F356086

General Info

Members Datasets Scaffolds Average Seq Length
243 174 237 264

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928115317|2928115639
Length 266
Sequence LGVRYNGRAYDGWQSQPSGRTVQDQLERALERFAQQRIGTLCAGRTDAGVHGWMQVVHFDTDVERVPFSWVRGPNRFLPEDIAVQWAQPVPDRFHCRAAALGRRYRYVLSQSPVRPSLEAGKVGWSMHALDGEAMRAAAAHLLGEHDFSSFRASACQAKSPVKTVRRIAIARVGAAERCHWHFDFEADAFLHHMIRNIMGCLVRVGQGHATPDWLREVRDARSRQAAAPTFAADGLYFLGPMYDAAWGLPPEVTMGVEPGACEDLP

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
4 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
5 2831864461 Roseateles noduli HZ7 Isolate Nodule
6 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
62 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
97 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
98 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
107 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
108 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
129 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
148 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
157 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
158 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
165 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
166 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
169 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
170 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
172 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
173 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 36.63
Nodule 1.23
Rhizoplane 0.82
Rhizosphere 53.5
Stem 0
Stem Tuber 0
Unclassified 7.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1007716 3300002773 Bacteria 2755
2 JGI25151J46595_10041955 3300003187 Bacteria 1655
3 JGI25153J46596_10005931 3300003215 Bacteria 6301
4 rootL2_10006461 3300003322 Bacteria 12808
5 rootL2_10284581 3300003322 Bacteria 1480
6 rootH1_10125905 3300003323 Bacteria 1946
7 JGI25160J50197_1000474 3300003354 Bacteria 24439
8 JGI25161J50226_1000042 3300003374 Bacteria 123841
9 Ga0055525_1000021 3300003759 Bacteria 370802
10 Ga0055524_1004293 3300003775 Bacteria 6609
11 Ga0055534_1010108 3300003784 Bacteria 2000
12 Ga0055530_10041005 3300003791 Bacteria 1133
13 Ga0055540_1035234 3300003792 Bacteria 1120
14 Ga0055531_10005778 3300003794 Bacteria 7163
15 Ga0055531_10010044 3300003794 Bacteria 4757
16 Ga0055543_1001010 3300004625 Bacteria 12544
17 Ga0070677_10044193 3300005333 Bacteria 1772
18 Ga0070660_100075701 3300005339 Bacteria 2635
19 Ga0070661_100001326 3300005344 Bacteria 17338
20 Ga0070675_100349910 3300005354 Bacteria 1310
21 Ga0070674_100080320 3300005356 Bacteria 2328
22 Ga0070659_100000336 3300005366 Bacteria 36297
23 Ga0070659_100580781 3300005366 Bacteria 962
24 Ga0070663_100474186 3300005455 Bacteria 1035
25 Ga0070678_100176591 3300005456 Bacteria 1745
26 Ga0070662_100047003 3300005457 Bacteria 3103
27 Ga0070662_100048041 3300005457 Bacteria 3073
28 Ga0070706_100001359 3300005467 Bacteria 26010
29 Ga0070707_100097547 3300005468 Bacteria 2847
30 Ga0070699_100147527 3300005518 Bacteria 2079
31 Ga0068853_100479698 3300005539 Bacteria 1172
32 Ga0068855_100104888 3300005563 Bacteria 3251
33 Ga0070664_100017678 3300005564 Bacteria 5855
34 Ga0070664_100268993 3300005564 Bacteria 1535
35 Ga0068861_100429722 3300005719 Bacteria 1179
36 Ga0075365_10024481 3300006038 Bacteria 3809
37 Ga0075368_10001139 3300006042 Bacteria 8381
38 Ga0075368_10011906 3300006042 Bacteria 3173
39 Ga0075363_100000866 3300006048 Bacteria 10603
40 Ga0075364_10021082 3300006051 Bacteria 4105
41 Ga0075364_10167287 3300006051 Bacteria 1486
42 Ga0075362_10008657 3300006177 Bacteria 3906
43 Ga0075367_10013893 3300006178 Bacteria 4344
44 Ga0075367_10039167 3300006178 Bacteria 2763
45 Ga0075369_10058088 3300006186 Bacteria 1684
46 Ga0075366_10001021 3300006195 Bacteria 13727
47 Ga0075366_10028099 3300006195 Bacteria 3300
48 Ga0075366_10046037 3300006195 Bacteria 2585
49 Ga0075366_10190367 3300006195 Bacteria 1247
