F356272

General Info

Members Datasets Scaffolds Average Seq Length
244 128 244 303

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100243977|Ga0070694_1002439771
Length 309
Sequence VRSEPKRVCVAGAGVIGSLFAGYLARVADVTVLTRREEHANALNEGGLRVSGRGDFTSRVTAATSPEALPEPDLVIVASKGGDVESLAARLAGHWPGATLMTVQNGIGADEIVARHGAWPLLTAVTFMSGTRHADTHVEYVLDTATWIGPSRGTTVEDARAVAALIDSSGLKAEAFDDLRPAQWSKLIFNATVNTVAAVTGLRHDPHFAALDEPSDLGFLVRNLMDEGKAVAAAAGVTLDEDPWEMNVLATQRGHRHAPSMLEDVQAGRPTEVDMITGSLVREAHRLGVPVPLHEAMYSLIKGREASWE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
52 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
124 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
125 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
126 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.3
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10044421 3300005327 Bacteria 3591
2 Ga0070658_10056867 3300005327 Bacteria 3181
3 Ga0070658_10251344 3300005327 Bacteria 1500
4 Ga0070658_10485872 3300005327 Bacteria 1066
5 Ga0070683_100203775 3300005329 Unclassified 1879
6 Ga0070683_100217686 3300005329 Bacteria 1815
7 Ga0070680_100003049 3300005336 Bacteria 12438
8 Ga0070680_100033088 3300005336 Bacteria 4164
9 Ga0070660_100001274 3300005339 Bacteria 17185
10 Ga0070660_100006124 3300005339 Bacteria 8321
11 Ga0070660_100064856 3300005339 Bacteria 2842
12 Ga0070671_100026038 3300005355 Bacteria 4804
13 Ga0070659_100098719 3300005366 Bacteria 2348
14 Ga0070709_10107614 3300005434 Unclassified 1869
15 Ga0070714_100004981 3300005435 Bacteria 10094
16 Ga0070714_100010104 3300005435 Bacteria 7449
17 Ga0070714_100020134 3300005435 Bacteria 5445
18 Ga0070714_100021307 3300005435 Bacteria 5303
19 Ga0070711_100043887 3300005439 Bacteria 3031
20 Ga0070694_100243977 3300005444 Bacteria 1356
21 Ga0070681_10055591 3300005458 Bacteria 3940
22 Ga0070681_10083082 3300005458 Bacteria 3157
23 Ga0070698_100054404 3300005471 Bacteria 4063
24 Ga0070679_100056640 3300005530 Bacteria 3906
25 Ga0070679_100203177 3300005530 Unclassified 1946
26 Ga0070679_100354273 3300005530 Bacteria 1415
27 Ga0070684_100019842 3300005535 Bacteria 5569
28 Ga0068853_100507795 3300005539 Unclassified 1139
29 Ga0068855_100083246 3300005563 Bacteria 3707
30 Ga0068855_100108747 3300005563 Bacteria 3184
31 Ga0068855_100148775 3300005563 Bacteria 2663
32 Ga0068855_100510175 3300005563 Unclassified 1306
33 Ga0068855_100525891 3300005563 Unclassified 1283
34 Ga0068857_100241462 3300005577 Unclassified 1654
35 Ga0081455_10234764 3300005937 Unclassified 1351
36 Ga0070712_100108532 3300006175 Unclassified 2067
37 Ga0075436_100024693 3300006914 Bacteria 4132
38 Ga0075436_100093133 3300006914 Bacteria 2095
39 Ga0105240_10416983 3300009093 Bacteria 1509
40 Ga0157370_10018322 3300013104 Bacteria 7043
41 Ga0157370_10071126 3300013104 Bacteria 3283
42 Ga0157370_10091163 3300013104 Unclassified 2862
43 Ga0157369_10011147 3300013105 Bacteria 10221
44 Ga0157369_10020388 3300013105 Bacteria 7411
45 Ga0157369_10022326 3300013105 Bacteria 7064
46 Ga0157369_10273625 3300013105 Unclassified 1759
47 Ga0157369_10374501 3300013105 Bacteria 1478
48 Ga0157369_10506302 3300013105 Bacteria 1249
49 Ga0182007_10053540 3300015262 Bacteria 1328
50 Ga0206356_11035672 3300020070 Bacteria 1645
51 Ga0206356_11755113 3300020070 Bacteria 6781
52 Ga0206353_10840906 3300020082 Bacteria 4345
53 Ga0206353_11760862 3300020082 Bacteria 3591
54 Ga0207699_10019701 3300025906 Bacteria 3603
55 Ga0207705_10040233 3300025909 Bacteria 3352
56 Ga0207705_10042503 3300025909 Bacteria 3263
57 Ga0207705_10088280 3300025909 Bacteria 2268
58 Ga0207705_10362325 3300025909 Bacteria 1118
59 Ga0207707_10020762 3300025912 Bacteria 5737
60 Ga0207707_10077768 3300025912 Bacteria 2896
61 Ga0207707_10081628 3300025912 Bacteria 2822
62 Ga0207707_10084969 3300025912 Bacteria 2765
63 Ga0207695_10351684 3300025913 Bacteria 1361
64 Ga0207663_10164600 3300025916 Bacteria 1569
