F356455

General Info

Members Datasets Scaffolds Average Seq Length
244 162 488 200

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10858406|Ga0105245_108584062
Length 231
Sequence MNWCRLTADKVDSRLPAPAFEARIFPPQVSMARSVTGPEIERLIQLLARLPGLGPRSARRAALHLIKKKDDLLVPLAEAMDVAVESIVVCSTCGNIDTTNPCTICSDPRRDQSVLVVVEDVADLWALERAGAINARYHVLGGVLSPLDGVGPDDLAIAPLVKRVAAGGIGEVILAVNATVEGATTAHYVTDQLAGLNVKVSRLAHGVPVGGELDYLDEGTLSAAMRSRTPF

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
88 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
91 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
107 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
108 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
113 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
147 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
148 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
149 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
150 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
154 2643221733 Bosea sp. Root381 Isolate Unclassified
155 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
156 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
157 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
158 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
159 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
160 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
161 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
162 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.9
Metatranscriptomes 0
Isolates 4.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 0.82
Rhizosphere 86.07
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10858406 3300009098 Bacteria 948
2 JGI25406J46586_10017320 3300003203 Bacteria 2983
3 Ga0065715_10156555 3300005293 Bacteria 1671
4 Ga0065707_10469592 3300005295 Bacteria 783
5 Ga0070676_10117819 3300005328 Bacteria 1663
6 Ga0070690_100261900 3300005330 Bacteria 1227
7 Ga0070670_100016910 3300005331 Bacteria 6261
8 Ga0070670_100243032 3300005331 Bacteria 1567
9 Ga0070677_10001997 3300005333 Bacteria 6488
10 Ga0070668_100139438 3300005347 Bacteria 1953
11 Ga0070675_100214770 3300005354 Bacteria 1673
12 Ga0070674_100014576 3300005356 Bacteria 4890
13 Ga0070673_100058108 3300005364 Bacteria 3057
14 Ga0070667_100085710 3300005367 Bacteria 2702
15 Ga0070709_10009360 3300005434 Bacteria 5402
16 Ga0070711_100223364 3300005439 Unclassified 1465
17 Ga0070678_100017817 3300005456 Bacteria 4585
18 Ga0070662_100009754 3300005457 Bacteria 6286
19 Ga0068867_100166799 3300005459 Bacteria 1741
20 Ga0070684_100032071 3300005535 Bacteria 4476
21 Ga0070672_100006473 3300005543 Bacteria 7875
22 Ga0068856_100920934 3300005614 Bacteria 893
23 Ga0068859_100027176 3300005617 Bacteria 5741
24 Ga0068864_100164433 3300005618 Bacteria 2019
25 Ga0068870_10156945 3300005840 Bacteria 1346
26 Ga0068858_100218509 3300005842 Bacteria 1804
27 Ga0081539_10001975 3300005985 Bacteria 31233
28 Ga0075368_10098806 3300006042 Bacteria 1197
29 Ga0075364_10074560 3300006051 Bacteria 2237
30 Ga0075364_10127460 3300006051 Bacteria 1707
31 Ga0075367_10051991 3300006178 Bacteria 2424
32 Ga0068871_100814999 3300006358 Bacteria 861
33 Ga0075430_100865926 3300006846 Bacteria 744
34 Ga0075431_100000345 3300006847 Bacteria 36593
35 Ga0075429_100005281 3300006880 Bacteria 11112
36 Ga0097620_100027176 3300006931 Bacteria 5741
