0070673_100078565 3300005364 Bacteria 2670
33 Ga0070659_100006371 3300005366 Bacteria 8525
34 Ga0070659_100020847 3300005366 Bacteria 4985
35 Ga0070667_100000322 3300005367 Bacteria 53499
36 Ga0070667_100001982 3300005367 Bacteria 18152
37 Ga0070667_100301024 3300005367 Bacteria 1444
38 Ga0070678_100020512 3300005456 Bacteria 4338
39 Ga0070678_100036463 3300005456 Bacteria 3442
40 Ga0070678_100343056 3300005456 Bacteria 1282
41 Ga0070662_100200592 3300005457 Bacteria 1583
42 Ga0068867_100017655 3300005459 Bacteria 5066
43 Ga0068867_100038718 3300005459 Bacteria 3472
44 Ga0070679_100000031 3300005530 Bacteria 107526
45 Ga0070672_100002690 3300005543 Bacteria 11370
46 Ga0070686_100320067 3300005544 Bacteria 1156
47 Ga0070693_100013417 3300005547 Bacteria 4174
48 Ga0070665_100120712 3300005548 Bacteria 2623
49 Ga0068855_100078786 3300005563 Bacteria 3822
50 Ga0068855_100267526 3300005563 Bacteria 1902
51 Ga0068857_100042620 3300005577 Bacteria 4027
52 Ga0068859_100016607 3300005617 Bacteria 7390
53 Ga0068859_100062313 3300005617 Bacteria 3759
54 Ga0068864_100000004 3300005618 Bacteria 489341
55 Ga0068864_100000354 3300005618 Bacteria 40336
56 Ga0068864_100009097 3300005618 Bacteria 8188
57 Ga0068864_100033182 3300005618 Bacteria 4388
58 Ga0068861_100245037 3300005719 Bacteria 1526
59 Ga0068863_100000002 3300005841 Bacteria 489510
60 Ga0068863_100252579 3300005841 Bacteria 1703
61 Ga0068858_100000262 3300005842 Bacteria 56062
62 Ga0068862_100000002 3300005844 Bacteria 489341
63 Ga0081540_1031766 3300005983 Bacteria 2895
64 Ga0070717_10068224 3300006028 Bacteria 2960
65 Ga0097621_100054328 3300006237 Bacteria 3266
66 Ga0097621_100074838 3300006237 Bacteria 2805
67 Ga0097621_100177880 3300006237 Bacteria 1837
68 Ga0097621_100319609 3300006237 Bacteria 1375
69 Ga0068871_100025788 3300006358 Bacteria 4578
70 Ga0068871_100216845 3300006358 Bacteria 1657
71 Ga0068865_100050628 3300006881 Bacteria 2870
72 Ga0097620_100016607 3300006931 Bacteria 7390
73 Ga0097620_100062316 3300006931 Bacteria 3759
74 Ga0105251_10002072 3300009011 Bacteria 16178
75 Ga0105248_10005317 3300009177 Bacteria 14175
76 Ga0105248_10026083 3300009177 Bacteria 6502
77 Ga0105248_10066801 3300009177 Bacteria 4037
78 Ga0105248_10068686 3300009177 Bacteria 3979
79 Ga0105238_10214190 3300009551 Bacteria 1903
80 Ga0105249_10000106 3300009553 Bacteria 115526
81 Ga0105239_10002081 3300010375 Bacteria 25940
82 Ga0157369_10075320 3300013105 Bacteria 3619
83 Ga0157374_10008718 3300013296 Bacteria 8674
84 Ga0157374_10130292 3300013296 Bacteria 2434
85 Ga0157378_10156414 3300013297 Bacteria 2129
86 Ga0163162_10003584 3300013306 Bacteria 14856
87 Ga0157375_10015677 3300013308 Bacteria 6788
88 Ga0157375_10655696 3300013308 Bacteria 1206
89 Ga0157379_10002033 3300014968 Bacteria 16785
90 Ga0157379_10176807 3300014968 Bacteria 1927
91 Ga0157376_10011894 3300014969 Bacteria 6435
92 Ga0157376_10021468 3300014969 Bacteria 5015
93 Ga0157376_10152766 3300014969 Bacteria 2084
94 Ga0163161_10176903 3300017792 Bacteria 1634
95 Ga0206354_11303983 3300020081 Bacteria 3470
96 Ga0206353_11106162 3300020082 Bacteria 4265
97 Ga0213873_10000049 3300021358 Bacteria 26948
98 Ga0213876_10000021 3300021384 Bacteria 260105
99 Ga0213876_10005801 3300021384 Bacteria 6760
100 Ga0213875_10002628 3300021388 Bacteria 10644
101 Ga0207425_1000094 3300025245 Bacteria 85629