65 Ga0207660_10372816 3300025917 Bacteria 1146
66 Ga0207657_10009267 3300025919 Bacteria 9917
67 Ga0207657_10014416 3300025919 Bacteria 7720
68 Ga0207657_10020425 3300025919 Bacteria 6259
69 Ga0207657_10077553 3300025919 Bacteria 2800
70 Ga0207657_10104888 3300025919 Bacteria 2341
71 Ga0207649_10209945 3300025920 Bacteria 1381
72 Ga0207652_10007162 3300025921 Bacteria 8995
73 Ga0207652_10089912 3300025921 Unclassified 2697
74 Ga0207652_10222427 3300025921 Bacteria 1701
75 Ga0207652_10380124 3300025921 Bacteria 1275
76 Ga0207700_10146531 3300025928 Bacteria 1946
77 Ga0207700_10265673 3300025928 Unclassified 1471
78 Ga0207664_10009424 3300025929 Bacteria 6851
79 Ga0207664_10011740 3300025929 Bacteria 6243
80 Ga0207664_10037791 3300025929 Bacteria 3739
81 Ga0207664_10188962 3300025929 Bacteria 1772
82 Ga0207664_10242487 3300025929 Bacteria 1570
83 Ga0207644_10038412 3300025931 Bacteria 3372
84 Ga0207690_10198011 3300025932 Bacteria 1524
85 Ga0207686_10040837 3300025934 Bacteria 2824
86 Ga0207661_10140387 3300025944 Unclassified 2079
87 Ga0207667_10183756 3300025949 Bacteria 2147
88 Ga0207667_10323230 3300025949 Unclassified 1576
89 Ga0207674_10243979 3300026116 Unclassified 1743
90 Ga0207698_10209471 3300026142 Bacteria 1753
91 Ga0265319_1001131 3300028563 Bacteria 16576
92 Ga0265319_1003410 3300028563 Bacteria 8300
93 Ga0265334_10000679 3300028573 Bacteria 17043
94 Ga0265334_10011458 3300028573 Unclassified 3733
95 Ga0265318_10001661 3300028577 Bacteria 12786
96 Ga0265318_10004002 3300028577 Bacteria 7243
97 Ga0265322_10033886 3300028654 Bacteria 1456
98 Ga0265322_10049743 3300028654 Unclassified 1190
99 Ga0265322_10050975 3300028654 Unclassified 1175
100 Ga0265338_10001443 3300028800 Bacteria 38590
101 Ga0265338_10005145 3300028800 Bacteria 17221
102 Ga0265338_10022691 3300028800 Bacteria 6482
103 Ga0265338_10050007 3300028800 Bacteria 3783
104 Ga0265338_10099524 3300028800 Bacteria 2374
105 Ga0265338_10152641 3300028800 Unclassified 1793
106 Ga0265324_10044733 3300029957 Bacteria 1526
107 Ga0265330_10003515 3300031235 Bacteria 8164
108 Ga0265328_10003815 3300031239 Bacteria 6624
109 Ga0265320_10003022 3300031240 Bacteria 11460
110 Ga0265329_10005179 3300031242 Bacteria 5303
111 Ga0265340_10003437 3300031247 Bacteria 8940
112 Ga0265340_10014292 3300031247 Bacteria 4152
113 Ga0265339_10004787 3300031249 Bacteria 9165
114 Ga0265331_10003344 3300031250 Bacteria 10405
115 Ga0265327_10006570 3300031251 Bacteria 9246
116 Ga0265327_10039339 3300031251 Bacteria 2569
117 Ga0265327_10066625 3300031251 Bacteria 1816
118 Ga0265327_10119645 3300031251 Bacteria 1249
119 Ga0265316_10027796 3300031344 Bacteria 4676
120 Ga0265313_10029730 3300031595 Bacteria 2822
121 Ga0265314_10009587 3300031711 Bacteria 8157
122 Ga0265314_10022143 3300031711 Bacteria 4871
123 Ga0265314_10023325 3300031711 Bacteria 4719
124 Ga0265342_10004174 3300031712 Bacteria 11498
125 Ga0265342_10006365 3300031712 Bacteria 8803
126 Ga0265342_10091957 3300031712 Bacteria 1738
127 Ga0307412_10180262 3300031911 Unclassified 1588
128 Ga0395900_0179517 3300037418 Bacteria 2152
129 Ga0395900_0341245 3300037418 Bacteria 1473
130 Ga0395898_0072759 3300037466 Bacteria 3320
131 Ga0395898_0074233 3300037466 Bacteria 3285
132 Ga0395898_0207622 3300037466 Unclassified 1869
133 Ga0395898_0243636 3300037466 Unclassified 1715
134 Ga0395901_0016341 3300038443 Bacteria 7558
135 Ga0466963_0003176 3300044694 Bacteria 9336
136 Ga0466963_0014512 3300044694 Bacteria 4859
137 Ga0466963_0085426 3300044694 Bacteria 2142
138 Ga0466963_0089308 3300044694 Bacteria 2096
139 Ga0466964_0117264 3300044706 Bacteria 1195
140 Ga0466957_0010377 3300044842 Bacteria 5344
141 Ga0466959_0018321 3300045049 Bacteria 5141
142 Ga0451576_0348573 3300045051 Unclassified 1550
143 Ga0466958_0003504 3300045836 Bacteria 8151
144 Ga0466958_0010935 3300045836 Bacteria 5098
145 Ga0466967_0000209 3300045976 Bacteria 24700
146 Ga0466967_0002179 3300045976 Bacteria 12048
