F356286

General Info

Members Datasets Scaffolds Average Seq Length
244 136 244 294

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10079962|Ga0070681_100799622
Length 325
Sequence VNGRPSTLRARCTQDHFHRIHKTRHGLVQNEKTLVGKLPASSPELVIITGLSGSGKGTVLKAFEDLGFHAVDNMPIALVPKFADLAHDSKSARRSALVIDIREGESLKEFPAMYRKLRRTINARLLFLDTADDVLQRRFSETRRPHPLGVETPVMRSISEERALLAPIQALADVTIDSSKLNVHELRGLIFQQFRSGDEEGKILIQVNSFGFRHGVPPDSDLVFDVRFLPNPNYIPEFKKLSGRHPSVARYIRSFPQTMEFINKISDLLIYLIPHYIREGKSYLTISFGCTGGHHRSVLIASEIRKRLANAGFQVKETHRDINKS

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.82
Rhizosphere 83.2
Stem 0
Stem Tuber 0
Unclassified 15.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10165611 3300004799 Bacteria 5071
2 Ga0070658_10009002 3300005327 Bacteria 8027
3 Ga0070683_100002622 3300005329 Bacteria 14376
4 Ga0070683_100181876 3300005329 Bacteria 1996
5 Ga0070670_100198001 3300005331 Bacteria 1745
6 Ga0070680_100178985 3300005336 Unclassified 1786
7 Ga0070660_100424497 3300005339 Bacteria 1101
8 Ga0070661_100096849 3300005344 Unclassified 2190
9 Ga0070671_100106192 3300005355 Unclassified 2357
10 Ga0070667_100145251 3300005367 Bacteria 2080
11 Ga0070711_100062543 3300005439 Bacteria 2595
12 Ga0070678_100452789 3300005456 Bacteria 1124
13 Ga0070681_10009447 3300005458 Bacteria 9598
14 Ga0070681_10074047 3300005458 Bacteria 3367
15 Ga0070681_10079962 3300005458 Unclassified 3225
16 Ga0070679_100063059 3300005530 Bacteria 3695
17 Ga0070679_100626447 3300005530 Bacteria 1019
18 Ga0068853_100005103 3300005539 Archaea 10255
19 Ga0068853_100039927 3300005539 Bacteria 4003
20 Ga0070665_100056503 3300005548 Bacteria 3935
21 Ga0068855_100034773 3300005563 Bacteria 6006
22 Ga0068855_100150916 3300005563 Bacteria 2642
23 Ga0068855_100299296 3300005563 Unclassified 1782
24 Ga0068855_100324991 3300005563 Unclassified 1699
25 Ga0070664_100152444 3300005564 Bacteria 2041
26 Ga0068857_100029034 3300005577 Bacteria 4880
27 Ga0068857_100521890 3300005577 Bacteria 1116
28 Ga0068856_100016973 3300005614 Bacteria 7057
29 Ga0068856_100079947 3300005614 Bacteria 3242
30 Ga0068856_100549008 3300005614 Bacteria 1176
31 Ga0068852_100170447 3300005616 Unclassified 2040
32 Ga0068863_100021974 3300005841 Bacteria 6089
33 Ga0070717_10038440 3300006028 Bacteria 3890
34 Ga0070717_10276586 3300006028 Bacteria 1488
35 Ga0097621_100120344 3300006237 Bacteria 2226
36 Ga0068871_100124958 3300006358 Bacteria 2177
37 Ga0075436_100080566 3300006914 Bacteria 2256
38 Ga0105240_10005328 3300009093 Bacteria 19189
39 Ga0105240_10012705 3300009093 Bacteria 11607
40 Ga0105240_10097502 3300009093 Bacteria 3582
41 Ga0105240_10703138 3300009093 Bacteria 1103
42 Ga0105241_10245153 3300009174 Bacteria 1516
43 Ga0105242_10037906 3300009176 Bacteria 3874
44 Ga0105248_10064161 3300009177 Bacteria 4123
45 Ga0105248_10133825 3300009177 Bacteria 2797
46 Ga0105248_10137980 3300009177 Bacteria 2751
47 Ga0105237_10002784 3300009545 Bacteria 21245
48 Ga0105237_10389062 3300009545 Bacteria 1399
49 Ga0105238_10020815 3300009551 Bacteria 6681
50 Ga0105238_10084151 3300009551 Unclassified 3170
51 Ga0105239_10096020 3300010375 Unclassified 3275
52 Ga0105239_10374236 3300010375 Bacteria 1610
53 Ga0157373_10023382 3300013100 Unclassified 4481
54 Ga0157371_10013037 3300013102 Bacteria 6330
55 Ga0157370_10067370 3300013104 Bacteria 3384
56 Ga0157370_10089282 3300013104 Bacteria 2895
57 Ga0157370_10110761 3300013104 Unclassified 2566
58 Ga0157370_10163177 3300013104 Bacteria 2073
59 Ga0157370_10399976 3300013104 Bacteria 1264
60 Ga0157369_10009582 3300013105 Bacteria 11075
61 Ga0157369_10332467 3300013105 Unclassified 1579
62 Ga0157369_10448319 3300013105 Bacteria 1336
63 Ga0157374_10015640 3300013296 Bacteria 6661
64 Ga0157378_10096676 3300013297 Bacteria 2691
65 Ga0157378_10517344 3300013297 Unclassified 1194
66 Ga0157378_10557928 3300013297 Bacteria 1152
67 Ga0163162_10016229 3300013306 Bacteria 7284