50 Ga0075366_10272140 3300006195 Bacteria 1034
51 Ga0075366_10364918 3300006195 Bacteria 887
52 Ga0075370_10000436 3300006353 Bacteria 15538
53 Ga0075370_10007774 3300006353 Bacteria 5477
54 Ga0075370_10011217 3300006353 Bacteria 4703
55 Ga0075370_10044698 3300006353 Bacteria 2504
56 Ga0075429_100286239 3300006880 Bacteria 1443
57 Ga0099823_1000985 3300006944 Bacteria 21888
58 Ga0105240_10003889 3300009093 Bacteria 23062
59 Ga0105245_10048582 3300009098 Bacteria 3796
60 Ga0105241_10172965 3300009174 Bacteria 1785
61 Ga0105237_10010664 3300009545 Bacteria 9760
62 Ga0105238_10101925 3300009551 Bacteria 2853
63 Ga0105239_10000366 3300010375 Bacteria 66301
64 Ga0157319_1000006 3300012497 Bacteria 361506
65 Ga0157374_10017423 3300013296 Bacteria 6324
66 Ga0157378_10268186 3300013297 Bacteria 1641
67 Ga0182007_10095198 3300015262 Bacteria 983
68 Ga0213872_10000090 3300021361 Bacteria 83813
69 Ga0213872_10000198 3300021361 Bacteria 53480
70 Ga0209436_116778 3300025208 Bacteria 1089
71 Ga0209563_100005 3300025230 Bacteria 1774893
72 Ga0207425_1001224 3300025245 Bacteria 11279
73 Ga0207425_1006043 3300025245 Bacteria 3365
74 Ga0209129_1000041 3300025258 Bacteria 307590
75 Ga0209565_1007859 3300025263 Bacteria 2832
76 Ga0209673_1003449 3300025273 Bacteria 9317
77 Ga0209673_1021882 3300025273 Bacteria 2223
78 Ga0209130_1000216 3300025284 Bacteria 75536
79 Ga0209130_1000578 3300025284 Bacteria 35635
80 Ga0209675_1010987 3300025291 Bacteria 3042
81 Ga0209025_1067104 3300025294 Bacteria 1298
82 Ga0209564_1000003 3300025295 Bacteria 1585848
83 Ga0209564_1000029 3300025295 Bacteria 505995
84 Ga0209758_1000043 3300025297 Bacteria 402310
85 Ga0209758_1008683 3300025297 Bacteria 6512
86 Ga0209050_1030364 3300025298 Bacteria 1707
87 Ga0209256_1002401 3300025299 Bacteria 15389
88 Ga0209256_1006842 3300025299 Bacteria 5867
89 Ga0209256_1016838 3300025299 Bacteria 2464
90 Ga0207426_1000817 3300025302 Bacteria 33418
91 Ga0209051_1003352 3300025303 Bacteria 10557
92 Ga0209257_1001931 3300025304 Bacteria 22372
93 Ga0209257_1008671 3300025304 Bacteria 5690
94 Ga0207684_10287024 3300025910 Bacteria 1419
95 Ga0207654_10047167 3300025911 Bacteria 2460
96 Ga0207695_10004334 3300025913 Bacteria 19434
97 Ga0207671_10007955 3300025914 Bacteria 9084
98 Ga0207657_10136563 3300025919 Bacteria 2006
99 Ga0207649_10011600 3300025920 Bacteria 4864
100 Ga0207646_10084736 3300025922 Bacteria 2836
101 Ga0207694_10005611 3300025924 Bacteria 9616
102 Ga0207659_10180059 3300025926 Bacteria 1674
103 Ga0207687_10320809 3300025927 Bacteria 1254
104 Ga0207690_10013283 3300025932 Bacteria 4946
105 Ga0207706_10009658 3300025933 Bacteria 8855
106 Ga0207669_10180880 3300025937 Bacteria 1511
107 Ga0207679_10000526 3300025945 Bacteria 25924
108 Ga0207658_10131396 3300025986 Bacteria 2012
109 Ga0207639_10092872 3300026041 Bacteria 2419
110 Ga0207639_10409898 3300026041 Bacteria 1223
111 Ga0209389_1010870 3300027296 Bacteria 8227
112 Ga0209813_10008102 3300027866 Bacteria 2644
113 Ga0209813_10071520 3300027866 Bacteria 1129
114 Ga0307515_10002116 3300028794 Bacteria 43530
115 Ga0307515_10002409 3300028794 Bacteria 40792
116 Ga0307515_10007308 3300028794 Bacteria 21863
117 Ga0307515_10100924 3300028794 Bacteria 3489
118 Ga0265332_10000009 3300031238 Bacteria 295760
119 Ga0307513_10000557 3300031456 Bacteria 53384
120 Ga0307513_10009083 3300031456 Bacteria 12601
121 Ga0307513_10158221 3300031456 Bacteria 2162
122 Ga0307508_10023375 3300031616 Bacteria 5612
123 Ga0307516_10002516 3300031730 Bacteria 24408
124 Ga0307516_10114380 3300031730 Bacteria 2496
125 Ga0307405_10288090 3300031731 Bacteria 1240
126 Ga0373947_0239985 3300035725 Bacteria 1196
127 Ga0395899_0001726 3300037312 Bacteria 18165
128 Ga0395900_0000054 3300037418 Bacteria 220487
129 Ga0395900_0010181 3300037418 Bacteria 9618
130 Ga0395900_0205487 3300037418 Bacteria 1991
131 Ga0395898_0004344 3300037466 Bacteria 15524
132 Ga0395898_0007404 3300037466 Bacteria 11651
133 Ga0395905_0001304 3300037471 Bacteria 30620