147 Ga0466967_0023852 3300045976 Bacteria 5020
148 Ga0466967_0121234 3300045976 Bacteria 2416
149 Ga0466967_0128388 3300045976 Bacteria 2350
150 Ga0466967_0150975 3300045976 Bacteria 2171
151 Ga0466967_0184147 3300045976 Bacteria 1971
152 Ga0466967_0206047 3300045976 Bacteria 1864
153 Ga0466967_0232717 3300045976 Bacteria 1755
154 Ga0466967_0307488 3300045976 Bacteria 1526
155 Ga0495629_0046364 3300046459 Bacteria 3049
156 Ga0495641_0078132 3300046461 Bacteria 1483
157 Ga0495641_0134050 3300046461 Bacteria 1106
158 Ga0495651_0348685 3300046462 Bacteria 979
159 Ga0495653_0108674 3300046463 Unclassified 1997
160 Ga0495582_0215830 3300046473 Unclassified 1097
161 Ga0495664_0138837 3300046477 Bacteria 1473
162 Ga0495608_0055570 3300046511 Bacteria 2616
163 Ga0495608_0087743 3300046511 Bacteria 2014
164 Ga0495618_0009767 3300046514 Bacteria 5798
165 Ga0495628_0033165 3300046516 Bacteria 4164
166 Ga0495652_0035940 3300046529 Bacteria 4309
167 Ga0495652_0154016 3300046529 Bacteria 1792
168 Ga0495587_0013305 3300046536 Bacteria 5172
169 Ga0495645_0050570 3300046543 Bacteria 3026
170 Ga0495645_0148925 3300046543 Bacteria 1628
171 Ga0495667_0024061 3300046559 Bacteria 4102
172 Ga0495667_0100437 3300046559 Bacteria 1872
173 Ga0495634_0112346 3300046642 Bacteria 1751
174 Ga0495634_0141250 3300046642 Bacteria 1528
175 Ga0495635_0066024 3300046663 Bacteria 2482
176 Ga0495635_0114344 3300046663 Unclassified 1842
177 Ga0495635_0232682 3300046663 Unclassified 1245
178 Ga0495657_0025782 3300046675 Bacteria 4172
179 Ga0495657_0035143 3300046675 Bacteria 3475
180 Ga0495623_0033513 3300046679 Bacteria 3295
181 Ga0495613_0021563 3300046689 Bacteria 4799
182 Ga0495613_0081962 3300046689 Bacteria 2343
183 Ga0495613_0217495 3300046689 Unclassified 1342
184 Ga0495600_0031118 3300046809 Bacteria 3456
185 Ga0495604_0063806 3300047317 Bacteria 2809
186 Ga0495604_0241838 3300047317 Bacteria 1234
187 Ga0495674_0000162 3300047319 Bacteria 51804
188 Ga0495674_0109583 3300047319 Bacteria 2342
189 Ga0495674_0196528 3300047319 Unclassified 1675
190 Ga0495680_0000826 3300047322 Bacteria 34470
191 Ga0495680_0017408 3300047322 Bacteria 6138
192 Ga0495680_0102303 3300047322 Unclassified 2133
193 Ga0495684_0056129 3300047471 Bacteria 3003
194 Ga0495602_0276167 3300048088 Unclassified 1240
195 Ga0496100_0005507 3300048903 Bacteria 6829
196 Ga0496100_0082698 3300048903 Unclassified 2172
197 Ga0496101_0001562 3300048904 Bacteria 13723
198 Ga0496101_0033475 3300048904 Bacteria 3624
199 Ga0496102_0022596 3300048905 Bacteria 5573
200 Ga0496102_0039505 3300048905 Bacteria 4264
201 Ga0496102_0061827 3300048905 Bacteria 3429
202 Ga0496104_0077632 3300048907 Unclassified 3164
203 Ga0496105_0257517 3300048908 Unclassified 1412
204 Ga0496106_0328758 3300048909 Unclassified 1227
205 Ga0496107_0018843 3300048910 Bacteria 4865
206 Ga0496107_0035608 3300048910 Bacteria 3568
207 Ga0496108_0077399 3300048911 Unclassified 2813
208 Ga0496109_0078851 3300048912 Unclassified 3033
209 Ga0496110_0008761 3300048913 Bacteria 8151
210 Ga0496111_0057752 3300048914 Bacteria 2809
211 Ga0496112_0004991 3300048915 Bacteria 11379
212 Ga0496112_0039050 3300048915 Bacteria 4636
213 Ga0496112_0042568 3300048915 Bacteria 4443
214 Ga0496112_0188834 3300048915 Unclassified 2023
215 Ga0496112_0312946 3300048915 Bacteria 1515
216 Ga0496112_0330966 3300048915 Unclassified 1467
217 Ga0496113_0052560 3300048916 Bacteria 3044
218 Ga0496113_0258565 3300048916 Bacteria 1391
219 Ga0496114_0011934 3300048917 Bacteria 6952
220 Ga0496114_0016676 3300048917 Bacteria 5924
221 Ga0496114_0241999 3300048917 Bacteria 1587
222 Ga0496115_0004526 3300048918 Bacteria 10052
223 Ga0496115_0005272 3300048918 Bacteria 9398
224 Ga0496115_0050825 3300048918 Bacteria 3323
225 Ga0501034_0023982 3300049571 Bacteria 6209
226 Ga0501067_0025059 3300049583 Archaea 3308
227 Ga0501069_0023520 3300049585 Unclassified 3361
228 Ga0501070_0002361 3300049586 Bacteria 16549