68 Ga0157372_10104384 3300013307 Unclassified 3240
69 Ga0157372_10257201 3300013307 Bacteria 2027
70 Ga0157372_10290532 3300013307 Bacteria 1901
71 Ga0157372_10473872 3300013307 Bacteria 1459
72 Ga0163163_10033174 3300014325 Bacteria 4993
73 Ga0163163_10053667 3300014325 Bacteria 3980
74 Ga0157379_10044330 3300014968 Bacteria 3971
75 Ga0157376_10436421 3300014969 Bacteria 1274
76 Ga0213874_10056509 3300021377 Bacteria 1218
77 Ga0213876_10014637 3300021384 Bacteria 4155
78 Ga0213876_10028506 3300021384 Unclassified 2945
79 Ga0213876_10056102 3300021384 Unclassified 2079
80 Ga0213876_10076455 3300021384 Unclassified 1768
81 Ga0213876_10177704 3300021384 Unclassified 1132
82 Ga0213875_10000005 3300021388 Bacteria 595146
83 Ga0213875_10001880 3300021388 Bacteria 13025
84 Ga0213875_10012939 3300021388 Unclassified 4109
85 Ga0213875_10022291 3300021388 Bacteria 3030
86 Ga0213875_10023892 3300021388 Bacteria 2917
87 Ga0213875_10026071 3300021388 Unclassified 2783
88 Ga0207647_10111745 3300025904 Bacteria 1615
89 Ga0207699_10230696 3300025906 Bacteria 1268
90 Ga0207705_10142154 3300025909 Bacteria 1793
91 Ga0207707_10010902 3300025912 Bacteria 7903
92 Ga0207707_10022981 3300025912 Bacteria 5453
93 Ga0207695_10020891 3300025913 Bacteria 7482
94 Ga0207695_10096932 3300025913 Bacteria 2950
95 Ga0207695_10105265 3300025913 Bacteria 2809
96 Ga0207695_10118412 3300025913 Unclassified 2620
97 Ga0207695_10193952 3300025913 Bacteria 1948
98 Ga0207671_10048541 3300025914 Bacteria 3142
99 Ga0207671_10067718 3300025914 Bacteria 2659
100 Ga0207663_10105249 3300025916 Bacteria 1904
101 Ga0207663_10175553 3300025916 Bacteria 1526
102 Ga0207660_10257306 3300025917 Bacteria 1379
103 Ga0207660_10362541 3300025917 Bacteria 1163
104 Ga0207660_10371608 3300025917 Unclassified 1148
105 Ga0207657_10350739 3300025919 Bacteria 1164
106 Ga0207652_10055942 3300025921 Bacteria 3395
107 Ga0207652_10079466 3300025921 Bacteria 2865
108 Ga0207652_10109722 3300025921 Unclassified 2447
109 Ga0207650_10245853 3300025925 Bacteria 1447
110 Ga0207687_10353650 3300025927 Unclassified 1197
111 Ga0207644_10190272 3300025931 Bacteria 1613
112 Ga0207690_10092049 3300025932 Bacteria 2145
113 Ga0207661_10290369 3300025944 Bacteria 1464
114 Ga0207661_10503131 3300025944 Unclassified 1107
115 Ga0207667_10109719 3300025949 Bacteria 2846
116 Ga0207667_10144751 3300025949 Unclassified 2447
117 Ga0207667_10350756 3300025949 Unclassified 1505
118 Ga0207658_10181853 3300025986 Bacteria 1741
119 Ga0207639_10005383 3300026041 Bacteria 8654
120 Ga0207639_10035937 3300026041 Bacteria 3669
121 Ga0207702_10063050 3300026078 Unclassified 3169
122 Ga0207702_10108646 3300026078 Unclassified 2462
123 Ga0207702_10168071 3300026078 Bacteria 2008
124 Ga0207702_10170463 3300026078 Unclassified 1995
125 Ga0207674_10013995 3300026116 Bacteria 8868
126 Ga0207683_10190090 3300026121 Bacteria 1864
127 Ga0207698_10314224 3300026142 Unclassified 1464
128 Ga0268266_10023283 3300028379 Bacteria 5274
129 Ga0268266_10043831 3300028379 Bacteria 3824
130 Ga0268266_10445644 3300028379 Unclassified 1230
131 Ga0265338_10083050 3300028800 Bacteria 2681
132 Ga0265338_10184426 3300028800 Bacteria 1588
133 Ga0265762_1003736 3300030760 Bacteria 2722
134 Ga0265325_10027126 3300031241 Bacteria 3098
135 Ga0265340_10035648 3300031247 Bacteria 2470
136 Ga0265314_10003447 3300031711 Bacteria 15289
137 Ga0316576_10131492 3300031727 Bacteria 1883
138 Ga0373934_0012342 3300035086 Bacteria 3225
139 Ga0373954_0004929 3300035118 Bacteria 5764
140 Ga0373954_0019973 3300035118 Bacteria 3025
141 Ga0373943_0005433 3300035170 Bacteria 5732
142 Ga0373955_0095848 3300035172 Unclassified 1697
143 Ga0316574_0110331 3300035398 Bacteria 1763
144 Ga0316574_0185318 3300035398 Bacteria 1339
145 Ga0316574_0202973 3300035398 Bacteria 1273
146 Ga0373935_0069851 3300035692 Bacteria 2263
147 Ga0373927_0003848 3300035695 Bacteria 10664
148 Ga0373927_0010010 3300035695 Bacteria 6351