134 Ga0395905_0011742 3300037471 Bacteria 8455
135 Ga0395905_0029070 3300037471 Bacteria 5208
136 Ga0395905_0044723 3300037471 Bacteria 4154
137 Ga0395905_0048444 3300037471 Bacteria 3982
138 Ga0395905_0162638 3300037471 Bacteria 2097
139 Ga0395901_0048349 3300038443 Bacteria 4417
140 Ga0395901_0490710 3300038443 Bacteria 1251
141 Ga0436361_0108966 3300039447 Bacteria 2559
142 Ga0436361_0692684 3300039447 Bacteria 133303
143 Ga0436361_1043638 3300039447 Bacteria 25534
144 Ga0451793_0214308 3300041452 Bacteria 1956
145 Ga0439458_0025973 3300042157 Bacteria 1376
146 Ga0439459_0002812 3300042438 Bacteria 2715
147 Ga0451577_0000641 3300042876 Bacteria 55722
148 Ga0451577_0001534 3300042876 Bacteria 30298
149 Ga0451577_0027444 3300042876 Bacteria 5154
150 Ga0466969_0017188 3300044656 Bacteria 3780
151 Ga0466969_0165400 3300044656 Bacteria 1015
152 Ga0466972_0002680 3300044658 Bacteria 8814
153 Ga0466972_0002850 3300044658 Bacteria 8559
154 Ga0453683_0004136 3300044673 Bacteria 10417
155 Ga0466965_0034819 3300044683 Bacteria 2465
156 Ga0466965_0137309 3300044683 Bacteria 1271
157 Ga0466966_0077161 3300044684 Bacteria 2079
158 Ga0466966_0157676 3300044684 Bacteria 1382
159 Ga0466966_0235532 3300044684 Bacteria 1104
160 Ga0466961_0116181 3300044693 Bacteria 1681
161 Ga0466964_0006733 3300044706 Bacteria 4284
162 Ga0466964_0056726 3300044706 Bacteria 1620
163 Ga0453684_0001818 3300044712 Bacteria 56168
164 Ga0453684_0047579 3300044712 Bacteria 5685
165 Ga0453684_0095819 3300044712 Bacteria 3646
166 Ga0466971_0109053 3300044719 Bacteria 1276
167 Ga0466968_0010618 3300044735 Bacteria 3575
168 Ga0466970_0038241 3300044765 Bacteria 2544
169 Ga0466957_0012207 3300044842 Bacteria 4971
170 Ga0466957_0074354 3300044842 Bacteria 2107
171 Ga0466959_0000635 3300045049 Bacteria 20406
172 Ga0466959_0018024 3300045049 Bacteria 5180
173 Ga0451576_0040382 3300045051 Bacteria 4939
174 Ga0451576_0305392 3300045051 Bacteria 1665
175 Ga0451576_0369425 3300045051 Bacteria 1503
176 Ga0466967_0023368 3300045976 Bacteria 5064
177 Ga0495590_0008248 3300046457 Bacteria 3982
178 Ga0495590_0015326 3300046457 Bacteria 2784
179 Ga0495650_0005214 3300046471 Bacteria 8534
180 Ga0495610_0048561 3300046512 Bacteria 2083
181 Ga0495620_0010812 3300046515 Bacteria 4799
182 Ga0495632_0014268 3300046519 Bacteria 4499
183 Ga0495611_0102350 3300046648 Bacteria 1331
184 Ga0495625_0143136 3300046660 Bacteria 1612
185 Ga0495649_0002061 3300046694 Bacteria 14469
186 Ga0495660_0051768 3300046810 Bacteria 2233
187 Ga0495686_0081747 3300047472 Bacteria 1972
188 Ga0496102_0065962 3300048905 Bacteria 3318
189 Ga0496121_0044818 3300048924 Bacteria 3809
190 Ga0496123_0204663 3300048926 Bacteria 1008
191 Ga0496124_0018411 3300048927 Bacteria 6540
192 Ga0496125_0008691 3300048928 Bacteria 10576
193 Ga0496126_0048972 3300048929 Bacteria 3859
194 Ga0501034_0077012 3300049571 Bacteria 3341
195 Ga0501036_0253040 3300049572 Bacteria 1476
196 Ga0501037_0176346 3300049573 Bacteria 1518
197 Ga0501038_0122968 3300049574 Bacteria 2138
198 Ga0501047_0108563 3300049581 Bacteria 2657
199 Ga0501073_0243036 3300049589 Bacteria 1243
200 Ga0501198_000004 3300049649 Bacteria 175146
201 Ga0501222_000038 3300049662 Bacteria 51424
202 Ga0501080_0290185 3300049742 Bacteria 1485
203 Ga0501035_0192275 3300049822 Bacteria 1754
204 Ga0501044_0535482 3300049823 Bacteria 1070
205 nmdc:mga03683_1375_c1 3300050489 Bacteria 7227
206 nmdc:mga03n38_10498_c1 3300050490 Bacteria 3411
207 nmdc:mga00v17_140531_c1 3300050491 Bacteria 1548
208 nmdc:mga00v17_24778_c1 3300050491 Bacteria 3482
209 nmdc:mga00v17_70495_c1 3300050491 Bacteria 2165
210 nmdc:mga0yw44_13996_c1 3300050492 Bacteria 4243
211 nmdc:mga0k408_338733_c1 3300050493 Bacteria 897
212 nmdc:mga0k408_348174_c1 3300050493 Bacteria 883
213 nmdc:mga0k408_55098_c1 3300050493 Bacteria 2305
214 nmdc:mga0k408_57024_c1 3300050493 Bacteria 2267
215 nmdc:mga0k408_63959_c1 3300050493 Bacteria 2141
216 nmdc:mga06z11_3754_c1 3300050494 Bacteria 5906