229 Ga0501070_0002523 3300049586 Bacteria 16046
230 Ga0501072_0004748 3300049588 Bacteria 10343
231 Ga0501073_0014045 3300049589 Bacteria 5818
232 Ga0501074_0017539 3300049590 Bacteria 5197
233 Ga0501079_0016409 3300049741 Bacteria 5655
234 Ga0501080_0001169 3300049742 Bacteria 21714
235 Ga0501080_0199702 3300049742 Bacteria 1836
236 Ga0501083_0001948 3300049744 Bacteria 14197
237 Ga0495601_0036168 3300053077 Bacteria 3083
238 Ga0495655_0004007 3300053083 Unclassified 2483
239 Ga0495595_0025295 3300053084 Bacteria 2630
240 Ga0495619_0060309 3300053085 Bacteria 2521
241 Ga0495619_0060840 3300053085 Bacteria 2511
242 Ga0495619_0131637 3300053085 Bacteria 1719
243 Ga0501084_0041784 3300054114 Bacteria 3836
244 Ga0501082_0175916 3300060353 Bacteria 1861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0207622 Ga0395898_0207622_950_1720 256
2 3300015262 Ga0182007_10053540 Ga0182007_100535402 285
3 3300048915 Ga0496112_0042568 Ga0496112_0042568_3206_4123 287
4 3300005327 Ga0070658_10056867 Ga0070658_100568673 289
5 3300005327 Ga0070658_10485872 Ga0070658_104858721 289
6 3300005336 Ga0070680_100003049 Ga0070680_1000030499 289
7 3300005366 Ga0070659_100098719 Ga0070659_1000987193 289
8 3300005563 Ga0068855_100083246 Ga0068855_1000832463 289
9 3300009093 Ga0105240_10416983 Ga0105240_104169832 289
10 3300020082 Ga0206353_10840906 Ga0206353_108409062 289
11 3300025909 Ga0207705_10040233 Ga0207705_100402332 289
12 3300025912 Ga0207707_10020762 Ga0207707_100207626 289
13 3300025912 Ga0207707_10084969 Ga0207707_100849692 289
14 3300025917 Ga0207660_10372816 Ga0207660_103728161 289
15 3300025919 Ga0207657_10014416 Ga0207657_100144166 289
16 3300025921 Ga0207652_10007162 Ga0207652_100071629 289
17 3300025921 Ga0207652_10089912 Ga0207652_100899123 289
18 3300025932 Ga0207690_10198011 Ga0207690_101980112 289
19 3300026142 Ga0207698_10209471 Ga0207698_102094712 289
20 3300048915 Ga0496112_0039050 Ga0496112_0039050_1313_2227 289
21 3300048916 Ga0496113_0052560 Ga0496113_0052560_540_1454 289
22 3300048903 Ga0496100_0005507 Ga0496100_0005507_5268_6185 290
23 3300048904 Ga0496101_0001562 Ga0496101_0001562_8646_9563 290
24 3300048910 Ga0496107_0035608 Ga0496107_0035608_501_1418 290
25 3300005563 Ga0068855_100148775 Ga0068855_1001487752 292
26 3300047317 Ga0495604_0241838 Ga0495604_0241838_163_1059 294
27 3300049742 Ga0501080_0199702 Ga0501080_0199702_145_1056 299
28 3300005327 Ga0070658_10251344 Ga0070658_102513441 300
29 3300005434 Ga0070709_10107614 Ga0070709_101076142 300
30 3300005435 Ga0070714_100004981 Ga0070714_1000049818 300
31 3300005435 Ga0070714_100020134 Ga0070714_1000201343 300
32 3300005435 Ga0070714_100021307 Ga0070714_1000213074 300
33 3300005439 Ga0070711_100043887 Ga0070711_1000438873 300
34 3300006175 Ga0070712_100108532 Ga0070712_1001085322 300
35 3300006914 Ga0075436_100024693 Ga0075436_1000246935 300
36 3300006914 Ga0075436_100093133 Ga0075436_1000931331 300
37 3300013104 Ga0157370_10071126 Ga0157370_100711263 300
38 3300013105 Ga0157369_10022326 Ga0157369_100223265 300
39 3300013105 Ga0157369_10506302 Ga0157369_105063022 300
40 3300025906 Ga0207699_10019701 Ga0207699_100197014 300
41 3300025909 Ga0207705_10088280 Ga0207705_100882802 300
42 3300025909 Ga0207705_10362325 Ga0207705_103623251 300
43 3300025913 Ga0207695_10351684 Ga0207695_103516842 300
44 3300025916 Ga0207663_10164600 Ga0207663_101646002 300
45 3300025928 Ga0207700_10146531 Ga0207700_101465312 300
46 3300025929 Ga0207664_10009424 Ga0207664_100094242 300
47 3300025929 Ga0207664_10037791 Ga0207664_100377912 300
48 3300025929 Ga0207664_10188962 Ga0207664_101889622 300
49 3300025929 Ga0207664_10242487 Ga0207664_102424872 300
50 3300025949 Ga0207667_10183756 Ga0207667_101837562 300
51 3300037418 Ga0395900_0179517 Ga0395900_0179517_886_1788 300
52 3300037466 Ga0395898_0074233 Ga0395898_0074233_1434_2336 300
53 3300044694 Ga0466963_0089308 Ga0466963_0089308_183_1085 300