37 Ga0105240_11227799 3300009093 Bacteria 793
38 Ga0105247_10018056 3300009101 Bacteria 4231
39 Ga0114129_10016707 3300009147 Bacteria 10452
40 Ga0105243_10037604 3300009148 Bacteria 3763
41 Ga0105241_10314213 3300009174 Bacteria 1349
42 Ga0105242_10325899 3300009176 Bacteria 1410
43 Ga0105242_11144819 3300009176 Bacteria 794
44 Ga0105248_10572121 3300009177 Bacteria 1275
45 Ga0105238_10020466 3300009551 Bacteria 6736
46 Ga0105246_10373346 3300011119 Bacteria 1176
47 Ga0157378_10110893 3300013297 Bacteria 2515
48 Ga0157375_11434157 3300013308 Bacteria 814
49 Ga0163163_10142688 3300014325 Bacteria 2437
50 Ga0157380_11357231 3300014326 Bacteria 760
51 Ga0157376_10153510 3300014969 Bacteria 2079
52 Ga0182005_1112396 3300015265 Bacteria 770
53 Ga0213876_10072285 3300021384 Bacteria 1822
54 Ga0213876_10123172 3300021384 Bacteria 1377
55 Ga0213876_10132234 3300021384 Bacteria 1326
56 Ga0207682_10006806 3300025893 Bacteria 4587
57 Ga0207680_10127598 3300025903 Bacteria 1672
58 Ga0207647_10381832 3300025904 Bacteria 795
59 Ga0207699_10001403 3300025906 Bacteria 11437
60 Ga0207645_10561662 3300025907 Bacteria 774
61 Ga0207643_10160942 3300025908 Bacteria 1351
62 Ga0207643_10281704 3300025908 Bacteria 1031
63 Ga0207671_10618776 3300025914 Bacteria 863
64 Ga0207663_10372943 3300025916 Bacteria 1085
65 Ga0207681_10167292 3300025923 Bacteria 1663
66 Ga0207694_10047786 3300025924 Bacteria 3310
67 Ga0207659_10039067 3300025926 Bacteria 3306
68 Ga0207659_10288447 3300025926 Bacteria 1344
69 Ga0207690_10697131 3300025932 Bacteria 835
70 Ga0207706_10015413 3300025933 Bacteria 6906
71 Ga0207706_10134795 3300025933 Bacteria 2172
72 Ga0207670_10375079 3300025936 Bacteria 1132
73 Ga0207669_10008446 3300025937 Bacteria 4835
74 Ga0207669_10558924 3300025937 Bacteria 924
75 Ga0207691_10000720 3300025940 Bacteria 32686
76 Ga0207689_10158982 3300025942 Bacteria 1862
77 Ga0207661_10473401 3300025944 Bacteria 1143
78 Ga0207661_11128766 3300025944 Bacteria 722
79 Ga0207679_10543267 3300025945 Bacteria 1042
80 Ga0207651_10012239 3300025960 Bacteria 4845
81 Ga0207712_10795795 3300025961 Bacteria 831
82 Ga0207668_10067553 3300025972 Bacteria 2539
83 Ga0207658_10051222 3300025986 Bacteria 3042
84 Ga0207677_10392369 3300026023 Bacteria 1175
85 Ga0207676_10026665 3300026095 Bacteria 4297
86 Ga0207675_100453106 3300026118 Bacteria 1272
87 Ga0207675_100578371 3300026118 Bacteria 1124
88 Ga0207683_10003359 3300026121 Bacteria 13946
89 Ga0265318_10021861 3300028577 Bacteria 2564
90 Ga0265318_10027403 3300028577 Bacteria 2239
91 Ga0265330_10022220 3300031235 Bacteria 2889
92 Ga0265330_10043710 3300031235 Bacteria 1981
93 Ga0265325_10062006 3300031241 Bacteria 1895
94 Ga0265325_10065109 3300031241 Bacteria 1841
95 Ga0265340_10002587 3300031247 Bacteria 10275
96 Ga0265340_10007291 3300031247 Bacteria 6011
97 Ga0265340_10010584 3300031247 Bacteria 4931
98 Ga0265340_10023721 3300031247 Bacteria 3126
99 Ga0265340_10088894 3300031247 Bacteria 1446
100 Ga0265339_10147616 3300031249 Bacteria 1192
101 Ga0265316_10012137 3300031344 Bacteria 7735
102 Ga0265316_10332295 3300031344 Bacteria 1102
103 Ga0265313_10005225 3300031595 Bacteria 9619
104 Ga0265313_10055475 3300031595 Bacteria 1877
105 Ga0265313_10115404 3300031595 Bacteria 1176
106 Ga0265314_10003068 3300031711 Bacteria 16468
107 Ga0265314_10440071 3300031711 Bacteria 696
