F356255

General Info

Members Datasets Scaffolds Average Seq Length
244 140 488 163

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100002825|Ga0070714_1000028252
Length 184
Sequence LRDFGKFQHPAGSGFTMTTSAAPLRNEPTVLAPQQQAAHGLAIVRLTIGAMFVSVFFENLGKGLYRPAGYAGLINYYIKQGHSPAAWKAVMGLAASHAAMAAPLQAMTEISFGILLIVGLLTRPVAFLAFLYLGSLWMSEWGTAWIWELLVPVLALLGLSIGRAGRRWGVDAWLSQGWPSSPWW

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
46 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
47 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
68 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
69 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
70 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
75 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
76 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
81 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.9
Metatranscriptomes 4.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.87
Rhizosphere 95.49
Stem 0
Stem Tuber 0
Unclassified 38.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100002825 3300005435 Bacteria 12811
2 Ga0070680_100764879 3300005336 Unclassified 832
3 Ga0070709_10001531 3300005434 Bacteria 12480
4 Ga0070709_10069444 3300005434 Unclassified 2269
5 Ga0070714_100034931 3300005435 Bacteria 4210
6 Ga0070714_100080724 3300005435 Bacteria 2830
7 Ga0070714_100138876 3300005435 Bacteria 2179
8 Ga0070714_100788746 3300005435 Bacteria 920
9 Ga0070714_100810880 3300005435 Unclassified 907
10 Ga0070714_101189155 3300005435 Bacteria 744
11 Ga0070713_100000125 3300005436 Bacteria 50351
12 Ga0070713_100000509 3300005436 Bacteria 24860
13 Ga0070713_100230316 3300005436 Bacteria 1684
14 Ga0070713_100252813 3300005436 Bacteria 1608
15 Ga0070713_100521535 3300005436 Unclassified 1123
16 Ga0070713_100523781 3300005436 Bacteria 1120
17 Ga0070713_101024416 3300005436 Bacteria 797
18 Ga0070713_101201759 3300005436 Unclassified 734
19 Ga0070710_10000598 3300005437 Bacteria 17193
20 Ga0070710_10030372 3300005437 Bacteria 2907
21 Ga0070711_100000408 3300005439 Bacteria 22286
22 Ga0070711_100022649 3300005439 Bacteria 4075
23 Ga0070711_100062963 3300005439 Bacteria 2587
24 Ga0070711_100628853 3300005439 Unclassified 898
25 Ga0070700_100790143 3300005441 Unclassified 763
26 Ga0070708_100716332 3300005445 Bacteria 941
27 Ga0070663_100001583 3300005455 Bacteria 12524
28 Ga0070681_10389613 3300005458 Bacteria 1304
29 Ga0070681_10408716 3300005458 Unclassified 1269
30 Ga0070706_100002718 3300005467 Bacteria 17695
31 Ga0070706_100395575 3300005467 Bacteria 1286
32 Ga0070706_100450590 3300005467 Bacteria 1198
33 Ga0070706_100521374 3300005467 Unclassified 1105
34 Ga0070707_101286805 3300005468 Bacteria 697
35 Ga0070698_100152020 3300005471 Bacteria 2262
36 Ga0070698_100194987 3300005471 Bacteria 1962
37 Ga0070699_100443835 3300005518 Bacteria 1176
38 Ga0070699_101208487 3300005518 Unclassified 693
39 Ga0070679_100057638 3300005530 Unclassified 3872
40 Ga0070697_100055550 3300005536 Bacteria 3219
41 Ga0070697_100377536 3300005536 Unclassified 1227
42 Ga0070697_100989360 3300005536 Bacteria 747
43 Ga0068855_100001421 3300005563 Bacteria 29751
44 Ga0068857_101098732 3300005577 Unclassified 768
45 Ga0068863_101677900 3300005841 Unclassified 645
46 Ga0081455_10187249 3300005937 Unclassified 1562
47 Ga0070717_10022002 3300006028 Bacteria 5031