54 3300045049 Ga0466959_0018321 Ga0466959_0018321_2489_3394 300
55 3300045976 Ga0466967_0000209 Ga0466967_0000209_18246_19148 300
56 3300045976 Ga0466967_0128388 Ga0466967_0128388_243_1145 300
57 3300045976 Ga0466967_0307488 Ga0466967_0307488_465_1367 300
58 3300046461 Ga0495641_0134050 Ga0495641_0134050_64_978 300
59 3300046473 Ga0495582_0215830 Ga0495582_0215830_88_1002 300
60 3300046511 Ga0495608_0055570 Ga0495608_0055570_386_1300 300
61 3300046536 Ga0495587_0013305 Ga0495587_0013305_2692_3606 300
62 3300046663 Ga0495635_0232682 Ga0495635_0232682_113_1027 300
63 3300046675 Ga0495657_0035143 Ga0495657_0035143_1288_2202 300
64 3300046679 Ga0495623_0033513 Ga0495623_0033513_1541_2455 300
65 3300046689 Ga0495613_0217495 Ga0495613_0217495_257_1159 300
66 3300046809 Ga0495600_0031118 Ga0495600_0031118_2057_2971 300
67 3300047322 Ga0495680_0102303 Ga0495680_0102303_151_1065 300
68 3300048088 Ga0495602_0276167 Ga0495602_0276167_266_1180 300
69 3300048903 Ga0496100_0082698 Ga0496100_0082698_995_1909 300
70 3300048905 Ga0496102_0061827 Ga0496102_0061827_2089_3003 300
71 3300048907 Ga0496104_0077632 Ga0496104_0077632_1593_2507 300
72 3300048908 Ga0496105_0257517 Ga0496105_0257517_203_1117 300
73 3300048909 Ga0496106_0328758 Ga0496106_0328758_144_1058 300
74 3300048915 Ga0496112_0188834 Ga0496112_0188834_301_1215 300
75 3300048915 Ga0496112_0330966 Ga0496112_0330966_43_957 300
76 3300048917 Ga0496114_0016676 Ga0496114_0016676_2114_3028 300
77 3300048918 Ga0496115_0004526 Ga0496115_0004526_2218_3132 300
78 3300048918 Ga0496115_0005272 Ga0496115_0005272_5170_6084 300
79 3300048918 Ga0496115_0050825 Ga0496115_0050825_2143_3066 300
80 3300049571 Ga0501034_0023982 Ga0501034_0023982_2130_3035 300
81 3300049586 Ga0501070_0002361 Ga0501070_0002361_13539_14444 300
82 3300049589 Ga0501073_0014045 Ga0501073_0014045_2116_3021 300
83 3300049742 Ga0501080_0001169 Ga0501080_0001169_12344_13249 300
84 3300053077 Ga0495601_0036168 Ga0495601_0036168_1736_2650 300
85 3300060353 Ga0501082_0175916 Ga0501082_0175916_204_1109 300
86 3300005329 Ga0070683_100203775 Ga0070683_1002037752 301
87 3300005329 Ga0070683_100217686 Ga0070683_1002176862 301
88 3300005336 Ga0070680_100033088 Ga0070680_1000330884 301
89 3300005339 Ga0070660_100001274 Ga0070660_10000127414 301
90 3300005339 Ga0070660_100006124 Ga0070660_1000061248 301
91 3300005355 Ga0070671_100026038 Ga0070671_1000260385 301
92 3300005458 Ga0070681_10055591 Ga0070681_100555912 301
93 3300005530 Ga0070679_100056640 Ga0070679_1000566403 301
94 3300005530 Ga0070679_100203177 Ga0070679_1002031772 301
95 3300005530 Ga0070679_100354273 Ga0070679_1003542732 301
96 3300005535 Ga0070684_100019842 Ga0070684_1000198423 301
97 3300005539 Ga0068853_100507795 Ga0068853_1005077952 301
98 3300005563 Ga0068855_100510175 Ga0068855_1005101752 301
99 3300005577 Ga0068857_100241462 Ga0068857_1002414622 301
100 3300005937 Ga0081455_10234764 Ga0081455_102347642 301
101 3300013104 Ga0157370_10018322 Ga0157370_100183228 301
102 3300013104 Ga0157370_10091163 Ga0157370_100911632 301
103 3300013105 Ga0157369_10011147 Ga0157369_100111479 301
104 3300013105 Ga0157369_10273625 Ga0157369_102736252 301
105 3300013105 Ga0157369_10374501 Ga0157369_103745012 301
106 3300020070 Ga0206356_11035672 Ga0206356_110356722 301
107 3300020082 Ga0206353_11760862 Ga0206353_117608622 301
108 3300025912 Ga0207707_10081628 Ga0207707_100816283 301
109 3300025919 Ga0207657_10009267 Ga0207657_1000926710 301
110 3300025919 Ga0207657_10020425 Ga0207657_100204256 301
111 3300025921 Ga0207652_10222427 Ga0207652_102224272 301
112 3300025921 Ga0207652_10380124 Ga0207652_103801242 301
113 3300025928 Ga0207700_10265673 Ga0207700_102656732 301
114 3300025931 Ga0207644_10038412 Ga0207644_100384122 301
115 3300025934 Ga0207686_10040837 Ga0207686_100408372 301
116 3300025944 Ga0207661_10140387 Ga0207661_101403872 301
117 3300026116 Ga0207674_10243979 Ga0207674_102439792 301
118 3300028563 Ga0265319_1001131 Ga0265319_10011317 301