217 nmdc:mga04h51_117963_c1 3300050495 Bacteria 986
218 nmdc:mga07m45_134324_c1 3300050496 Bacteria 1432
219 nmdc:mga07m45_244221_c1 3300050496 Bacteria 1045
220 nmdc:mga07m45_410_c1 3300050496 Bacteria 17752
221 nmdc:mga07m45_75994_c1 3300050496 Bacteria 1915
222 nmdc:mga0sz30_28770_c1 3300050516 Bacteria 2288
223 Ga0500644_0027124 3300053088 Bacteria 1779
224 Ga0500651_0012618 3300053093 Bacteria 5124
225 Ga0500650_0017430 3300053098 Bacteria 3100
226 Ga0500569_005309 3300053109 Bacteria 2763
227 Ga0500593_012364 3300053117 Bacteria 3617
228 Ga0500628_002165 3300053129 Bacteria 3275
229 Ga0500652_008946 3300053131 Bacteria 3364
230 Ga0500658_0010715 3300053134 Bacteria 3382
231 Ga0500568_0068638 3300053139 Bacteria 1360
232 Ga0500604_0010931 3300053151 Bacteria 2433
233 Ga0500622_0005574 3300053156 Bacteria 7513
234 Ga0500587_001782 3300053739 Bacteria 3059
235 Ga0590071_000225 3300059421 Bacteria 16513
236 Ga0466962_0034371 3300061719 Bacteria 2426
237 Ga0466962_0149306 3300061719 Bacteria 1134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0235532 Ga0466966_0235532_24_743 235
2 3300045051 Ga0451576_0305392 Ga0451576_0305392_595_1311 238
3 3300039447 Ga0436361_0108966 Ga0436361_0108966_1795_2514 239
4 3300044658 Ga0466972_0002850 Ga0466972_0002850_6130_6894 254
5 3300045051 Ga0451576_0369425 Ga0451576_0369425_193_990 255
6 iso_pu_bacteria 2831864461 2831869959 256
7 iso_pu_bacteria 2928115317 2928115639 256
8 3300009174 Ga0105241_10172965 Ga0105241_101729652 258
9 3300042157 Ga0439458_0025973 Ga0439458_0025973_200_979 259
10 3300042876 Ga0451577_0000641 Ga0451577_0000641_45230_46018 259
11 3300044712 Ga0453684_0001818 Ga0453684_0001818_10151_10939 259
12 3300003187 JGI25151J46595_10041955 JGI25151J46595_100419552 260
13 3300003322 rootL2_10006461 rootL2_100064619 260
14 3300003323 rootH1_10125905 rootH1_101259052 260
15 3300003354 JGI25160J50197_1000474 JGI25160J50197_100047416 260
16 3300003374 JGI25161J50226_1000042 JGI25161J50226_100004255 260
17 3300003759 Ga0055525_1000021 Ga0055525_1000021170 260
18 3300003775 Ga0055524_1004293 Ga0055524_10042934 260
19 3300003784 Ga0055534_1010108 Ga0055534_10101082 260
20 3300003791 Ga0055530_10041005 Ga0055530_100410051 260
21 3300003792 Ga0055540_1035234 Ga0055540_10352342 260
22 3300003794 Ga0055531_10005778 Ga0055531_100057784 260
23 3300003794 Ga0055531_10010044 Ga0055531_100100441 260
24 3300004625 Ga0055543_1001010 Ga0055543_100101013 260
25 3300005333 Ga0070677_10044193 Ga0070677_100441932 260
26 3300005354 Ga0070675_100349910 Ga0070675_1003499102 260
27 3300005356 Ga0070674_100080320 Ga0070674_1000803203 260
28 3300005366 Ga0070659_100580781 Ga0070659_1005807811 260
29 3300005455 Ga0070663_100474186 Ga0070663_1004741861 260
30 3300005539 Ga0068853_100479698 Ga0068853_1004796982 260
31 3300005563 Ga0068855_100104888 Ga0068855_1001048882 260
32 3300005719 Ga0068861_100429722 Ga0068861_1004297222 260
33 3300006038 Ga0075365_10024481 Ga0075365_100244812 260
34 3300006042 Ga0075368_10001139 Ga0075368_100011392 260
35 3300006048 Ga0075363_100000866 Ga0075363_1000008664 260
36 3300006051 Ga0075364_10167287 Ga0075364_101672872 260
37 3300006177 Ga0075362_10008657 Ga0075362_100086573 260
38 3300006178 Ga0075367_10013893 Ga0075367_100138932 260
39 3300006186 Ga0075369_10058088 Ga0075369_100580882 260
40 3300006195 Ga0075366_10001021 Ga0075366_100010216 260
41 3300006195 Ga0075366_10028099 Ga0075366_100280992 260
42 3300006195 Ga0075366_10046037 Ga0075366_100460372 260
43 3300006195 Ga0075366_10272140 Ga0075366_102721401 260
44 3300006353 Ga0075370_10000436 Ga0075370_100004364 260
45 3300006353 Ga0075370_10044698 Ga0075370_100446983 260
46 3300006880 Ga0075429_100286239 Ga0075429_1002862392 260
47 3300006944 Ga0099823_1000985 Ga0099823_100098513 260
48 3300009093 Ga0105240_10003889 Ga0105240_1000388919 260
49 3300009098 Ga0105245_10048582 Ga0105245_100485822 260
50 3300009545 Ga0105237_10010664 Ga0105237_100106646 260
51 3300009551 Ga0105238_10101925 Ga0105238_101019252 260