108 Ga0265342_10006227 3300031712 Bacteria 8915
109 Ga0265342_10021592 3300031712 Bacteria 4107
110 Ga0265342_10065525 3300031712 Bacteria 2129
111 Ga0265342_10238256 3300031712 Bacteria 975
112 Ga0307410_10334508 3300031852 Bacteria 1205
113 Ga0307406_10142250 3300031901 Bacteria 1700
114 Ga0307409_101253180 3300031995 Bacteria 766
115 Ga0307510_10230370 3300033180 Bacteria 1356
116 Ga0316574_0185821 3300035398 Bacteria 1337
117 Ga0373935_0317240 3300035692 Bacteria 1105
118 Ga0316584_0211691 3300036712 Bacteria 1426
119 Ga0373925_0848841 3300037068 Bacteria 753
120 Ga0395900_0157391 3300037418 Bacteria 2320
121 Ga0395898_0486315 3300037466 Bacteria 1174
122 Ga0395905_0021976 3300037471 Bacteria 6035
123 Ga0436364_0556782 3300037853 Bacteria 765
124 Ga0436364_0987839 3300037853 Bacteria 1091
125 Ga0436364_1361836 3300037853 Bacteria 1285
126 Ga0436365_0050130 3300039437 Bacteria 1431
127 Ga0436365_0404207 3300039437 Bacteria 1312
128 Ga0436365_1716714 3300039437 Bacteria 1584
129 Ga0436365_1938037 3300039437 Bacteria 723
130 Ga0436363_0640862 3300039450 Bacteria 855
131 Ga0436362_0068401 3300039453 Bacteria 881
132 Ga0439461_0099126 3300041410 Bacteria 708
133 Ga0451837_1612070 3300041494 Bacteria 838
134 Ga0439455_0132757 3300042012 Bacteria 703
135 Ga0466965_0176512 3300044683 Bacteria 1126
136 Ga0466968_0031293 3300044735 Bacteria 2207
137 Ga0466968_0085492 3300044735 Bacteria 1391
138 Ga0466970_0047682 3300044765 Bacteria 2284
139 Ga0466960_0130431 3300044901 Bacteria 1326
140 Ga0466967_1148472 3300045976 Bacteria 774
141 Ga0495605_0022515 3300046474 Bacteria 3328
142 Ga0495685_018908 3300047447 Bacteria 2366
143 Ga0495615_0008393 3300048090 Bacteria 1994
144 Ga0496112_0283122 3300048915 Bacteria 1605
145 Ga0496114_0033470 3300048917 Bacteria 4235
146 Ga0496119_0002204 3300048922 Bacteria 21763
147 Ga0496122_0016290 3300048925 Bacteria 7050
148 Ga0496123_0003152 3300048926 Bacteria 18863
149 Ga0496124_0621386 3300048927 Bacteria 699
150 Ga0501032_0030681 3300049569 Bacteria 3689
151 Ga0501032_0253244 3300049569 Bacteria 1143
152 Ga0501033_0086207 3300049570 Bacteria 2299
153 Ga0501033_0655498 3300049570 Bacteria 717
154 Ga0501033_0718532 3300049570 Bacteria 679
155 Ga0501034_0016156 3300049571 Bacteria 7658
156 Ga0501034_0040812 3300049571 Bacteria 4695
157 Ga0501034_0043792 3300049571 Bacteria 4528
158 Ga0501034_0047013 3300049571 Bacteria 4359
159 Ga0501034_0169677 3300049571 Bacteria 2150
160 Ga0501034_0204540 3300049571 Bacteria 1931
161 Ga0501034_0690773 3300049571 Bacteria 919
162 Ga0501036_0122800 3300049572 Bacteria 2193
163 Ga0501036_0229725 3300049572 Bacteria 1557
164 Ga0501037_0498049 3300049573 Bacteria 827
165 Ga0501037_0632905 3300049573 Bacteria 716
166 Ga0501039_0693128 3300049575 Bacteria 797
167 Ga0501039_0877091 3300049575 Bacteria 699
168 Ga0501043_0084666 3300049579 Bacteria 2492
169 Ga0501047_0060611 3300049581 Bacteria 3651
170 Ga0501047_0116972 3300049581 Bacteria 2547
171 Ga0501047_0129347 3300049581 Bacteria 2405
172 Ga0501047_0136443 3300049581 Bacteria 2334
173 Ga0501047_0175392 3300049581 Bacteria 2011
174 Ga0501047_0311122 3300049581 Bacteria 1416
175 Ga0501047_0379037 3300049581 Bacteria 1249
176 Ga0501047_0612446 3300049581 Bacteria 910
177 Ga0501067_0001744 3300049583 Bacteria 11950
178 Ga0501067_0010872 3300049583 Bacteria 5038
179 Ga0501067_0164648 3300049583 Bacteria 1235