149 Ga0373933_0027636 3300035724 Bacteria 3269
150 Ga0373947_0005999 3300035725 Bacteria 7082
151 Ga0373947_0060727 3300035725 Bacteria 2296
152 Ga0373947_0099426 3300035725 Bacteria 1826
153 Ga0373937_0026212 3300036401 Bacteria 5267
154 Ga0373937_0032215 3300036401 Bacteria 4754
155 Ga0373937_0333500 3300036401 Unclassified 1436
156 Ga0316584_0165634 3300036712 Bacteria 1642
157 Ga0373925_0025564 3300037068 Bacteria 4315
158 Ga0373925_0062967 3300037068 Bacteria 2790
159 Ga0395898_0034326 3300037466 Bacteria 5057
160 Ga0436364_0059099 3300037853 Bacteria 8032
161 Ga0436364_0092190 3300037853 Bacteria 7063
162 Ga0436364_0157811 3300037853 Bacteria 430293
163 Ga0436364_0257521 3300037853 Bacteria 1529
164 Ga0436364_0586215 3300037853 Bacteria 68755
165 Ga0436364_1055827 3300037853 Bacteria 5937
166 Ga0436364_1120059 3300037853 Bacteria 4631
167 Ga0436364_1278270 3300037853 Bacteria 10113
168 Ga0436364_1325833 3300037853 Unclassified 3616
169 Ga0436364_1345932 3300037853 Bacteria 5440
170 Ga0436364_1395566 3300037853 Unclassified 2952
171 Ga0436364_1403972 3300037853 Bacteria 3252
172 Ga0436364_1463956 3300037853 Bacteria 14231
173 Ga0400483_014874 3300039062 Bacteria 14731
174 Ga0400483_091867 3300039062 Bacteria 1167
175 Ga0400483_281451 3300039062 Bacteria 1393
176 Ga0436365_0412184 3300039437 Bacteria 1710
177 Ga0436365_0596914 3300039437 Bacteria 2843
178 Ga0436365_0617682 3300039437 Bacteria 10340
179 Ga0436365_0782129 3300039437 Bacteria 3888
180 Ga0436365_0879627 3300039437 Unclassified 2105
181 Ga0436365_1105269 3300039437 Bacteria 7072
182 Ga0436365_1383985 3300039437 Bacteria 5145
183 Ga0436360_0318029 3300039438 Bacteria 5276
184 Ga0436360_1374380 3300039438 Bacteria 2503
185 Ga0436361_0233351 3300039447 Bacteria 63019
186 Ga0436361_0540008 3300039447 Bacteria 1017
187 Ga0436361_0551875 3300039447 Bacteria 4174
188 Ga0436363_0618120 3300039450 Bacteria 12910
189 Ga0436363_0896592 3300039450 Bacteria 1051
190 Ga0436363_1203601 3300039450 Bacteria 5897
191 Ga0436362_0081568 3300039453 Unclassified 1493
192 Ga0436362_0290787 3300039453 Bacteria 4014
193 Ga0436362_0443492 3300039453 Bacteria 4116
194 Ga0451837_0189242 3300041494 Bacteria 1544
195 Ga0451577_0699711 3300042876 Bacteria 918
196 Ga0466958_0109866 3300045836 Bacteria 1721
197 Ga0495580_0001036 3300046472 Bacteria 24398
198 Ga0495580_0031280 3300046472 Bacteria 3847
199 Ga0495665_0127332 3300046531 Bacteria 1333
200 Ga0495667_0082352 3300046559 Unclassified 2091
201 Ga0495674_0305280 3300047319 Bacteria 1299
202 Ga0495684_0011797 3300047471 Bacteria 6743
203 Ga0496112_0017790 3300048915 Bacteria 6688
204 Ga0496115_0057124 3300048918 Unclassified 3138
205 Ga0501031_0002363 3300049568 Bacteria 11968
206 Ga0501032_0000924 3300049569 Bacteria 23743
207 Ga0501033_0023940 3300049570 Bacteria 4606
208 Ga0501034_0003470 3300049571 Bacteria 17926
209 Ga0501034_0032622 3300049571 Bacteria 5288
210 Ga0501036_0000610 3300049572 Bacteria 25955
211 Ga0501036_0221218 3300049572 Unclassified 1590
212 Ga0501037_0005839 3300049573 Bacteria 8992
213 Ga0501038_0000375 3300049574 Bacteria 38556
214 Ga0501039_0022634 3300049575 Bacteria 4823
215 Ga0501043_0003097 3300049579 Bacteria 13789
216 Ga0501046_0012710 3300049580 Bacteria 7160
217 Ga0501047_0010018 3300049581 Bacteria 8959
218 Ga0501047_0175320 3300049581 Bacteria 2011
219 Ga0501047_0300215 3300049581 Unclassified 1449
220 Ga0501048_0010326 3300049582 Bacteria 6981
221 Ga0501067_0001762 3300049583 Bacteria 11890
222 Ga0501068_0000105 3300049584 Bacteria 36022
223 Ga0501069_0004725 3300049585 Bacteria 7044
224 Ga0501069_0178096 3300049585 Bacteria 1228
225 Ga0501070_0068246 3300049586 Bacteria 2943
226 Ga0501070_0112774 3300049586 Bacteria 2247
227 Ga0501072_0000213 3300049588 Bacteria 42312
228 Ga0501073_0000234 3300049589 Bacteria 36616
229 Ga0501074_0001286 3300049590 Bacteria 16633
230 Ga0501076_0010228 3300049592 Bacteria 6954