102 Ga0209129_1001201 3300025258 Bacteria 14903
103 Ga0209233_1000052 3300025261 Bacteria 445813
104 Ga0209565_1000291 3300025263 Bacteria 48450
105 Ga0209673_1030992 3300025273 Bacteria 1673
106 Ga0209676_1008769 3300025292 Bacteria 4456
107 Ga0209025_1000630 3300025294 Bacteria 62487
108 Ga0209564_1001220 3300025295 Bacteria 29066
109 Ga0209564_1026147 3300025295 Bacteria 1938
110 Ga0209758_1000002 3300025297 Bacteria 1400310
111 Ga0209758_1000108 3300025297 Bacteria 216541
112 Ga0209050_1000342 3300025298 Bacteria 92644
113 Ga0209050_1024443 3300025298 Bacteria 2089
114 Ga0207426_1028760 3300025302 Bacteria 1840
115 Ga0209051_1000226 3300025303 Bacteria 94990
116 Ga0209257_1001667 3300025304 Bacteria 25114
117 Ga0209257_1001937 3300025304 Bacteria 22336
118 Ga0207713_1005825 3300025735 Bacteria 7626
119 Ga0207682_10019613 3300025893 Bacteria 2648
120 Ga0207682_10047934 3300025893 Bacteria 1761
121 Ga0207710_10037255 3300025900 Bacteria 2147
122 Ga0207705_10000002 3300025909 Bacteria 2046852
123 Ga0207705_10044168 3300025909 Bacteria 3202
124 Ga0207705_10119476 3300025909 Bacteria 1954
125 Ga0207707_10083280 3300025912 Bacteria 2793
126 Ga0207695_10006423 3300025913 Bacteria 15266
127 Ga0207660_10003047 3300025917 Bacteria 10958
128 Ga0207662_10088897 3300025918 Bacteria 1897
129 Ga0207657_10001669 3300025919 Bacteria 23945
130 Ga0207657_10009370 3300025919 Bacteria 9848
131 Ga0207657_10048773 3300025919 Bacteria 3695
132 Ga0207649_10000190 3300025920 Bacteria 50479
133 Ga0207652_10000003 3300025921 Bacteria 502441
134 Ga0207652_10068364 3300025921 Bacteria 3082
135 Ga0207681_10135166 3300025923 Bacteria 1829
136 Ga0207681_10136052 3300025923 Bacteria 1823
137 Ga0207650_10028720 3300025925 Bacteria 3992
138 Ga0207659_10001828 3300025926 Bacteria 12600
139 Ga0207659_10005032 3300025926 Bacteria 8012
140 Ga0207659_10039672 3300025926 Bacteria 3286
141 Ga0207700_10016803 3300025928 Bacteria 4872
142 Ga0207690_10004149 3300025932 Bacteria 8567
143 Ga0207690_10008855 3300025932 Bacteria 5972
144 Ga0207690_10014431 3300025932 Bacteria 4772
145 Ga0207706_10019733 3300025933 Bacteria 6063
146 Ga0207670_10011254 3300025936 Bacteria 5187
147 Ga0207704_10017080 3300025938 Bacteria 3751
148 Ga0207691_10007407 3300025940 Bacteria 10568
149 Ga0207691_10098267 3300025940 Bacteria 2615
150 Ga0207711_10000022 3300025941 Bacteria 340441
151 Ga0207711_10016636 3300025941 Bacteria 6108
152 Ga0207711_10022306 3300025941 Bacteria 5293
153 Ga0207711_10195340 3300025941 Bacteria 1845
154 Ga0207711_10257245 3300025941 Bacteria 1604
155 Ga0207661_10080684 3300025944 Bacteria 2685
156 Ga0207679_10102230 3300025945 Bacteria 2244
157 Ga0207679_10148174 3300025945 Bacteria 1906
158 Ga0207651_10024218 3300025960 Bacteria 3750
159 Ga0207712_10004350 3300025961 Bacteria 8946
160 Ga0207668_10024871 3300025972 Bacteria 3870
161 Ga0207668_10363032 3300025972 Bacteria 1214
162 Ga0207658_10000589 3300025986 Bacteria 32594
163 Ga0207658_10031032 3300025986 Bacteria 3791
164 Ga0207658_10166512 3300025986 Bacteria 1811
165 Ga0207703_10000277 3300026035 Bacteria 56761
166 Ga0207678_10001633 3300026067 Bacteria 20554
167 Ga0207641_10000002 3300026088 Bacteria 981004
168 Ga0207648_10016909 3300026089 Bacteria 6648
169 Ga0207648_10039138 3300026089 Bacteria 4169
170 Ga0207676_10000040 3300026095 Bacteria 167947
171 Ga0207676_10003399 3300026095 Bacteria 11245