180 Ga0501069_0333209 3300049585 Bacteria 893
181 Ga0501069_0615372 3300049585 Bacteria 652
182 Ga0501070_0099545 3300049586 Bacteria 2405
183 Ga0501070_0140460 3300049586 Bacteria 1994
184 Ga0501070_0229143 3300049586 Bacteria 1522
185 Ga0501072_0030786 3300049588 Bacteria 4198
186 Ga0501073_0195125 3300049589 Bacteria 1400
187 Ga0501074_0449303 3300049590 Bacteria 914
188 Ga0501074_0782060 3300049590 Bacteria 673
189 Ga0501075_0233391 3300049591 Bacteria 1403
190 Ga0501076_0141795 3300049592 Bacteria 1953
191 Ga0501076_0632789 3300049592 Bacteria 883
192 Ga0501077_0185313 3300049593 Bacteria 1322
193 Ga0501077_0331676 3300049593 Bacteria 970
194 Ga0501079_0788442 3300049741 Bacteria 748
195 Ga0501080_0146841 3300049742 Bacteria 2180
196 Ga0501080_0295228 3300049742 Bacteria 1471
197 Ga0501080_0405843 3300049742 Bacteria 1225
198 Ga0501080_0746596 3300049742 Bacteria 861
199 Ga0501081_0168027 3300049743 Bacteria 1583
200 Ga0501083_0000366 3300049744 Bacteria 28661
201 Ga0501083_0017441 3300049744 Bacteria 5004
202 Ga0501083_0028037 3300049744 Bacteria 3882
203 Ga0501083_0107224 3300049744 Bacteria 1838
204 Ga0501083_0113592 3300049744 Bacteria 1779
205 Ga0501083_0325455 3300049744 Bacteria 999
206 Ga0501035_0035242 3300049822 Bacteria 4542
207 Ga0501035_0166902 3300049822 Bacteria 1903
208 Ga0501035_0250345 3300049822 Bacteria 1505
209 Ga0501035_0351832 3300049822 Bacteria 1232
210 Ga0501044_0006144 3300049823 Bacteria 13263
211 Ga0501044_0052069 3300049823 Bacteria 4220
212 Ga0501044_0248359 3300049823 Bacteria 1721
213 Ga0501044_0294391 3300049823 Bacteria 1554
214 Ga0501044_0834999 3300049823 Bacteria 799
215 nmdc:mga05p37_72901_c1 3300050507 Bacteria 4226
216 nmdc:mga09592_32634_c1 3300050508 Bacteria 4341
217 nmdc:mga06r32_26639_c1 3300050510 Bacteria 5393
218 nmdc:mga0n895_1280964_c1 3300050512 Bacteria 704
219 Ga0500650_0228583 3300053098 Bacteria 840
220 Ga0500556_0000038 3300053104 Bacteria 138208
221 Ga0500652_060723 3300053131 Bacteria 1556
222 Ga0500627_0155200 3300053158 Bacteria 1034
223 Ga0500645_019861 3300053730 Bacteria 2087
224 Ga0501084_0055815 3300054114 Bacteria 3305
225 Ga0501084_0106686 3300054114 Bacteria 2353
226 Ga0501084_0350365 3300054114 Bacteria 1247
227 Ga0501084_0622189 3300054114 Bacteria 912
228 Ga0501082_0000002 3300060353 Bacteria 186546
229 Ga0501082_0019935 3300060353 Bacteria 5779
230 Ga0501082_0202157 3300060353 Bacteria 1729
231 Ga0501082_0266063 3300060353 Bacteria 1492
232 Ga0501082_0402198 3300060353 Bacteria 1195
233 Ga0501082_0714477 3300060353 Bacteria 877
234 Ga0501082_0920697 3300060353 Bacteria 765
235 2523468796 2523231067 Bacteria 5230452
236 2644729469 2643221733 Bacteria 5690728
237 2739349708 2738543031 Bacteria 5769731
238 2842699156 2842698319 Bacteria 5190321
239 2861691675 2861691609 Bacteria 5628931
240 2882461319 2882456835 Bacteria 6863978
241 2889310725 2889306138 Bacteria 6358934
242 2917557980 2917554339 Bacteria 4987857
243 2928129058 2928125067 Bacteria 5937560
244 2939673634 2939669807 Bacteria 5028511
245 Ga0105245_10858406
246 JGI25406J46586_10017320
247 Ga0065715_10156555
248 Ga0065707_10469592
249 Ga0070676_10117819
250 Ga0070690_100261900
251 Ga0070670_100016910
252 Ga0070670_100243032
253 Ga0070677_10001997
254 Ga0070668_100139438
255 Ga0070675_100214770
256 Ga0070674_100014576
257 Ga0070673_100058108
258 Ga0070667_100085710