231 Ga0501077_0029701 3300049593 Bacteria 3476
232 Ga0501079_0001242 3300049741 Bacteria 17870
233 Ga0501080_0001031 3300049742 Bacteria 22932
234 Ga0501083_0003424 3300049744 Bacteria 11082
235 Ga0501035_0008139 3300049822 Bacteria 9771
236 Ga0501035_0019576 3300049822 Bacteria 6218
237 Ga0501044_0003198 3300049823 Bacteria 18467
238 Ga0501044_0024658 3300049823 Bacteria 6381
239 Ga0501044_0038437 3300049823 Bacteria 4998
240 Ga0501045_0148474 3300049824 Bacteria 1744
241 Ga0495612_0061323 3300053078 Bacteria 1558
242 Ga0495619_0282217 3300053085 Bacteria 1151
243 Ga0501084_0000365 3300054114 Bacteria 34541
244 Ga0501082_0001460 3300060353 Bacteria 20771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049585 Ga0501069_0178096 Ga0501069_0178096_231_1082 261
2 3300039062 Ga0400483_091867 Ga0400483_091867_216_1025 263
3 3300005539 Ga0068853_100005103 Ga0068853_1000051034 269
4 3300026041 Ga0207639_10005383 Ga0207639_100053833 269
5 3300039447 Ga0436361_0540008 Ga0436361_0540008_56_874 272
6 3300005344 Ga0070661_100096849 Ga0070661_1000968493 275
7 3300005539 Ga0068853_100039927 Ga0068853_1000399273 275
8 3300005563 Ga0068855_100034773 Ga0068855_1000347734 275
9 3300005563 Ga0068855_100299296 Ga0068855_1002992962 275
10 3300005614 Ga0068856_100016973 Ga0068856_1000169737 275
11 3300025904 Ga0207647_10111745 Ga0207647_101117452 275
12 3300026142 Ga0207698_10314224 Ga0207698_103142242 275
13 3300037853 Ga0436364_1120059 Ga0436364_1120059_30_857 275
14 3300021384 Ga0213876_10177704 Ga0213876_101777041 276
15 3300039437 Ga0436365_1383985 Ga0436365_1383985_2352_3254 276
16 3300039453 Ga0436362_0290787 Ga0436362_0290787_1985_2887 276
17 3300046559 Ga0495667_0082352 Ga0495667_0082352_466_1314 276
18 3300013307 Ga0157372_10473872 Ga0157372_104738723 277
19 3300013297 Ga0157378_10557928 Ga0157378_105579281 278
20 3300031727 Ga0316576_10131492 Ga0316576_101314922 278
21 3300041494 Ga0451837_0189242 Ga0451837_0189242_335_1183 279
22 3300009551 Ga0105238_10020815 Ga0105238_100208156 280
23 3300039062 Ga0400483_014874 Ga0400483_014874_13419_14279 280
24 3300039062 Ga0400483_281451 Ga0400483_281451_110_970 280
25 3300005841 Ga0068863_100021974 Ga0068863_1000219743 281
26 3300013297 Ga0157378_10096676 Ga0157378_100966763 281
27 3300021388 Ga0213875_10001880 Ga0213875_100018803 281
28 3300035398 Ga0316574_0202973 Ga0316574_0202973_334_1182 281
29 3300036712 Ga0316584_0165634 Ga0316584_0165634_772_1620 281
30 3300037853 Ga0436364_1463956 Ga0436364_1463956_2744_3688 281
31 3300042876 Ga0451577_0699711 Ga0451577_0699711_50_895 281
32 3300035398 Ga0316574_0110331 Ga0316574_0110331_765_1619 282
33 3300035398 Ga0316574_0185318 Ga0316574_0185318_66_923 282
34 3300049568 Ga0501031_0002363 Ga0501031_0002363_10136_11065 282
35 3300049569 Ga0501032_0000924 Ga0501032_0000924_6488_7417 282
36 3300049570 Ga0501033_0023940 Ga0501033_0023940_1558_2487 282
37 3300049571 Ga0501034_0003470 Ga0501034_0003470_1063_1992 282
38 3300049572 Ga0501036_0000610 Ga0501036_0000610_18089_19018 282
39 3300049573 Ga0501037_0005839 Ga0501037_0005839_3378_4307 282
40 3300049574 Ga0501038_0000375 Ga0501038_0000375_29853_30782 282
41 3300049575 Ga0501039_0022634 Ga0501039_0022634_2776_3705 282
42 3300049579 Ga0501043_0003097 Ga0501043_0003097_12128_13057 282
43 3300049580 Ga0501046_0012710 Ga0501046_0012710_5518_6447 282
44 3300049581 Ga0501047_0175320 Ga0501047_0175320_882_1811 282
45 3300049582 Ga0501048_0010326 Ga0501048_0010326_5303_6232 282
46 3300049583 Ga0501067_0001762 Ga0501067_0001762_882_1811 282
47 3300049584 Ga0501068_0000105 Ga0501068_0000105_12088_13017 282
48 3300049585 Ga0501069_0004725 Ga0501069_0004725_2055_2984 282
49 3300049586 Ga0501070_0068246 Ga0501070_0068246_329_1258 282
50 3300049588 Ga0501072_0000213 Ga0501072_0000213_14783_15712 282
51 3300049589 Ga0501073_0000234 Ga0501073_0000234_29853_30782 282
52 3300049590 Ga0501074_0001286 Ga0501074_0001286_9386_10315 282