172 Ga0207676_10006001 3300026095 Bacteria 8567
173 Ga0207674_10014458 3300026116 Bacteria 8715
174 Ga0207675_100053673 3300026118 Bacteria 3760
175 Ga0207683_10005419 3300026121 Bacteria 10931
176 Ga0207683_10028075 3300026121 Bacteria 4865
177 Ga0207683_10053921 3300026121 Bacteria 3526
178 Ga0207698_10095503 3300026142 Bacteria 2447
179 Ga0268265_10000003 3300028380 Bacteria 949201
180 Ga0265339_10001722 3300031249 Bacteria 16118
181 Ga0265316_10164575 3300031344 Bacteria 1657
182 Ga0307508_10002317 3300031616 Bacteria 20218
183 Ga0395899_0000274 3300037312 Bacteria 67210
184 Ga0395900_0001146 3300037418 Bacteria 33378
185 Ga0395898_0000788 3300037466 Bacteria 54310
186 Ga0395905_0001287 3300037471 Bacteria 30898
187 Ga0395905_0087958 3300037471 Bacteria 2913
188 Ga0395901_0000866 3300038443 Bacteria 33378
189 Ga0436365_0066479 3300039437 Bacteria 6695
190 Ga0436365_0591960 3300039437 Bacteria 5494
191 Ga0436365_0618060 3300039437 Bacteria 25583
192 Ga0436362_0126459 3300039453 Bacteria 236400
193 Ga0439464_0005797 3300042439 Bacteria 3202
194 Ga0451577_0096687 3300042876 Bacteria 2637
195 Ga0495638_0000484 3300046460 Bacteria 47792
196 Ga0495606_0006965 3300046507 Bacteria 10277
197 Ga0495606_0217233 3300046507 Bacteria 1079
198 Ga0495648_0128141 3300046524 Bacteria 1353
199 Ga0495654_0004068 3300046530 Bacteria 8781
200 Ga0495649_0000501 3300046694 Bacteria 33497
201 Ga0495674_0091564 3300047319 Bacteria 2597
202 Ga0495679_003321 3300047446 Bacteria 7779
203 Ga0496101_0271236 3300048904 Bacteria 1325
204 Ga0496109_0089425 3300048912 Bacteria 2847
205 Ga0496110_0058417 3300048913 Bacteria 3398
206 Ga0496114_0036202 3300048917 Bacteria 4079
207 Ga0496115_0019740 3300048918 Bacteria 5190
208 Ga0496117_0003086 3300048920 Bacteria 19943
209 Ga0496118_0002584 3300048921 Bacteria 24182
210 Ga0496121_0005116 3300048924 Bacteria 17089
211 Ga0496122_0001932 3300048925 Bacteria 31245
212 Ga0496123_0002702 3300048926 Bacteria 21325
213 Ga0496124_0000022 3300048927 Bacteria 421020
214 Ga0496126_0055236 3300048929 Bacteria 3594
215 Ga0501031_0027339 3300049568 Bacteria 3720
216 Ga0501032_0025487 3300049569 Bacteria 4076
217 Ga0501036_0088639 3300049572 Bacteria 2614
218 Ga0501038_0023889 3300049574 Bacteria 5459
219 Ga0501039_0064031 3300049575 Bacteria 2849
220 Ga0501043_0132625 3300049579 Bacteria 1952
221 Ga0501046_0262405 3300049580 Bacteria 1269
222 Ga0501047_0058809 3300049581 Bacteria 3713
223 Ga0501070_0036414 3300049586 Bacteria 4109
224 Ga0501071_0049912 3300049587 Bacteria 3013
225 Ga0501073_0018310 3300049589 Bacteria 5061
226 Ga0501080_0046188 3300049742 Bacteria 4056
227 Ga0501035_0030368 3300049822 Bacteria 4927
228 Ga0501044_0024389 3300049823 Bacteria 6422
229 Ga0500595_043291 3300053119 Bacteria 1434
230 Ga0500618_000341 3300053125 Bacteria 33449
231 Ga0500559_0000026 3300053136 Bacteria 120494
232 Ga0500559_0000460 3300053136 Bacteria 28961
233 Ga0500573_0001088 3300053140 Bacteria 12591
234 2830079003 2830075706 Bacteria 3855215
235 2842784075 2842780639 Bacteria 4337790
236 2928028650 2928027323 Bacteria 4382488
237 2946788199 2946787523 Bacteria 4366789
238 2984555548 2984555340 Bacteria 4247089
239 2984566339 2984564862 Bacteria 4339992
240 2993357354 2993356040 Bacteria 4247105
241 8005661471 8005658619 Bacteria 4500593
242 8055433769 8055431914 Bacteria 4551896
243 8057104487 8057101203 Bacteria 5034064