48 Ga0070717_10086948 3300006028 Unclassified 2632
49 Ga0070717_10239227 3300006028 Unclassified 1600
50 Ga0070717_10574428 3300006028 Bacteria 1022
51 Ga0070716_100001646 3300006173 Bacteria 10079
52 Ga0070716_100002081 3300006173 Bacteria 9175
53 Ga0070716_100152536 3300006173 Unclassified 1488
54 Ga0070716_100718473 3300006173 Unclassified 765
55 Ga0070712_100000067 3300006175 Bacteria 53056
56 Ga0070712_100000134 3300006175 Bacteria 38860
57 Ga0070712_100006375 3300006175 Bacteria 7319
58 Ga0070712_100135417 3300006175 Bacteria 1873
59 Ga0070712_100238561 3300006175 Unclassified 1447
60 Ga0075428_100677978 3300006844 Unclassified 1099
61 Ga0075430_100190189 3300006846 Unclassified 1706
62 Ga0075431_100140971 3300006847 Unclassified 2485
63 Ga0075433_10008310 3300006852 Bacteria 8275
64 Ga0075433_10621511 3300006852 Bacteria 948
65 Ga0075434_100000235 3300006871 Bacteria 38289
66 Ga0075434_100004271 3300006871 Bacteria 12817
67 Ga0075429_100029806 3300006880 Bacteria 4740
68 Ga0075436_100005980 3300006914 Bacteria 8355
69 Ga0075436_100158556 3300006914 Unclassified 1595
70 Ga0075435_100003821 3300007076 Bacteria 10277
71 Ga0075435_100007962 3300007076 Bacteria 7584
72 Ga0075435_100497341 3300007076 Bacteria 1054
73 Ga0075435_100811550 3300007076 Bacteria 815
74 Ga0099794_10133496 3300007265 Unclassified 1255
75 Ga0105240_10004264 3300009093 Bacteria 21862
76 Ga0105240_10047360 3300009093 Bacteria 5441
77 Ga0111539_11153263 3300009094 Bacteria 900
78 Ga0105247_11129997 3300009101 Bacteria 620
79 Ga0114129_10074350 3300009147 Unclassified 4733
80 Ga0114129_10098137 3300009147 Bacteria 4055
81 Ga0114129_11281314 3300009147 Unclassified 909
82 Ga0105241_10722746 3300009174 Unclassified 911
83 Ga0105238_10845999 3300009551 Bacteria 932
84 Ga0099796_10073775 3300010159 Unclassified 1237
85 Ga0157370_10002484 3300013104 Bacteria 22231
86 Ga0157369_10399861 3300013105 Bacteria 1425
87 Ga0157374_10128064 3300013296 Unclassified 2455
88 Ga0163163_10382359 3300014325 Bacteria 1465
89 Ga0213872_10001709 3300021361 Bacteria 13824
90 Ga0224572_1007976 3300024225 Unclassified 1951
91 Ga0228598_1000105 3300024227 Bacteria 13925
92 Ga0207653_10236907 3300025885 Unclassified 696
93 Ga0207692_10003006 3300025898 Bacteria 6536
94 Ga0207692_10024007 3300025898 Bacteria 2828
95 Ga0207685_10126149 3300025905 Bacteria 1130
96 Ga0207699_10001629 3300025906 Bacteria 10643
97 Ga0207699_10045048 3300025906 Bacteria 2572
98 Ga0207699_10293951 3300025906 Bacteria 1132
99 Ga0207684_10002906 3300025910 Bacteria 16981
100 Ga0207684_10045187 3300025910 Bacteria 3737
101 Ga0207684_10495508 3300025910 Bacteria 1047
102 Ga0207707_10029186 3300025912 Bacteria 4821
103 Ga0207695_10005455 3300025913 Bacteria 16847
104 Ga0207693_10000051 3300025915 Bacteria 99220
105 Ga0207693_10000252 3300025915 Bacteria 49630
106 Ga0207693_10005557 3300025915 Bacteria 10490
107 Ga0207693_10038900 3300025915 Bacteria 3744
108 Ga0207693_10127168 3300025915 Bacteria 2003
109 Ga0207693_10405782 3300025915 Bacteria 1065
110 Ga0207663_10001998 3300025916 Bacteria 9690
111 Ga0207663_10012760 3300025916 Unclassified 4551
112 Ga0207663_10039718 3300025916 Bacteria 2854
113 Ga0207663_10082243 3300025916 Bacteria 2112
114 Ga0207660_10429400 3300025917 Unclassified 1067
115 Ga0207652_10123880 3300025921 Bacteria 2301