53 3300049592 Ga0501076_0010228 Ga0501076_0010228_3135_4064 282
54 3300049593 Ga0501077_0029701 Ga0501077_0029701_848_1777 282
55 3300049741 Ga0501079_0001242 Ga0501079_0001242_4814_5743 282
56 3300049742 Ga0501080_0001031 Ga0501080_0001031_21122_22051 282
57 3300049744 Ga0501083_0003424 Ga0501083_0003424_9230_10159 282
58 3300049822 Ga0501035_0019576 Ga0501035_0019576_3732_4661 282
59 3300049823 Ga0501044_0003198 Ga0501044_0003198_839_1768 282
60 3300054114 Ga0501084_0000365 Ga0501084_0000365_10282_11211 282
61 3300060353 Ga0501082_0001460 Ga0501082_0001460_18907_19836 282
62 3300036401 Ga0373937_0333500 Ga0373937_0333500_270_1133 284
63 3300005331 Ga0070670_100198001 Ga0070670_1001980012 285
64 3300009177 Ga0105248_10133825 Ga0105248_101338253 285
65 3300025925 Ga0207650_10245853 Ga0207650_102458532 285
66 3300005456 Ga0070678_100452789 Ga0070678_1004527891 286
67 3300006237 Ga0097621_100120344 Ga0097621_1001203442 286
68 3300006358 Ga0068871_100124958 Ga0068871_1001249583 286
69 3300021384 Ga0213876_10028506 Ga0213876_100285064 286
70 3300026121 Ga0207683_10190090 Ga0207683_101900902 286
71 3300049571 Ga0501034_0032622 Ga0501034_0032622_263_1132 286
72 3300049572 Ga0501036_0221218 Ga0501036_0221218_169_1038 286
73 3300049581 Ga0501047_0010018 Ga0501047_0010018_3821_4690 286
74 3300049586 Ga0501070_0112774 Ga0501070_0112774_99_968 286
75 3300049822 Ga0501035_0008139 Ga0501035_0008139_3883_4752 286
76 3300049823 Ga0501044_0024658 Ga0501044_0024658_4172_5041 286
77 3300005439 Ga0070711_100062543 Ga0070711_1000625432 287
78 3300009093 Ga0105240_10012705 Ga0105240_100127059 287
79 3300009177 Ga0105248_10137980 Ga0105248_101379802 287
80 3300009545 Ga0105237_10389062 Ga0105237_103890622 287
81 3300010375 Ga0105239_10096020 Ga0105239_100960203 287
82 3300021388 Ga0213875_10026071 Ga0213875_100260714 287
83 3300025913 Ga0207695_10020891 Ga0207695_100208915 287
84 3300025916 Ga0207663_10105249 Ga0207663_101052492 287
85 3300025927 Ga0207687_10353650 Ga0207687_103536502 287
86 3300035086 Ga0373934_0012342 Ga0373934_0012342_1689_2579 287
87 3300035118 Ga0373954_0019973 Ga0373954_0019973_113_1003 287
88 3300035170 Ga0373943_0005433 Ga0373943_0005433_4699_5580 287
89 3300035172 Ga0373955_0095848 Ga0373955_0095848_763_1653 287
90 3300036401 Ga0373937_0032215 Ga0373937_0032215_116_1009 287
91 3300037853 Ga0436364_1395566 Ga0436364_1395566_1285_2163 287
92 3300053078 Ga0495612_0061323 Ga0495612_0061323_612_1493 287
93 3300053085 Ga0495619_0282217 Ga0495619_0282217_210_1091 287
94 3300005329 Ga0070683_100181876 Ga0070683_1001818762 288
95 3300005458 Ga0070681_10009447 Ga0070681_100094478 288
96 3300005530 Ga0070679_100063059 Ga0070679_1000630592 288
97 3300005563 Ga0068855_100324991 Ga0068855_1003249913 288
98 3300005577 Ga0068857_100029034 Ga0068857_1000290343 288
99 3300005614 Ga0068856_100549008 Ga0068856_1005490081 288
100 3300006028 Ga0070717_10038440 Ga0070717_100384403 288
101 3300009093 Ga0105240_10703138 Ga0105240_107031382 288
102 3300009176 Ga0105242_10037906 Ga0105242_100379064 288
103 3300009177 Ga0105248_10064161 Ga0105248_100641613 288
104 3300009551 Ga0105238_10084151 Ga0105238_100841513 288
105 3300013104 Ga0157370_10110761 Ga0157370_101107613 288
106 3300013105 Ga0157369_10448319 Ga0157369_104483191 288
107 3300013306 Ga0163162_10016229 Ga0163162_100162297 288
108 3300014325 Ga0163163_10053667 Ga0163163_100536673 288
109 3300021388 Ga0213875_10012939 Ga0213875_100129394 288
110 3300025912 Ga0207707_10010902 Ga0207707_100109027 288
111 3300025913 Ga0207695_10096932 Ga0207695_100969323 288
112 3300025913 Ga0207695_10118412 Ga0207695_101184123 288
113 3300025914 Ga0207671_10067718 Ga0207671_100677181 288
114 3300025916 Ga0207663_10175553 Ga0207663_101755532 288
115 3300025917 Ga0207660_10257306 Ga0207660_102573062 288
116 3300025921 Ga0207652_10055942 Ga0207652_100559423 288