52 3300010375 Ga0105239_10000366 Ga0105239_1000036657 260
53 3300012497 Ga0157319_1000006 Ga0157319_100000695 260
54 3300013296 Ga0157374_10017423 Ga0157374_100174236 260
55 3300013297 Ga0157378_10268186 Ga0157378_102681861 260
56 3300015262 Ga0182007_10095198 Ga0182007_100951981 260
57 3300021361 Ga0213872_10000090 Ga0213872_1000009065 260
58 3300025208 Ga0209436_116778 Ga0209436_1167782 260
59 3300025230 Ga0209563_100005 Ga0209563_100005157 260
60 3300025245 Ga0207425_1006043 Ga0207425_10060432 260
61 3300025263 Ga0209565_1007859 Ga0209565_10078592 260
62 3300025284 Ga0209130_1000216 Ga0209130_100021621 260
63 3300025284 Ga0209130_1000578 Ga0209130_100057817 260
64 3300025291 Ga0209675_1010987 Ga0209675_10109872 260
65 3300025294 Ga0209025_1067104 Ga0209025_10671041 260
66 3300025295 Ga0209564_1000003 Ga0209564_10000031349 260
67 3300025297 Ga0209758_1008683 Ga0209758_10086833 260
68 3300025298 Ga0209050_1030364 Ga0209050_10303642 260
69 3300025299 Ga0209256_1002401 Ga0209256_10024016 260
70 3300025299 Ga0209256_1006842 Ga0209256_10068422 260
71 3300025302 Ga0207426_1000817 Ga0207426_100081724 260
72 3300025303 Ga0209051_1003352 Ga0209051_10033529 260
73 3300025304 Ga0209257_1001931 Ga0209257_10019315 260
74 3300025304 Ga0209257_1008671 Ga0209257_10086712 260
75 3300025911 Ga0207654_10047167 Ga0207654_100471673 260
76 3300025913 Ga0207695_10004334 Ga0207695_100043346 260
77 3300025914 Ga0207671_10007955 Ga0207671_100079555 260
78 3300025924 Ga0207694_10005611 Ga0207694_100056113 260
79 3300025926 Ga0207659_10180059 Ga0207659_101800592 260
80 3300025927 Ga0207687_10320809 Ga0207687_103208091 260
81 3300025937 Ga0207669_10180880 Ga0207669_101808802 260
82 3300026041 Ga0207639_10092872 Ga0207639_100928722 260
83 3300026041 Ga0207639_10409898 Ga0207639_104098982 260
84 3300027296 Ga0209389_1010870 Ga0209389_10108705 260
85 3300027866 Ga0209813_10008102 Ga0209813_100081022 260
86 3300028794 Ga0307515_10007308 Ga0307515_100073082 260
87 3300031238 Ga0265332_10000009 Ga0265332_1000000971 260
88 3300031456 Ga0307513_10000557 Ga0307513_1000055718 260
89 3300031456 Ga0307513_10158221 Ga0307513_101582212 260
90 3300031616 Ga0307508_10023375 Ga0307508_100233753 260
91 3300031730 Ga0307516_10114380 Ga0307516_101143802 260
92 3300031731 Ga0307405_10288090 Ga0307405_102880902 260
93 3300035725 Ga0373947_0239985 Ga0373947_0239985_246_1031 260
94 3300037312 Ga0395899_0001726 Ga0395899_0001726_12434_13216 260
95 3300037418 Ga0395900_0000054 Ga0395900_0000054_106910_107710 260
96 3300037418 Ga0395900_0010181 Ga0395900_0010181_7437_8219 260
97 3300037418 Ga0395900_0205487 Ga0395900_0205487_719_1501 260
98 3300037466 Ga0395898_0004344 Ga0395898_0004344_5546_6346 260
99 3300037466 Ga0395898_0007404 Ga0395898_0007404_6341_7123 260
100 3300037471 Ga0395905_0011742 Ga0395905_0011742_5089_5871 260
101 3300037471 Ga0395905_0044723 Ga0395905_0044723_2717_3499 260
102 3300037471 Ga0395905_0048444 Ga0395905_0048444_3047_3829 260
103 3300037471 Ga0395905_0162638 Ga0395905_0162638_152_934 260
104 3300038443 Ga0395901_0048349 Ga0395901_0048349_3037_3819 260
105 3300038443 Ga0395901_0490710 Ga0395901_0490710_368_1150 260
106 3300039447 Ga0436361_1043638 Ga0436361_1043638_4210_4998 260
107 3300042438 Ga0439459_0002812 Ga0439459_0002812_1783_2565 260
108 3300042876 Ga0451577_0027444 Ga0451577_0027444_1355_2158 260
109 3300044656 Ga0466969_0165400 Ga0466969_0165400_70_852 260
110 3300044684 Ga0466966_0157676 Ga0466966_0157676_237_1043 260
111 3300044693 Ga0466961_0116181 Ga0466961_0116181_674_1480 260
112 3300044706 Ga0466964_0056726 Ga0466964_0056726_232_1038 260
113 3300044712 Ga0453684_0047579 Ga0453684_0047579_3620_4402 260
114 3300044719 Ga0466971_0109053 Ga0466971_0109053_392_1198 260
115 3300044842 Ga0466957_0074354 Ga0466957_0074354_357_1163 260
116 3300046457 Ga0495590_0015326 Ga0495590_0015326_66_848 260
117 3300046519 Ga0495632_0014268 Ga0495632_0014268_2311_3093 260
118 3300046648 Ga0495611_0102350 Ga0495611_0102350_150_932 260