259 Ga0070709_10009360
260 Ga0070711_100223364
261 Ga0070678_100017817
262 Ga0070662_100009754
263 Ga0068867_100166799
264 Ga0070684_100032071
265 Ga0070672_100006473
266 Ga0068856_100920934
267 Ga0068859_100027176
268 Ga0068864_100164433
269 Ga0068870_10156945
270 Ga0068858_100218509
271 Ga0081539_10001975
272 Ga0075368_10098806
273 Ga0075364_10074560
274 Ga0075364_10127460
275 Ga0075367_10051991
276 Ga0068871_100814999
277 Ga0075430_100865926
278 Ga0075431_100000345
279 Ga0075429_100005281
280 Ga0097620_100027176
281 Ga0105240_11227799
282 Ga0105247_10018056
283 Ga0114129_10016707
284 Ga0105243_10037604
285 Ga0105241_10314213
286 Ga0105242_10325899
287 Ga0105242_11144819
288 Ga0105248_10572121
289 Ga0105238_10020466
290 Ga0105246_10373346
291 Ga0157378_10110893
292 Ga0157375_11434157
293 Ga0163163_10142688
294 Ga0157380_11357231
295 Ga0157376_10153510
296 Ga0182005_1112396
297 Ga0213876_10072285
298 Ga0213876_10123172
299 Ga0213876_10132234
300 Ga0207682_10006806
301 Ga0207680_10127598
302 Ga0207647_10381832
303 Ga0207699_10001403
304 Ga0207645_10561662
305 Ga0207643_10160942
306 Ga0207643_10281704
307 Ga0207671_10618776
308 Ga0207663_10372943
309 Ga0207681_10167292
310 Ga0207694_10047786
311 Ga0207659_10039067
312 Ga0207659_10288447
313 Ga0207690_10697131
314 Ga0207706_10015413
315 Ga0207706_10134795
316 Ga0207670_10375079
317 Ga0207669_10008446
318 Ga0207669_10558924
319 Ga0207691_10000720
320 Ga0207689_10158982
321 Ga0207661_10473401
322 Ga0207661_11128766
323 Ga0207679_10543267
324 Ga0207651_10012239
325 Ga0207712_10795795
326 Ga0207668_10067553
327 Ga0207658_10051222
328 Ga0207677_10392369
329 Ga0207676_10026665
330 Ga0207675_100453106
331 Ga0207675_100578371
332 Ga0207683_10003359
333 Ga0265318_10021861
334 Ga0265318_10027403
335 Ga0265330_10022220
336 Ga0265330_10043710
337 Ga0265325_10062006
338 Ga0265325_10065109
339 Ga0265340_10002587
340 Ga0265340_10007291
341 Ga0265340_10010584
342 Ga0265340_10023721
343 Ga0265340_10088894
344 Ga0265339_10147616
345 Ga0265316_10012137
346 Ga0265316_10332295
347 Ga0265313_10005225
348 Ga0265313_10055475
349 Ga0265313_10115404
350 Ga0265314_10003068
351 Ga0265314_10440071
352 Ga0265342_10006227
353 Ga0265342_10021592
354 Ga0265342_10065525
355 Ga0265342_10238256
356 Ga0307410_10334508
357 Ga0307406_10142250
358 Ga0307409_101253180
359 Ga0307510_10230370
360 Ga0316574_0185821
361 Ga0373935_0317240
362 Ga0316584_0211691
363 Ga0373925_0848841
364 Ga0395900_0157391
365 Ga0395898_0486315
366 Ga0395905_0021976
367 Ga0436364_0556782
368 Ga0436364_0987839
369 Ga0436364_1361836
370 Ga0436365_0050130
371 Ga0436365_0404207
372 Ga0436365_1716714
373 Ga0436365_1938037
374 Ga0436363_0640862
375 Ga0436362_0068401
376 Ga0439461_0099126
377 Ga0451837_1612070
378 Ga0439455_0132757
379 Ga0466965_0176512
380 Ga0466968_0031293
381 Ga0466968_0085492
382 Ga0466970_0047682
383 Ga0466960_0130431
384 Ga0466967_1148472
385 Ga0495605_0022515
386 Ga0495685_018908
387 Ga0495615_0008393
388 Ga0496112_0283122
389 Ga0496114_0033470
390 Ga0496119_0002204
391 Ga0496122_0016290
392 Ga0496123_0003152
393 Ga0496124_0621386
394 Ga0501032_0030681
395 Ga0501032_0253244
396 Ga0501033_0086207
397 Ga0501033_0655498
398 Ga0501033_0718532
399 Ga0501034_0016156
400 Ga0501034_0040812
401 Ga0501034_0043792
402 Ga0501034_0047013
403 Ga0501034_0169677
404 Ga0501034_0204540
405 Ga0501034_0690773
406 Ga0501036_0122800