244 Ga0495606_0000054
245 JGI24752J21851_1000407
246 JGI24735J21928_10002566
247 JGI25150J39212_1001113
248 JGI25153J46596_10000253
249 Ga0055526_1015744
250 Ga0055537_1001769
251 Ga0055536_1021688
252 Ga0055540_1004406
253 Ga0055540_1005915
254 Ga0065165_1014413
255 Ga0070658_10111855
256 Ga0070683_100040441
257 Ga0070690_100060008
258 Ga0070677_10001128
259 Ga0070677_10013104
260 Ga0070677_10078103
261 Ga0070666_10009812
262 Ga0070680_100000081
263 Ga0070660_100001321
264 Ga0070660_100010425
265 Ga0070689_100095355
266 Ga0070661_100000009
267 Ga0070692_10009916
268 Ga0070668_100020418
269 Ga0070669_100091133
270 Ga0070675_100000199
271 Ga0070675_100022786
272 Ga0070675_100035240
273 Ga0070673_100008889
274 Ga0070673_100038837
275 Ga0070673_100078565
276 Ga0070659_100006371
277 Ga0070659_100020847
278 Ga0070667_100000322
279 Ga0070667_100001982
280 Ga0070667_100301024
281 Ga0070678_100020512
282 Ga0070678_100036463
283 Ga0070678_100343056
284 Ga0070662_100200592
285 Ga0068867_100017655
286 Ga0068867_100038718
287 Ga0070679_100000031
288 Ga0070672_100002690
289 Ga0070686_100320067
290 Ga0070693_100013417
291 Ga0070665_100120712
292 Ga0068855_100078786
293 Ga0068855_100267526
294 Ga0068857_100042620
295 Ga0068859_100016607
296 Ga0068859_100062313
297 Ga0068864_100000004
298 Ga0068864_100000354
299 Ga0068864_100009097
300 Ga0068864_100033182
301 Ga0068861_100245037
302 Ga0068863_100000002
303 Ga0068863_100252579
304 Ga0068858_100000262
305 Ga0068862_100000002
306 Ga0081540_1031766
307 Ga0070717_10068224
308 Ga0097621_100054328
309 Ga0097621_100074838
310 Ga0097621_100177880
311 Ga0097621_100319609
312 Ga0068871_100025788
313 Ga0068871_100216845
314 Ga0068865_100050628
315 Ga0097620_100016607
316 Ga0097620_100062316
317 Ga0105251_10002072
318 Ga0105248_10005317
319 Ga0105248_10026083
320 Ga0105248_10066801
321 Ga0105248_10068686
322 Ga0105238_10214190
323 Ga0105249_10000106
324 Ga0105239_10002081
325 Ga0157369_10075320
326 Ga0157374_10008718
327 Ga0157374_10130292
328 Ga0157378_10156414
329 Ga0163162_10003584
330 Ga0157375_10015677
331 Ga0157375_10655696
332 Ga0157379_10002033
333 Ga0157379_10176807
334 Ga0157376_10011894
335 Ga0157376_10021468
336 Ga0157376_10152766
337 Ga0163161_10176903
338 Ga0206354_11303983
339 Ga0206353_11106162
340 Ga0213873_10000049
341 Ga0213876_10000021
342 Ga0213876_10005801
343 Ga0213875_10002628
344 Ga0207425_1000094
345 Ga0209129_1001201
346 Ga0209233_1000052
347 Ga0209565_1000291
348 Ga0209673_1030992
349 Ga0209676_1008769
350 Ga0209025_1000630
351 Ga0209564_1001220
352 Ga0209564_1026147
353 Ga0209758_1000002
354 Ga0209758_1000108
355 Ga0209050_1000342
356 Ga0209050_1024443
357 Ga0207426_1028760
358 Ga0209051_1000226
359 Ga0209257_1001667
360 Ga0209257_1001937
361 Ga0207713_1005825
362 Ga0207682_10019613
363 Ga0207682_10047934
364 Ga0207710_10037255
365 Ga0207705_10000002
366 Ga0207705_10044168
367 Ga0207705_10119476
368 Ga0207707_10083280
369 Ga0207695_10006423
370 Ga0207660_10003047
371 Ga0207662_10088897
372 Ga0207657_10001669
373 Ga0207657_10009370
374 Ga0207657_10048773
375 Ga0207649_10000190
376 Ga0207652_10000003
377 Ga0207652_10068364
378 Ga0207681_10135166
379 Ga0207681_10136052
380 Ga0207650_10028720
381 Ga0207659_10001828
382 Ga0207659_10005032
383 Ga0207659_10039672
384 Ga0207700_10016803
385 Ga0207690_10004149
386 Ga0207690_10008855
387 Ga0207690_10014431