119 3300046694 Ga0495649_0002061 Ga0495649_0002061_717_1499 260
120 3300046810 Ga0495660_0051768 Ga0495660_0051768_546_1328 260
121 3300048926 Ga0496123_0204663 Ga0496123_0204663_84_899 260
122 3300048929 Ga0496126_0048972 Ga0496126_0048972_2686_3468 260
123 3300049571 Ga0501034_0077012 Ga0501034_0077012_1653_2444 260
124 3300049572 Ga0501036_0253040 Ga0501036_0253040_563_1354 260
125 3300049573 Ga0501037_0176346 Ga0501037_0176346_431_1222 260
126 3300049574 Ga0501038_0122968 Ga0501038_0122968_682_1473 260
127 3300049581 Ga0501047_0108563 Ga0501047_0108563_1439_2230 260
128 3300049589 Ga0501073_0243036 Ga0501073_0243036_104_895 260
129 3300049742 Ga0501080_0290185 Ga0501080_0290185_116_907 260
130 3300049822 Ga0501035_0192275 Ga0501035_0192275_183_974 260
131 3300049823 Ga0501044_0535482 Ga0501044_0535482_36_827 260
132 3300050489 nmdc:mga03683_1375_c1 nmdc:mga03683_1375_c1_3322_4104 260
133 3300050490 nmdc:mga03n38_10498_c1 nmdc:mga03n38_10498_c1_970_1752 260
134 3300050491 nmdc:mga00v17_140531_c1 nmdc:mga00v17_140531_c1_515_1297 260
135 3300050491 nmdc:mga00v17_24778_c1 nmdc:mga00v17_24778_c1_569_1363 260
136 3300050492 nmdc:mga0yw44_13996_c1 nmdc:mga0yw44_13996_c1_1317_2099 260
137 3300050493 nmdc:mga0k408_348174_c1 nmdc:mga0k408_348174_c1_67_849 260
138 3300050493 nmdc:mga0k408_55098_c1 nmdc:mga0k408_55098_c1_1270_2052 260
139 3300050493 nmdc:mga0k408_57024_c1 nmdc:mga0k408_57024_c1_1260_2042 260
140 3300050493 nmdc:mga0k408_63959_c1 nmdc:mga0k408_63959_c1_847_1629 260
141 3300050494 nmdc:mga06z11_3754_c1 nmdc:mga06z11_3754_c1_3565_4347 260
142 3300050496 nmdc:mga07m45_410_c1 nmdc:mga07m45_410_c1_5989_6771 260
143 3300050496 nmdc:mga07m45_75994_c1 nmdc:mga07m45_75994_c1_608_1390 260
144 3300050516 nmdc:mga0sz30_28770_c1 nmdc:mga0sz30_28770_c1_847_1629 260
145 3300053139 Ga0500568_0068638 Ga0500568_0068638_430_1212 260
146 3300061719 Ga0466962_0149306 Ga0466962_0149306_20_802 260
147 iso_pu_bacteria 2734482258 2735818331 260
148 3300005339 Ga0070660_100075701 Ga0070660_1000757013 261
149 3300005344 Ga0070661_100001326 Ga0070661_10000132610 261
150 3300005366 Ga0070659_100000336 Ga0070659_10000033629 261
151 3300005456 Ga0070678_100176591 Ga0070678_1001765913 261
152 3300005457 Ga0070662_100048041 Ga0070662_1000480412 261
153 3300005467 Ga0070706_100001359 Ga0070706_10000135913 261
154 3300005468 Ga0070707_100097547 Ga0070707_1000975473 261
155 3300005518 Ga0070699_100147527 Ga0070699_1001475272 261
156 3300005564 Ga0070664_100017678 Ga0070664_1000176786 261
157 3300005564 Ga0070664_100268993 Ga0070664_1002689932 261
158 3300006042 Ga0075368_10011906 Ga0075368_100119061 261
159 3300021361 Ga0213872_10000198 Ga0213872_100001989 261
160 3300025910 Ga0207684_10287024 Ga0207684_102870242 261
161 3300025919 Ga0207657_10136563 Ga0207657_101365632 261
162 3300025920 Ga0207649_10011600 Ga0207649_100116006 261
163 3300025922 Ga0207646_10084736 Ga0207646_100847362 261
164 3300025932 Ga0207690_10013283 Ga0207690_100132832 261
165 3300025945 Ga0207679_10000526 Ga0207679_1000052621 261
166 3300027866 Ga0209813_10071520 Ga0209813_100715202 261
167 3300042876 Ga0451577_0001534 Ga0451577_0001534_18243_19028 261
168 3300044656 Ga0466969_0017188 Ga0466969_0017188_2001_2801 261
169 3300044673 Ga0453683_0004136 Ga0453683_0004136_2839_3624 261
170 3300044683 Ga0466965_0034819 Ga0466965_0034819_916_1716 261
171 3300044684 Ga0466966_0077161 Ga0466966_0077161_308_1096 261
172 3300044712 Ga0453684_0095819 Ga0453684_0095819_1264_2049 261
173 3300045049 Ga0466959_0018024 Ga0466959_0018024_2423_3211 261
174 3300045051 Ga0451576_0040382 Ga0451576_0040382_1227_2012 261
175 3300048905 Ga0496102_0065962 Ga0496102_0065962_1370_2155 261
176 3300050495 nmdc:mga04h51_117963_c1 nmdc:mga04h51_117963_c1_62_859 261
177 3300053117 Ga0500593_012364 Ga0500593_012364_1427_2212 261
178 3300005457 Ga0070662_100047003 Ga0070662_1000470032 262
179 3300025933 Ga0207706_10009658 Ga0207706_100096585 262
180 3300028794 Ga0307515_10002409 Ga0307515_1000240911 262