116 Ga0207646_10007050 3300025922 Bacteria 11497
117 Ga0207646_10268812 3300025922 Bacteria 1541
118 Ga0207700_10000381 3300025928 Bacteria 25771
119 Ga0207700_10002753 3300025928 Bacteria 10131
120 Ga0207700_10451722 3300025928 Bacteria 1133
121 Ga0207700_10507917 3300025928 Unclassified 1067
122 Ga0207700_10681735 3300025928 Unclassified 917
123 Ga0207664_10000033 3300025929 Bacteria 176549
124 Ga0207664_10050872 3300025929 Bacteria 3269
125 Ga0207664_10159823 3300025929 Bacteria 1921
126 Ga0207664_10172174 3300025929 Bacteria 1854
127 Ga0207664_10980183 3300025929 Bacteria 758
128 Ga0207665_10009975 3300025939 Bacteria 6234
129 Ga0207665_10134546 3300025939 Bacteria 1758
130 Ga0207665_10153774 3300025939 Bacteria 1650
131 Ga0207667_10001239 3300025949 Bacteria 32026
132 Ga0207678_10000903 3300026067 Bacteria 27239
133 Ga0207641_10418179 3300026088 Unclassified 1290
134 Ga0207674_10686966 3300026116 Unclassified 988
135 Ga0209588_1064650 3300027671 Bacteria 1182
136 Ga0265356_1003032 3300028017 Bacteria 2152
137 Ga0265357_1010804 3300028023 Unclassified 923
138 Ga0265355_1016074 3300028036 Unclassified 635
139 Ga0265770_1052947 3300030878 Bacteria 739
140 Ga0265765_1008281 3300030879 Bacteria 1131
141 Ga0265773_1006642 3300031018 Bacteria 880
142 Ga0265773_1032563 3300031018 Bacteria 567
143 Ga0265760_10004082 3300031090 Unclassified 4207
144 Ga0265760_10005650 3300031090 Bacteria 3579
145 Ga0265760_10010730 3300031090 Bacteria 2617
146 Ga0265760_10052935 3300031090 Unclassified 1224
147 Ga0265760_10131609 3300031090 Bacteria 809
148 Ga0373934_0000830 3300035086 Bacteria 11167
149 Ga0373923_0065124 3300035111 Unclassified 1555
150 Ga0373923_0093978 3300035111 Unclassified 1315
151 Ga0373953_0004359 3300035117 Unclassified 4506
152 Ga0373953_0158610 3300035117 Unclassified 972
153 Ga0373954_0000402 3300035118 Bacteria 16198
154 Ga0373954_0510478 3300035118 Unclassified 596
155 Ga0373956_0035799 3300035119 Unclassified 2190
156 Ga0373946_0166055 3300035171 Bacteria 1039
157 Ga0373955_0493362 3300035172 Unclassified 748
158 Ga0373924_0023109 3300035410 Unclassified 2435
159 Ga0373935_0364945 3300035692 Bacteria 1032
160 Ga0373927_0220133 3300035695 Bacteria 1247
161 Ga0373933_0000375 3300035724 Bacteria 28675
162 Ga0373933_0030936 3300035724 Bacteria 3102
163 Ga0373937_0000082 3300036401 Bacteria 87971
164 Ga0373937_0078351 3300036401 Bacteria 3054
165 Ga0373937_0412778 3300036401 Bacteria 1281
166 Ga0373937_1004574 3300036401 Unclassified 783
167 Ga0373925_0023003 3300037068 Bacteria 4548
168 Ga0395898_0247788 3300037466 Unclassified 1699
169 Ga0436364_1024863 3300037853 Bacteria 725
170 Ga0395901_0069456 3300038443 Bacteria 3669
171 Ga0242420_045058 3300038996 Unclassified 851
172 Ga0436365_0946945 3300039437 Bacteria 1485
173 Ga0436360_0846475 3300039438 Bacteria 1873
174 Ga0436361_0470698 3300039447 Unclassified 538
175 Ga0436361_0582286 3300039447 Bacteria 2289
176 Ga0436363_1636019 3300039450 Bacteria 1237
177 Ga0436363_1643389 3300039450 Bacteria 1079
178 Ga0436362_0055977 3300039453 Bacteria 1330
179 Ga0436362_0057665 3300039453 Bacteria 1708
180 Ga0453684_0285831 3300044712 Bacteria 1879
181 Ga0451576_0413200 3300045051 Unclassified 1415
182 Ga0495603_0179340 3300046455 Unclassified 1226
183 Ga0495651_0179558 3300046462 Unclassified 1499
184 Ga0495651_0948078 3300046462 Unclassified 524