119 3300028573 Ga0265334_10011458 Ga0265334_100114584 301
120 3300028577 Ga0265318_10004002 Ga0265318_100040024 301
121 3300028654 Ga0265322_10049743 Ga0265322_100497432 301
122 3300028654 Ga0265322_10050975 Ga0265322_100509752 301
123 3300028800 Ga0265338_10022691 Ga0265338_100226915 301
124 3300031240 Ga0265320_10003022 Ga0265320_100030222 301
125 3300031251 Ga0265327_10006570 Ga0265327_100065709 301
126 3300031711 Ga0265314_10023325 Ga0265314_100233255 301
127 3300031712 Ga0265342_10006365 Ga0265342_1000636510 301
128 3300031911 Ga0307412_10180262 Ga0307412_101802622 301
129 3300044694 Ga0466963_0003176 Ga0466963_0003176_2758_3663 301
130 3300044694 Ga0466963_0014512 Ga0466963_0014512_2799_3704 301
131 3300044694 Ga0466963_0085426 Ga0466963_0085426_636_1541 301
132 3300044706 Ga0466964_0117264 Ga0466964_0117264_35_940 301
133 3300044842 Ga0466957_0010377 Ga0466957_0010377_505_1410 301
134 3300045051 Ga0451576_0348573 Ga0451576_0348573_173_1090 301
135 3300045836 Ga0466958_0003504 Ga0466958_0003504_3302_4207 301
136 3300045836 Ga0466958_0010935 Ga0466958_0010935_3763_4668 301
137 3300045976 Ga0466967_0002179 Ga0466967_0002179_8003_8908 301
138 3300045976 Ga0466967_0023852 Ga0466967_0023852_3007_3912 301
139 3300045976 Ga0466967_0121234 Ga0466967_0121234_61_966 301
140 3300045976 Ga0466967_0150975 Ga0466967_0150975_923_1828 301
141 3300045976 Ga0466967_0232717 Ga0466967_0232717_235_1143 301
142 3300046461 Ga0495641_0078132 Ga0495641_0078132_159_1076 301
143 3300046477 Ga0495664_0138837 Ga0495664_0138837_376_1293 301
144 3300046514 Ga0495618_0009767 Ga0495618_0009767_711_1628 301
145 3300046516 Ga0495628_0033165 Ga0495628_0033165_1302_2219 301
146 3300046529 Ga0495652_0035940 Ga0495652_0035940_2445_3362 301
147 3300046529 Ga0495652_0154016 Ga0495652_0154016_231_1148 301
148 3300046543 Ga0495645_0050570 Ga0495645_0050570_551_1468 301
149 3300046543 Ga0495645_0148925 Ga0495645_0148925_514_1431 301
150 3300046559 Ga0495667_0024061 Ga0495667_0024061_1712_2629 301
151 3300046642 Ga0495634_0112346 Ga0495634_0112346_208_1125 301
152 3300046642 Ga0495634_0141250 Ga0495634_0141250_474_1391 301
153 3300046689 Ga0495613_0081962 Ga0495613_0081962_35_952 301
154 3300047319 Ga0495674_0000162 Ga0495674_0000162_12491_13408 301
155 3300047322 Ga0495680_0000826 Ga0495680_0000826_12238_13155 301
156 3300048904 Ga0496101_0033475 Ga0496101_0033475_63_980 301
157 3300048905 Ga0496102_0022596 Ga0496102_0022596_2246_3163 301
158 3300048905 Ga0496102_0039505 Ga0496102_0039505_3317_4234 301
159 3300048910 Ga0496107_0018843 Ga0496107_0018843_149_1066 301
160 3300048915 Ga0496112_0004991 Ga0496112_0004991_4876_5793 301
161 3300048915 Ga0496112_0312946 Ga0496112_0312946_367_1284 301
162 3300048917 Ga0496114_0011934 Ga0496114_0011934_1092_2009 301
163 3300049583 Ga0501067_0025059 Ga0501067_0025059_1338_2246 301
164 3300049585 Ga0501069_0023520 Ga0501069_0023520_483_1388 301
165 3300049586 Ga0501070_0002523 Ga0501070_0002523_3213_4136 301
166 3300053083 Ga0495655_0004007 Ga0495655_0004007_601_1518 301
167 3300053085 Ga0495619_0131637 Ga0495619_0131637_415_1332 301
168 3300005458 Ga0070681_10083082 Ga0070681_100830822 302
169 3300005471 Ga0070698_100054404 Ga0070698_1000544043 302
170 3300028563 Ga0265319_1003410 Ga0265319_10034108 302
171 3300028573 Ga0265334_10000679 Ga0265334_100006798 302
172 3300028577 Ga0265318_10001661 Ga0265318_1000166110 302
173 3300028654 Ga0265322_10033886 Ga0265322_100338862 302
174 3300028800 Ga0265338_10001443 Ga0265338_1000144335 302
175 3300028800 Ga0265338_10005145 Ga0265338_1000514514 302
176 3300028800 Ga0265338_10050007 Ga0265338_100500073 302
177 3300028800 Ga0265338_10099524 Ga0265338_100995242 302
178 3300028800 Ga0265338_10152641 Ga0265338_101526412 302
179 3300029957 Ga0265324_10044733 Ga0265324_100447332 302
180 3300031235 Ga0265330_10003515 Ga0265330_100035152 302
181 3300031239 Ga0265328_10003815 Ga0265328_100038157 302