181 3300037471 Ga0395905_0001304 Ga0395905_0001304_4435_5268 262
182 3300044658 Ga0466972_0002680 Ga0466972_0002680_1359_2177 262
183 3300044683 Ga0466965_0137309 Ga0466965_0137309_389_1207 262
184 3300044735 Ga0466968_0010618 Ga0466968_0010618_1489_2277 262
185 3300046515 Ga0495620_0010812 Ga0495620_0010812_2750_3538 262
186 3300047472 Ga0495686_0081747 Ga0495686_0081747_690_1478 262
187 3300049649 Ga0501198_000004 Ga0501198_000004_60276_61064 262
188 3300049662 Ga0501222_000038 Ga0501222_000038_13934_14722 262
189 3300050496 nmdc:mga07m45_244221_c1 nmdc:mga07m45_244221_c1_165_953 262
190 3300053134 Ga0500658_0010715 Ga0500658_0010715_1500_2288 262
191 3300053739 Ga0500587_001782 Ga0500587_001782_921_1709 262
192 3300059421 Ga0590071_000225 Ga0590071_000225_5656_6444 262
193 3300003322 rootL2_10284581 rootL2_102845811 263
194 3300006195 Ga0075366_10190367 Ga0075366_101903672 263
195 3300006195 Ga0075366_10364918 Ga0075366_103649181 263
196 3300006353 Ga0075370_10007774 Ga0075370_100077742 263
197 3300025986 Ga0207658_10131396 Ga0207658_101313962 263
198 3300028794 Ga0307515_10002116 Ga0307515_1000211618 263
199 3300028794 Ga0307515_10100924 Ga0307515_101009244 263
200 3300031456 Ga0307513_10009083 Ga0307513_100090835 263
201 3300031730 Ga0307516_10002516 Ga0307516_100025162 263
202 3300037471 Ga0395905_0029070 Ga0395905_0029070_2095_2901 263
203 3300044706 Ga0466964_0006733 Ga0466964_0006733_3343_4203 263
204 3300044765 Ga0466970_0038241 Ga0466970_0038241_418_1278 263
205 3300044842 Ga0466957_0012207 Ga0466957_0012207_2082_2942 263
206 3300045049 Ga0466959_0000635 Ga0466959_0000635_11352_12212 263
207 3300045976 Ga0466967_0023368 Ga0466967_0023368_4102_4962 263
208 3300046457 Ga0495590_0008248 Ga0495590_0008248_1741_2577 263
209 3300046471 Ga0495650_0005214 Ga0495650_0005214_5818_6621 263
210 3300046660 Ga0495625_0143136 Ga0495625_0143136_607_1428 263
211 3300048924 Ga0496121_0044818 Ga0496121_0044818_1722_2543 263
212 3300048927 Ga0496124_0018411 Ga0496124_0018411_4329_5159 263
213 3300048928 Ga0496125_0008691 Ga0496125_0008691_3108_3938 263
214 3300050493 nmdc:mga0k408_338733_c1 nmdc:mga0k408_338733_c1_36_827 263
215 3300050496 nmdc:mga07m45_134324_c1 nmdc:mga07m45_134324_c1_255_1061 263
216 3300061719 Ga0466962_0034371 Ga0466962_0034371_162_1022 263
217 3300039447 Ga0436361_0692684 Ga0436361_0692684_69912_70739 264
218 iso_pu_bacteria 2585428057 2587726332 264
219 iso_pu_bacteria 2585428058 2587731762 264
220 iso_pu_bacteria 2588253510 2588292268 264
221 3300002773 JGI25152J39213_1007716 JGI25152J39213_10077162 268
222 3300003215 JGI25153J46596_10005931 JGI25153J46596_100059312 268
223 3300006051 Ga0075364_10021082 Ga0075364_100210822 268
224 3300006178 Ga0075367_10039167 Ga0075367_100391673 268
225 3300006353 Ga0075370_10011217 Ga0075370_100112172 268
226 3300025245 Ga0207425_1001224 Ga0207425_10012248 268
227 3300025258 Ga0209129_1000041 Ga0209129_100004122 268
228 3300025273 Ga0209673_1003449 Ga0209673_10034496 268
229 3300025273 Ga0209673_1021882 Ga0209673_10218823 268
230 3300025295 Ga0209564_1000029 Ga0209564_1000029168 268
231 3300025297 Ga0209758_1000043 Ga0209758_1000043272 268
232 3300025299 Ga0209256_1016838 Ga0209256_10168382 268
233 3300041452 Ga0451793_0214308 Ga0451793_0214308_893_1705 268
234 3300046512 Ga0495610_0048561 Ga0495610_0048561_947_1762 268
235 3300050491 nmdc:mga00v17_70495_c1 nmdc:mga00v17_70495_c1_581_1393 268
236 3300053088 Ga0500644_0027124 Ga0500644_0027124_431_1243 268
237 3300053093 Ga0500651_0012618 Ga0500651_0012618_4031_4843 268
238 3300053098 Ga0500650_0017430 Ga0500650_0017430_1250_2062 268
239 3300053109 Ga0500569_005309 Ga0500569_005309_857_1669 268
240 3300053129 Ga0500628_002165 Ga0500628_002165_1619_2431 268
241 3300053131 Ga0500652_008946 Ga0500652_008946_1232_2044 268
242 3300053151 Ga0500604_0010931 Ga0500604_0010931_213_1025 268
243 3300053156 Ga0500622_0005574 Ga0500622_0005574_1315_2127 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