185 Ga0495653_0332863 3300046463 Unclassified 981
186 Ga0495580_0006097 3300046472 Bacteria 9858
187 Ga0495580_0023886 3300046472 Bacteria 4483
188 Ga0495580_0025792 3300046472 Bacteria 4292
189 Ga0495580_0736216 3300046472 Unclassified 643
190 Ga0495594_0041072 3300046499 Bacteria 2533
191 Ga0495594_0066940 3300046499 Bacteria 1993
192 Ga0495608_0015490 3300046511 Bacteria 5288
193 Ga0495630_0531787 3300046517 Unclassified 901
194 Ga0495630_0535570 3300046517 Unclassified 898
195 Ga0495652_0144751 3300046529 Unclassified 1865
196 Ga0495652_0463505 3300046529 Unclassified 885
197 Ga0495640_0462129 3300046533 Unclassified 774
198 Ga0495587_0003381 3300046536 Bacteria 10641
199 Ga0495667_0040669 3300046559 Unclassified 3086
200 Ga0495667_0144103 3300046559 Unclassified 1535
201 Ga0495668_0308166 3300046616 Unclassified 868
202 Ga0495634_0291438 3300046642 Unclassified 989
203 Ga0495635_0042731 3300046663 Unclassified 3129
204 Ga0495635_0878240 3300046663 Bacteria 575
205 Ga0495657_0541172 3300046675 Bacteria 677
206 Ga0495599_0314301 3300046678 Bacteria 944
207 Ga0495623_0106740 3300046679 Unclassified 1701
208 Ga0495646_0033720 3300046680 Bacteria 3183
209 Ga0495613_0555193 3300046689 Unclassified 768
210 Ga0495624_0286463 3300046690 Unclassified 994
211 Ga0495600_0305968 3300046809 Unclassified 1002
212 Ga0495600_0418811 3300046809 Unclassified 831
213 Ga0495604_0000235 3300047317 Bacteria 49754
214 Ga0495604_0159766 3300047317 Unclassified 1593
215 Ga0495636_0123958 3300047318 Unclassified 1145
216 Ga0495674_0011684 3300047319 Bacteria 8282
217 Ga0495674_0092937 3300047319 Bacteria 2575
218 Ga0495674_0099208 3300047319 Bacteria 2480
219 Ga0495674_0202527 3300047319 Unclassified 1646
220 Ga0495675_0025838 3300047444 Bacteria 3743
221 Ga0495684_0023950 3300047471 Unclassified 4695
222 Ga0495684_0619581 3300047471 Unclassified 728
223 Ga0495602_0055071 3300048088 Unclassified 3505
224 Ga0495602_0604730 3300048088 Unclassified 754
225 Ga0496102_0073061 3300048905 Unclassified 3153
226 Ga0496103_0827972 3300048906 Unclassified 583
227 Ga0496105_0113465 3300048908 Bacteria 2236
228 Ga0496112_0096313 3300048915 Unclassified 2930
229 Ga0496114_0955122 3300048917 Bacteria 740
230 Ga0496115_0381189 3300048918 Bacteria 1147
231 Ga0496115_0898629 3300048918 Unclassified 683
232 nmdc:mga05p37_42655_c1 3300050507 Bacteria 5576
233 nmdc:mga09592_21938_c1 3300050508 Bacteria 5266
234 nmdc:mga0qj67_312699_c1 3300050509 Unclassified 1272
235 nmdc:mga06r32_214002_c1 3300050510 Unclassified 1915
236 nmdc:mga0n895_4333_c1 3300050512 Bacteria 11630
237 nmdc:mga0rr50_140_c1 3300050513 Bacteria 39942
238 nmdc:mga08x19_139751_c1 3300050514 Bacteria 1635
239 nmdc:mga08x19_14044_c1 3300050514 Unclassified 4852
240 nmdc:mga08x19_274032_c1 3300050514 Unclassified 1168
241 nmdc:mga0a205_231868_c1 3300050515 Unclassified 1729
242 nmdc:mga0a205_2342_c1 3300050515 Bacteria 16711
243 Ga0495595_0107802 3300053084 Unclassified 1349
244 Ga0587071_008823 3300060344 Unclassified 1644
245 Ga0070714_100002825
246 Ga0070680_100764879
247 Ga0070709_10001531
248 Ga0070709_10069444
249 Ga0070714_100034931
250 Ga0070714_100080724
251 Ga0070714_100138876
252 Ga0070714_100788746
253 Ga0070714_100810880
254 Ga0070714_101189155
255 Ga0070713_100000125
256 Ga0070713_100000509
257 Ga0070713_100230316
258 Ga0070713_100252813
259 Ga0070713_100521535