407 Ga0501036_0229725
408 Ga0501037_0498049
409 Ga0501037_0632905
410 Ga0501039_0693128
411 Ga0501039_0877091
412 Ga0501043_0084666
413 Ga0501047_0060611
414 Ga0501047_0116972
415 Ga0501047_0129347
416 Ga0501047_0136443
417 Ga0501047_0175392
418 Ga0501047_0311122
419 Ga0501047_0379037
420 Ga0501047_0612446
421 Ga0501067_0001744
422 Ga0501067_0010872
423 Ga0501067_0164648
424 Ga0501069_0333209
425 Ga0501069_0615372
426 Ga0501070_0099545
427 Ga0501070_0140460
428 Ga0501070_0229143
429 Ga0501072_0030786
430 Ga0501073_0195125
431 Ga0501074_0449303
432 Ga0501074_0782060
433 Ga0501075_0233391
434 Ga0501076_0141795
435 Ga0501076_0632789
436 Ga0501077_0185313
437 Ga0501077_0331676
438 Ga0501079_0788442
439 Ga0501080_0146841
440 Ga0501080_0295228
441 Ga0501080_0405843
442 Ga0501080_0746596
443 Ga0501081_0168027
444 Ga0501083_0000366
445 Ga0501083_0017441
446 Ga0501083_0028037
447 Ga0501083_0107224
448 Ga0501083_0113592
449 Ga0501083_0325455
450 Ga0501035_0035242
451 Ga0501035_0166902
452 Ga0501035_0250345
453 Ga0501035_0351832
454 Ga0501044_0006144
455 Ga0501044_0052069
456 Ga0501044_0248359
457 Ga0501044_0294391
458 Ga0501044_0834999
459 nmdc:mga05p37_72901_c1
460 nmdc:mga09592_32634_c1
461 nmdc:mga06r32_26639_c1
462 nmdc:mga0n895_1280964_c1
463 Ga0500650_0228583
464 Ga0500556_0000038
465 Ga0500652_060723
466 Ga0500627_0155200
467 Ga0500645_019861
468 Ga0501084_0055815
469 Ga0501084_0106686
470 Ga0501084_0350365
471 Ga0501084_0622189
472 Ga0501082_0000002
473 Ga0501082_0019935
474 Ga0501082_0202157
475 Ga0501082_0266063
476 Ga0501082_0402198
477 Ga0501082_0714477
478 Ga0501082_0920697
479 2523468796
480 2644729469
481 2739349708
482 2842699156
483 2861691675
484 2882461319
485 2889310725
486 2917557980
487 2928129058
488 2939673634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13662

Toprim_4

Toprim domain

113

204

0.98

PF21175

RecR_C

RecR, C-terminal

206

229

0.97

PF21176

RecR_HhH

RecR, helix-hairpin-helix

40

84

0.96

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

87

107

0.93

PF01751

Toprim

Toprim domain

114

203

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9415 82 173
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9317 82 173
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8603 20 200
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8558 20 200
4o6p-assembly1.cif.gz_C structural and functional studies the characterization of c58g/c70g mutant in cys4 zinc-finger motif in the recombination mediator protein recr 0.799 5 198
ID Description Score Start End Superfamily
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9545 79 200 3.40.1360.10
af_P9WHI3_76_174_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9511 79 172 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.947 79 200 3.40.1360.10
1vddC03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9422 79 172 3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.935 78 172 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.9807 62 157 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9739 73 175 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.9641 42 154 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A3B9BGG3-F1-model_v4 Recombination protein RecR 0.961 62 157 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9557 73 175 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Map