138

244

0.98

PF01416

PseudoU_synth_1

tRNA pseudouridine synthase

2

97

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9636 1 255
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9573 1 255
1vs3-assembly1.cif.gz_B crystal structure of the trna pseudouridine synthase trua from thermus thermophilus hb8 0.9374 4 247
2nr0-assembly1.cif.gz_B crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9281 1 255
2nre-assembly1.cif.gz_A-2 crystal structure of pseudoudirinde synthase trua in complex with leucyl trna 0.9214 1 255
ID Description Score Start End Superfamily
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9619 1 107 3.30.70.580
af_A0A0R0F7R0_40_148_3.30.70.580 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9562 4 107 3.30.70.580
2nqpB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, N-terminal subdomain 0.9532 1 107 3.30.70.580
af_Q2FW37_106_241_3.30.70.660 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9493 110 241 3.30.70.660
2nreA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Pseudouridine synthase I, catalytic domain, C-terminal subdomain 0.9478 109 245 3.30.70.660
ID Description Score Start End GO Terms
AF-A0A844AZB0-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.994 5 263 GO:0003723
GO:0009982
GO:0031119
GO:0140098
AF-A0A257CBZ4-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9916 4 263 GO:0003723
GO:0031119
GO:0160147
AF-A0A7S1HF79-F1-model_v4 tRNA pseudouridine synthase (EC 5.4.99.12) 0.9901 83 247 GO:0003723
GO:0009982
GO:0031119
AF-A0A844AZB0-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9864 5 263 GO:0003723
GO:0009982
GO:0031119
GO:0140098
AF-A0A543Q406-F1-model_v4 tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I) 0.9863 1 253 GO:0003723
GO:0031119
GO:0160147

Feature Viewer

pLDDT pTM Quality
93 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map