260 Ga0070713_100523781
261 Ga0070713_101024416
262 Ga0070713_101201759
263 Ga0070710_10000598
264 Ga0070710_10030372
265 Ga0070711_100000408
266 Ga0070711_100022649
267 Ga0070711_100062963
268 Ga0070711_100628853
269 Ga0070700_100790143
270 Ga0070708_100716332
271 Ga0070663_100001583
272 Ga0070681_10389613
273 Ga0070681_10408716
274 Ga0070706_100002718
275 Ga0070706_100395575
276 Ga0070706_100450590
277 Ga0070706_100521374
278 Ga0070707_101286805
279 Ga0070698_100152020
280 Ga0070698_100194987
281 Ga0070699_100443835
282 Ga0070699_101208487
283 Ga0070679_100057638
284 Ga0070697_100055550
285 Ga0070697_100377536
286 Ga0070697_100989360
287 Ga0068855_100001421
288 Ga0068857_101098732
289 Ga0068863_101677900
290 Ga0081455_10187249
291 Ga0070717_10022002
292 Ga0070717_10086948
293 Ga0070717_10239227
294 Ga0070717_10574428
295 Ga0070716_100001646
296 Ga0070716_100002081
297 Ga0070716_100152536
298 Ga0070716_100718473
299 Ga0070712_100000067
300 Ga0070712_100000134
301 Ga0070712_100006375
302 Ga0070712_100135417
303 Ga0070712_100238561
304 Ga0075428_100677978
305 Ga0075430_100190189
306 Ga0075431_100140971
307 Ga0075433_10008310
308 Ga0075433_10621511
309 Ga0075434_100000235
310 Ga0075434_100004271
311 Ga0075429_100029806
312 Ga0075436_100005980
313 Ga0075436_100158556
314 Ga0075435_100003821
315 Ga0075435_100007962
316 Ga0075435_100497341
317 Ga0075435_100811550
318 Ga0099794_10133496
319 Ga0105240_10004264
320 Ga0105240_10047360
321 Ga0111539_11153263
322 Ga0105247_11129997
323 Ga0114129_10074350
324 Ga0114129_10098137
325 Ga0114129_11281314
326 Ga0105241_10722746
327 Ga0105238_10845999
328 Ga0099796_10073775
329 Ga0157370_10002484
330 Ga0157369_10399861
331 Ga0157374_10128064
332 Ga0163163_10382359
333 Ga0213872_10001709
334 Ga0224572_1007976
335 Ga0228598_1000105
336 Ga0207653_10236907
337 Ga0207692_10003006
338 Ga0207692_10024007
339 Ga0207685_10126149
340 Ga0207699_10001629
341 Ga0207699_10045048
342 Ga0207699_10293951
343 Ga0207684_10002906
344 Ga0207684_10045187
345 Ga0207684_10495508
346 Ga0207707_10029186
347 Ga0207695_10005455
348 Ga0207693_10000051
349 Ga0207693_10000252
350 Ga0207693_10005557
351 Ga0207693_10038900
352 Ga0207693_10127168
353 Ga0207693_10405782
354 Ga0207663_10001998
355 Ga0207663_10012760
356 Ga0207663_10039718
357 Ga0207663_10082243
358 Ga0207660_10429400
359 Ga0207652_10123880
360 Ga0207646_10007050
361 Ga0207646_10268812
362 Ga0207700_10000381
363 Ga0207700_10002753
364 Ga0207700_10451722
365 Ga0207700_10507917
366 Ga0207700_10681735
367 Ga0207664_10000033
368 Ga0207664_10050872
369 Ga0207664_10159823
370 Ga0207664_10172174
371 Ga0207664_10980183
372 Ga0207665_10009975
373 Ga0207665_10134546
374 Ga0207665_10153774
375 Ga0207667_10001239
376 Ga0207678_10000903
377 Ga0207641_10418179
378 Ga0207674_10686966
379 Ga0209588_1064650
380 Ga0265356_1003032
381 Ga0265357_1010804
382 Ga0265355_1016074
383 Ga0265770_1052947
384 Ga0265765_1008281
385 Ga0265773_1006642
386 Ga0265773_1032563
387 Ga0265760_10004082
388 Ga0265760_10005650
389 Ga0265760_10010730
390 Ga0265760_10052935
391 Ga0265760_10131609
392 Ga0373934_0000830
393 Ga0373923_0065124
394 Ga0373923_0093978
395 Ga0373953_0004359
396 Ga0373953_0158610
397 Ga0373954_0000402
398 Ga0373954_0510478
399 Ga0373956_0035799
400 Ga0373946_0166055
401 Ga0373955_0493362
402 Ga0373924_0023109
403 Ga0373935_0364945