388 Ga0207706_10019733
389 Ga0207670_10011254
390 Ga0207704_10017080
391 Ga0207691_10007407
392 Ga0207691_10098267
393 Ga0207711_10000022
394 Ga0207711_10016636
395 Ga0207711_10022306
396 Ga0207711_10195340
397 Ga0207711_10257245
398 Ga0207661_10080684
399 Ga0207679_10102230
400 Ga0207679_10148174
401 Ga0207651_10024218
402 Ga0207712_10004350
403 Ga0207668_10024871
404 Ga0207668_10363032
405 Ga0207658_10000589
406 Ga0207658_10031032
407 Ga0207658_10166512
408 Ga0207703_10000277
409 Ga0207678_10001633
410 Ga0207641_10000002
411 Ga0207648_10016909
412 Ga0207648_10039138
413 Ga0207676_10000040
414 Ga0207676_10003399
415 Ga0207676_10006001
416 Ga0207674_10014458
417 Ga0207675_100053673
418 Ga0207683_10005419
419 Ga0207683_10028075
420 Ga0207683_10053921
421 Ga0207698_10095503
422 Ga0268265_10000003
423 Ga0265339_10001722
424 Ga0265316_10164575
425 Ga0307508_10002317
426 Ga0395899_0000274
427 Ga0395900_0001146
428 Ga0395898_0000788
429 Ga0395905_0001287
430 Ga0395905_0087958
431 Ga0395901_0000866
432 Ga0436365_0066479
433 Ga0436365_0591960
434 Ga0436365_0618060
435 Ga0436362_0126459
436 Ga0439464_0005797
437 Ga0451577_0096687
438 Ga0495638_0000484
439 Ga0495606_0006965
440 Ga0495606_0217233
441 Ga0495648_0128141
442 Ga0495654_0004068
443 Ga0495649_0000501
444 Ga0495674_0091564
445 Ga0495679_003321
446 Ga0496101_0271236
447 Ga0496109_0089425
448 Ga0496110_0058417
449 Ga0496114_0036202
450 Ga0496115_0019740
451 Ga0496117_0003086
452 Ga0496118_0002584
453 Ga0496121_0005116
454 Ga0496122_0001932
455 Ga0496123_0002702
456 Ga0496124_0000022
457 Ga0496126_0055236
458 Ga0501031_0027339
459 Ga0501032_0025487
460 Ga0501036_0088639
461 Ga0501038_0023889
462 Ga0501039_0064031
463 Ga0501043_0132625
464 Ga0501046_0262405
465 Ga0501047_0058809
466 Ga0501070_0036414
467 Ga0501071_0049912
468 Ga0501073_0018310
469 Ga0501080_0046188
470 Ga0501035_0030368
471 Ga0501044_0024389
472 Ga0500595_043291
473 Ga0500618_000341
474 Ga0500559_0000026
475 Ga0500559_0000460
476 Ga0500573_0001088
477 2830079003
478 2842784075
479 2928028650
480 2946788199
481 2984555548
482 2984566339
483 2993357354
484 8005661471
485 8055433769
486 8057104487

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

40

339

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9494 4 319
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9433 3 319
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9307 1 319
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9304 3 319
6ovq-assembly2.cif.gz_B crystal structure of mithramycin 3-side chain keto-reductase mtmw 0.9249 3 314
ID Description Score Start End Superfamily
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9142 3 317 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9132 3 319 3.20.20.100
af_P77735_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9113 3 319 3.20.20.100
af_C4J2K0_1_323_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9049 3 319 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.904 3 314 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2M8P5I0-F1-model_v4 Aldo/keto reductase 0.9847 111 211 GO:0005829
GO:0016491
AF-B9B0Z6-F1-model_v4 deleted 0.9831 3 315
AF-A0A531LSG7-F1-model_v4 Aldo/keto reductase 0.9807 107 226 GO:0005829
GO:0016491
AF-A0A3N7H1F2-F1-model_v4 Aldo/keto reductase 0.9798 151 316 GO:0005829
AF-A0A2Z6TUM4-F1-model_v4 deleted 0.9781 2 315

Map