117 3300026078 Ga0207702_10108646 Ga0207702_101086462 288
118 3300026116 Ga0207674_10013995 Ga0207674_100139953 288
119 3300031711 Ga0265314_10003447 Ga0265314_100034473 288
120 3300035118 Ga0373954_0004929 Ga0373954_0004929_2389_3276 288
121 3300035692 Ga0373935_0069851 Ga0373935_0069851_1070_1957 288
122 3300035695 Ga0373927_0003848 Ga0373927_0003848_3072_3959 288
123 3300035724 Ga0373933_0027636 Ga0373933_0027636_1774_2661 288
124 3300035725 Ga0373947_0005999 Ga0373947_0005999_4236_5123 288
125 3300035725 Ga0373947_0060727 Ga0373947_0060727_1213_2100 288
126 3300036401 Ga0373937_0026212 Ga0373937_0026212_3961_4848 288
127 3300037068 Ga0373925_0025564 Ga0373925_0025564_1119_2006 288
128 3300037853 Ga0436364_1055827 Ga0436364_1055827_2008_2895 288
129 3300046472 Ga0495580_0001036 Ga0495580_0001036_5377_6264 288
130 3300046531 Ga0495665_0127332 Ga0495665_0127332_261_1148 288
131 3300047319 Ga0495674_0305280 Ga0495674_0305280_321_1208 288
132 3300047471 Ga0495684_0011797 Ga0495684_0011797_3934_4821 288
133 3300006914 Ga0075436_100080566 Ga0075436_1000805662 289
134 3300014325 Ga0163163_10033174 Ga0163163_100331744 289
135 3300028379 Ga0268266_10445644 Ga0268266_104456441 289
136 3300005577 Ga0068857_100521890 Ga0068857_1005218902 290
137 3300009093 Ga0105240_10005328 Ga0105240_100053288 290
138 3300009093 Ga0105240_10097502 Ga0105240_100975023 290
139 3300009545 Ga0105237_10002784 Ga0105237_1000278410 290
140 3300013104 Ga0157370_10089282 Ga0157370_100892824 290
141 3300025913 Ga0207695_10105265 Ga0207695_101052652 290
142 3300025913 Ga0207695_10193952 Ga0207695_101939522 290
143 3300025914 Ga0207671_10048541 Ga0207671_100485412 290
144 3300026078 Ga0207702_10170463 Ga0207702_101704632 290
145 3300028379 Ga0268266_10023283 Ga0268266_100232836 290
146 3300035695 Ga0373927_0010010 Ga0373927_0010010_1959_2870 290
147 3300039437 Ga0436365_1105269 Ga0436365_1105269_3753_4655 290
148 3300039438 Ga0436360_0318029 Ga0436360_0318029_1150_2052 290
149 3300039447 Ga0436361_0233351 Ga0436361_0233351_61594_62496 290
150 3300039447 Ga0436361_0551875 Ga0436361_0551875_393_1295 290
151 3300039450 Ga0436363_0618120 Ga0436363_0618120_5379_6281 290
152 3300045836 Ga0466958_0109866 Ga0466958_0109866_448_1347 290
153 3300005355 Ga0070671_100106192 Ga0070671_1001061923 291
154 3300005530 Ga0070679_100626447 Ga0070679_1006264471 291
155 3300005548 Ga0070665_100056503 Ga0070665_1000565032 291
156 3300005564 Ga0070664_100152444 Ga0070664_1001524443 291
157 3300005614 Ga0068856_100079947 Ga0068856_1000799473 291
158 3300005616 Ga0068852_100170447 Ga0068852_1001704472 291
159 3300009174 Ga0105241_10245153 Ga0105241_102451532 291
160 3300010375 Ga0105239_10374236 Ga0105239_103742362 291
161 3300013100 Ga0157373_10023382 Ga0157373_100233823 291
162 3300013102 Ga0157371_10013037 Ga0157371_100130374 291
163 3300013104 Ga0157370_10163177 Ga0157370_101631772 291
164 3300013104 Ga0157370_10399976 Ga0157370_103999761 291
165 3300013105 Ga0157369_10009582 Ga0157369_100095826 291
166 3300013296 Ga0157374_10015640 Ga0157374_100156404 291
167 3300013297 Ga0157378_10517344 Ga0157378_105173442 291
168 3300013307 Ga0157372_10104384 Ga0157372_101043843 291
169 3300013307 Ga0157372_10290532 Ga0157372_102905322 291
170 3300014969 Ga0157376_10436421 Ga0157376_104364212 291
171 3300025917 Ga0207660_10362541 Ga0207660_103625411 291
172 3300025931 Ga0207644_10190272 Ga0207644_101902722 291
173 3300025932 Ga0207690_10092049 Ga0207690_100920492 291
174 3300026041 Ga0207639_10035937 Ga0207639_100359373 291
175 3300026078 Ga0207702_10063050 Ga0207702_100630503 291
176 3300026078 Ga0207702_10168071 Ga0207702_101680712 291
177 3300028379 Ga0268266_10043831 Ga0268266_100438312 291
178 3300030760 Ga0265762_1003736 Ga0265762_10037362 291
179 3300035725 Ga0373947_0099426 Ga0373947_0099426_197_1096 291
180 3300037068 Ga0373925_0062967 Ga0373925_0062967_481_1380 291
181 3300039437 Ga0436365_0412184 Ga0436365_0412184_649_1560 291