404 Ga0373927_0220133
405 Ga0373933_0000375
406 Ga0373933_0030936
407 Ga0373937_0000082
408 Ga0373937_0078351
409 Ga0373937_0412778
410 Ga0373937_1004574
411 Ga0373925_0023003
412 Ga0395898_0247788
413 Ga0436364_1024863
414 Ga0395901_0069456
415 Ga0242420_045058
416 Ga0436365_0946945
417 Ga0436360_0846475
418 Ga0436361_0470698
419 Ga0436361_0582286
420 Ga0436363_1636019
421 Ga0436363_1643389
422 Ga0436362_0055977
423 Ga0436362_0057665
424 Ga0453684_0285831
425 Ga0451576_0413200
426 Ga0495603_0179340
427 Ga0495651_0179558
428 Ga0495651_0948078
429 Ga0495653_0332863
430 Ga0495580_0006097
431 Ga0495580_0023886
432 Ga0495580_0025792
433 Ga0495580_0736216
434 Ga0495594_0041072
435 Ga0495594_0066940
436 Ga0495608_0015490
437 Ga0495630_0531787
438 Ga0495630_0535570
439 Ga0495652_0144751
440 Ga0495652_0463505
441 Ga0495640_0462129
442 Ga0495587_0003381
443 Ga0495667_0040669
444 Ga0495667_0144103
445 Ga0495668_0308166
446 Ga0495634_0291438
447 Ga0495635_0042731
448 Ga0495635_0878240
449 Ga0495657_0541172
450 Ga0495599_0314301
451 Ga0495623_0106740
452 Ga0495646_0033720
453 Ga0495613_0555193
454 Ga0495624_0286463
455 Ga0495600_0305968
456 Ga0495600_0418811
457 Ga0495604_0000235
458 Ga0495604_0159766
459 Ga0495636_0123958
460 Ga0495674_0011684
461 Ga0495674_0092937
462 Ga0495674_0099208
463 Ga0495674_0202527
464 Ga0495675_0025838
465 Ga0495684_0023950
466 Ga0495684_0619581
467 Ga0495602_0055071
468 Ga0495602_0604730
469 Ga0496102_0073061
470 Ga0496103_0827972
471 Ga0496105_0113465
472 Ga0496112_0096313
473 Ga0496114_0955122
474 Ga0496115_0381189
475 Ga0496115_0898629
476 nmdc:mga05p37_42655_c1
477 nmdc:mga09592_21938_c1
478 nmdc:mga0qj67_312699_c1
479 nmdc:mga06r32_214002_c1
480 nmdc:mga0n895_4333_c1
481 nmdc:mga0rr50_140_c1
482 nmdc:mga08x19_139751_c1
483 nmdc:mga08x19_14044_c1
484 nmdc:mga08x19_274032_c1
485 nmdc:mga0a205_231868_c1
486 nmdc:mga0a205_2342_c1
487 Ga0495595_0107802
488 Ga0587071_008823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

40

141

0.87

PF04173

DoxD

TQO small subunit DoxD

41

179

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4706 22 145
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.4567 13 145
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4328 22 145
8dgi-assembly1.cif.gz_A structural basis of microrna biogenesis by dicer-1 and its partner protein loqs-pb - complex ia 0.3806 32 167
1x8z-assembly2.cif.gz_C crystal structure of a pectin methylesterase inhibitor from arabidopsis thaliana 0.3793 13 145
ID Description Score Start End Superfamily
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6397 26 161 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6121 26 161 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6006 25 164 1.20.120.550
af_Q8T0T9_12_131_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5972 28 140 1.20.120.550
af_Q4E5C0_1_157_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5663 26 161 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2U3K7L6-F1-model_v4 DoxX family protein 0.9839 22 168 GO:0016020
AF-A0A534PVB9-F1-model_v4 DoxX family membrane protein 0.9775 21 168 GO:0016020
AF-A0A534Q1C8-F1-model_v4 DoxX family membrane protein 0.9774 22 168 GO:0016020
AF-A0A3N5H890-F1-model_v4 DoxX family membrane protein 0.9722 36 168 GO:0016020
AF-A0A220VGL1-F1-model_v4 Uncharacterized protein 0.9625 25 145 GO:0016020

Map