182 3300031242 Ga0265329_10005179 Ga0265329_100051796 302
183 3300031247 Ga0265340_10003437 Ga0265340_100034377 302
184 3300031247 Ga0265340_10014292 Ga0265340_100142922 302
185 3300031249 Ga0265339_10004787 Ga0265339_100047877 302
186 3300031250 Ga0265331_10003344 Ga0265331_100033443 302
187 3300031251 Ga0265327_10039339 Ga0265327_100393392 302
188 3300031251 Ga0265327_10119645 Ga0265327_101196451 302
189 3300031344 Ga0265316_10027796 Ga0265316_100277963 302
190 3300031595 Ga0265313_10029730 Ga0265313_100297302 302
191 3300031711 Ga0265314_10009587 Ga0265314_100095877 302
192 3300031711 Ga0265314_10022143 Ga0265314_100221436 302
193 3300031712 Ga0265342_10004174 Ga0265342_100041746 302
194 3300037466 Ga0395898_0243636 Ga0395898_0243636_29_949 302
195 3300038443 Ga0395901_0016341 Ga0395901_0016341_1558_2478 302
196 3300046459 Ga0495629_0046364 Ga0495629_0046364_1203_2117 302
197 3300046462 Ga0495651_0348685 Ga0495651_0348685_10_930 302
198 3300046463 Ga0495653_0108674 Ga0495653_0108674_263_1177 302
199 3300046511 Ga0495608_0087743 Ga0495608_0087743_792_1712 302
200 3300046559 Ga0495667_0100437 Ga0495667_0100437_378_1292 302
201 3300046663 Ga0495635_0066024 Ga0495635_0066024_431_1351 302
202 3300046663 Ga0495635_0114344 Ga0495635_0114344_870_1784 302
203 3300046675 Ga0495657_0025782 Ga0495657_0025782_3152_4072 302
204 3300046689 Ga0495613_0021563 Ga0495613_0021563_946_1866 302
205 3300047317 Ga0495604_0063806 Ga0495604_0063806_358_1278 302
206 3300047319 Ga0495674_0109583 Ga0495674_0109583_515_1435 302
207 3300047322 Ga0495680_0017408 Ga0495680_0017408_1460_2380 302
208 3300047471 Ga0495684_0056129 Ga0495684_0056129_1821_2741 302
209 3300048911 Ga0496108_0077399 Ga0496108_0077399_1149_2063 302
210 3300048912 Ga0496109_0078851 Ga0496109_0078851_442_1356 302
211 3300048913 Ga0496110_0008761 Ga0496110_0008761_676_1590 302
212 3300048914 Ga0496111_0057752 Ga0496111_0057752_1020_1934 302
213 3300048916 Ga0496113_0258565 Ga0496113_0258565_454_1368 302
214 3300048917 Ga0496114_0241999 Ga0496114_0241999_347_1273 302
215 3300053084 Ga0495595_0025295 Ga0495595_0025295_1039_1959 302
216 3300053085 Ga0495619_0060309 Ga0495619_0060309_872_1786 302
217 3300053085 Ga0495619_0060840 Ga0495619_0060840_954_1874 302
218 3300005327 Ga0070658_10044421 Ga0070658_100444213 303
219 3300005339 Ga0070660_100064856 Ga0070660_1000648562 303
220 3300005435 Ga0070714_100010104 Ga0070714_1000101047 303
221 3300005444 Ga0070694_100243977 Ga0070694_1002439771 303
222 3300005563 Ga0068855_100108747 Ga0068855_1001087472 303
223 3300005563 Ga0068855_100525891 Ga0068855_1005258912 303
224 3300013105 Ga0157369_10020388 Ga0157369_100203886 303
225 3300020070 Ga0206356_11755113 Ga0206356_117551133 303
226 3300025909 Ga0207705_10042503 Ga0207705_100425033 303
227 3300025912 Ga0207707_10077768 Ga0207707_100777682 303
228 3300025919 Ga0207657_10077553 Ga0207657_100775533 303
229 3300025919 Ga0207657_10104888 Ga0207657_101048882 303
230 3300025920 Ga0207649_10209945 Ga0207649_102099452 303
231 3300025929 Ga0207664_10011740 Ga0207664_100117407 303
232 3300025949 Ga0207667_10323230 Ga0207667_103232302 303
233 3300031251 Ga0265327_10066625 Ga0265327_100666252 303
234 3300031712 Ga0265342_10091957 Ga0265342_100919572 303
235 3300037418 Ga0395900_0341245 Ga0395900_0341245_198_1112 303
236 3300037466 Ga0395898_0072759 Ga0395898_0072759_462_1376 303
237 3300045976 Ga0466967_0184147 Ga0466967_0184147_741_1655 303
238 3300045976 Ga0466967_0206047 Ga0466967_0206047_148_1071 303
239 3300047319 Ga0495674_0196528 Ga0495674_0196528_201_1130 303
240 3300049588 Ga0501072_0004748 Ga0501072_0004748_6158_7075 303
241 3300049590 Ga0501074_0017539 Ga0501074_0017539_748_1665 303
242 3300049741 Ga0501079_0016409 Ga0501079_0016409_2011_2928 303
243 3300049744 Ga0501083_0001948 Ga0501083_0001948_9950_10867 303
244 3300054114 Ga0501084_0041784 Ga0501084_0041784_1072_1989 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02558