182 3300046472 Ga0495580_0031280 Ga0495580_0031280_1339_2238 291
183 3300048915 Ga0496112_0017790 Ga0496112_0017790_1858_2757 291
184 3300048918 Ga0496115_0057124 Ga0496115_0057124_1384_2286 291
185 3300049823 Ga0501044_0038437 Ga0501044_0038437_1144_2061 291
186 3300005329 Ga0070683_100002622 Ga0070683_10000262213 292
187 3300005367 Ga0070667_100145251 Ga0070667_1001452512 292
188 3300006028 Ga0070717_10276586 Ga0070717_102765862 292
189 3300014968 Ga0157379_10044330 Ga0157379_100443303 292
190 3300021384 Ga0213876_10056102 Ga0213876_100561023 292
191 3300025949 Ga0207667_10350756 Ga0207667_103507562 292
192 3300025986 Ga0207658_10181853 Ga0207658_101818532 292
193 3300028800 Ga0265338_10184426 Ga0265338_101844262 292
194 3300037853 Ga0436364_1325833 Ga0436364_1325833_750_1658 292
195 3300037853 Ga0436364_1345932 Ga0436364_1345932_3499_4404 292
196 3300039437 Ga0436365_0782129 Ga0436365_0782129_1572_2480 292
197 3300005336 Ga0070680_100178985 Ga0070680_1001789852 293
198 3300005458 Ga0070681_10079962 Ga0070681_100799622 293
199 3300013104 Ga0157370_10067370 Ga0157370_100673702 293
200 3300013105 Ga0157369_10332467 Ga0157369_103324672 293
201 3300021377 Ga0213874_10056509 Ga0213874_100565091 293
202 3300021384 Ga0213876_10014637 Ga0213876_100146373 293
203 3300021384 Ga0213876_10076455 Ga0213876_100764552 293
204 3300021388 Ga0213875_10000005 Ga0213875_10000005260 293
205 3300021388 Ga0213875_10022291 Ga0213875_100222913 293
206 3300021388 Ga0213875_10023892 Ga0213875_100238923 293
207 3300025917 Ga0207660_10371608 Ga0207660_103716081 293
208 3300025921 Ga0207652_10109722 Ga0207652_101097222 293
209 3300025944 Ga0207661_10290369 Ga0207661_102903692 293
210 3300025944 Ga0207661_10503131 Ga0207661_105031311 293
211 3300037466 Ga0395898_0034326 Ga0395898_0034326_1673_2578 293
212 3300037853 Ga0436364_0059099 Ga0436364_0059099_3342_4256 293
213 3300037853 Ga0436364_0092190 Ga0436364_0092190_5652_6563 293
214 3300037853 Ga0436364_0157811 Ga0436364_0157811_289518_290429 293
215 3300037853 Ga0436364_0257521 Ga0436364_0257521_180_1091 293
216 3300037853 Ga0436364_0586215 Ga0436364_0586215_11958_12866 293
217 3300037853 Ga0436364_1278270 Ga0436364_1278270_3785_4699 293
218 3300037853 Ga0436364_1403972 Ga0436364_1403972_431_1327 293
219 3300039437 Ga0436365_0596914 Ga0436365_0596914_1801_2703 293
220 3300039437 Ga0436365_0617682 Ga0436365_0617682_3374_4288 293
221 3300039437 Ga0436365_0879627 Ga0436365_0879627_808_1722 293
222 3300039438 Ga0436360_1374380 Ga0436360_1374380_432_1343 293
223 3300039450 Ga0436363_0896592 Ga0436363_0896592_16_927 293
224 3300039450 Ga0436363_1203601 Ga0436363_1203601_354_1268 293
225 3300039453 Ga0436362_0081568 Ga0436362_0081568_350_1264 293
226 3300039453 Ga0436362_0443492 Ga0436362_0443492_545_1459 293
227 3300049824 Ga0501045_0148474 Ga0501045_0148474_116_1024 293
228 3300025906 Ga0207699_10230696 Ga0207699_102306962 294
229 3300025949 Ga0207667_10144751 Ga0207667_101447513 294
230 3300031241 Ga0265325_10027126 Ga0265325_100271263 294
231 3300031247 Ga0265340_10035648 Ga0265340_100356482 294
232 3300004799 Ga0058863_10165611 Ga0058863_101656113 295
233 3300005327 Ga0070658_10009002 Ga0070658_100090022 295
234 3300005339 Ga0070660_100424497 Ga0070660_1004244971 295
235 3300005458 Ga0070681_10074047 Ga0070681_100740473 295
236 3300005563 Ga0068855_100150916 Ga0068855_1001509163 295
237 3300013307 Ga0157372_10257201 Ga0157372_102572012 295
238 3300025909 Ga0207705_10142154 Ga0207705_101421542 295
239 3300025912 Ga0207707_10022981 Ga0207707_100229813 295
240 3300025919 Ga0207657_10350739 Ga0207657_103507391 295
241 3300025921 Ga0207652_10079466 Ga0207652_100794661 295
242 3300025949 Ga0207667_10109719 Ga0207667_101097193 295
243 3300028800 Ga0265338_10083050 Ga0265338_100830503 295
244 3300049581 Ga0501047_0300215 Ga0501047_0300215_258_1145 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22740

PapZ_C

RapZ C-terminal domain

203

323

0.98

PF03668

RapZ-like_N

RapZ-like N-terminal domain

43

198

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9726 171 293
5o5s-assembly1.cif.gz_A-2 x-ray crystal structure of the rapz c-terminal domain from escherichia coli 0.9649 171 293
3vaa-assembly2.cif.gz_B 1.7 angstrom resolution crystal structure of shikimate kinase from bacteroides thetaiotaomicron 0.6726 13 164
1tev-assembly1.cif.gz_A crystal structure of the human ump/cmp kinase in open conformation 0.6661 12 167
1grq-assembly1.cif.gz_A chloramphenicol phosphotransferase in complex with p-amino-chloramphenicol from streptomyces venezuelae 0.6646 10 161
ID Description Score Start End Superfamily
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9784 179 292 3.40.50.720
af_Q2G039_182_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.908 179 292 3.40.50.720
af_O43012_3_162_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7092 14 162 3.40.50.300
af_P9WFQ3_17_301_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7024 12 294 3.40.50.300
af_P9WFQ3_17_301_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6969 12 294 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A351E942-F1-model_v4 RNase adaptor protein RapZ 0.9928 179 295 GO:0005524
AF-A0A662DSW2-F1-model_v4 RNase adaptor protein RapZ 0.9904 171 293 GO:0005524
AF-A0A661M354-F1-model_v4 RapZ C-terminal domain-containing protein 0.9868 172 291 GO:0005524
AF-A0A645DGX9-F1-model_v4 RNase adapter protein RapZ 0.9853 172 292 GO:0005524
AF-X1G6X1-F1-model_v4 RapZ C-terminal domain-containing protein 0.9849 184 276 GO:0005524

Feature Viewer

pLDDT pTM Quality
88.28 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map