ApbA

Ketopantoate reductase PanE/ApbA

8

153

0.95

PF08546

ApbA_C

Ketopantoate reductase PanE/ApbA C terminal

178

305

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f7l-assembly1.cif.gz_A crystal structure of lkce r326q mutant in complex with its substrate 0.9162 3 35
3hwr-assembly1.cif.gz_B crystal structure of pane/apba family ketopantoate reductase (yp_299159.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.9119 5 302
5ayv-assembly1.cif.gz_A crystal structure of archaeal ketopantoate reductase complexed with coenzyme a and 2-oxopantoate 0.9092 6 302
5hws-assembly1.cif.gz_D crystal structure of ketopantoate reductase from thermococcus kodakarensis complexed with nadp+ 0.9039 6 300
5x20-assembly1.cif.gz_B the ternary structure of d-mandelate dehydrogenase with nadh and anilino(oxo)acetate 0.9015 5 302
ID Description Score Start End Superfamily
af_Q54LH3_697_827_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.912 179 300 1.10.1040.10
2ofpB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9033 176 299 1.10.1040.10
3egoB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8994 4 162 3.40.50.720
5hwsD02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.8971 176 299 1.10.1040.10
5hwsD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8953 6 173 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W1KVW0-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9773 46 302 GO:0005737
GO:0008677
GO:0015940
AF-A0A1Q3VXL7-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9767 59 302 GO:0005737
GO:0008677
GO:0015940
AF-A0A538F1V7-F1-model_v4 2-dehydropantoate 2-reductase 0.9741 3 303 GO:0005737
GO:0008677
GO:0015940
AF-A0A2V9WCW6-F1-model_v4 2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase) 0.9657 4 295 GO:0005737
GO:0008677
GO:0015940
AF-A0A538F1V7-F1-model_v4 2-dehydropantoate 2-reductase 0.9646 3 303 GO:0005737
GO:0008677
GO:0015940

Feature Viewer

pLDDT pTM Quality
93.97 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map