F356550

General Info

Members Datasets Scaffolds Average Seq Length
244 148 241 225

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10025652|Ga0207684_100256522
Length 263
Sequence MWRVHETFIPGVYTLTKGHIKQGGTLTQRAHSSPIGAMRILLVEDEPQIADFVARGLHENGYSVDLARDGEEALEWPSVASFDVIILDVMLPSVDGTEVCRTLRTQGLRTPILMLTARDGVEDRVRGLDSGADDYLVKPFAFAELLARIRALSRREPALLGTELQVGDLRMNTATRQVTRAGVLVELTSKEFALLEHLMRHPNQVLSRTVIAEHVWNYDFDNVTNVIDVHVKNLRKKIDEGFDPKLIHTVRGAGYRLSDRTTR

Samples

Sample ID Description Type Environment
1 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
2 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
56 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
57 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
61 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
62 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
65 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
72 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
111 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
119 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
120 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
121 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
122 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
123 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
135 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
136 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 2.87
Rhizosphere 89.34
Stem 0
Stem Tuber 0
Unclassified 6.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10008808 3300003373 Bacteria 2548
2 Ga0065707_10089618 3300005295 Bacteria 4319
3 Ga0070683_100035617 3300005329 Bacteria 4550
4 Ga0070680_100022787 3300005336 Bacteria 4989
5 Ga0070680_100161478 3300005336 Bacteria 1883
6 Ga0070675_100478484 3300005354 Bacteria 1120
7 Ga0070709_10004374 3300005434 Bacteria 7616
8 Ga0070709_10522165 3300005434 Bacteria 905
9 Ga0070714_100007208 3300005435 Bacteria 8632
10 Ga0070714_100009325 3300005435 Bacteria 7711
11 Ga0070714_100230016 3300005435 Bacteria 1708
12 Ga0070713_100361701 3300005436 Bacteria 1348
13 Ga0070713_100401816 3300005436 Bacteria 1280
14 Ga0070708_100085987 3300005445 Bacteria 2855
15 Ga0070708_100281217 3300005445 Bacteria 1566
16 Ga0070681_10014683 3300005458 Bacteria 7789
17 Ga0070681_10050735 3300005458 Bacteria 4140
18 Ga0070706_100059676 3300005467 Bacteria 3521
19 Ga0070698_100389634 3300005471 Bacteria 1326
20 Ga0070699_100525360 3300005518 Bacteria 1076
21 Ga0070679_100000343 3300005530 Bacteria 39458
22 Ga0070679_100013890 3300005530 Bacteria 7715
23 Ga0070679_100264972 3300005530 Bacteria 1673
24 Ga0070679_100367293 3300005530 Bacteria 1386
25 Ga0070686_100041513 3300005544 Bacteria 2876
26 Ga0068855_100625439 3300005563 Bacteria 1159
27 Ga0068857_100051417 3300005577 Bacteria 3656
28 Ga0068856_100280473 3300005614 Bacteria 1683
29 Ga0068859_100007027 3300005617 Bacteria 11427
30 Ga0068863_100001879 3300005841 Bacteria 20844
31 Ga0068858_100096170 3300005842 Bacteria 2760
32 Ga0068858_100468363 3300005842 Bacteria 1215
33 Ga0068860_100000177 3300005843 Bacteria 104330
34 Ga0081538_10005087 3300005981 Bacteria 11947
35 Ga0097620_100007027 3300006931 Bacteria 11427
36 Ga0105240_10000638 3300009093 Bacteria 64636
37 Ga0105240_10012978 3300009093 Bacteria 11475
38 Ga0105240_10021327 3300009093 Bacteria 8618
39 Ga0105240_10050089 3300009093 Bacteria 5268
40 Ga0105240_10140872 3300009093 Bacteria 2883
41 Ga0105240_10195197 3300009093 Bacteria 2378
42 Ga0114129_10012463 3300009147 Bacteria 12105
43 Ga0114129_10944461 3300009147 Bacteria 1090
44 Ga0105248_10322905 3300009177 Bacteria 1739
45 Ga0105248_10512848 3300009177 Bacteria 1352
46 Ga0105238_10009613 3300009551 Bacteria 9674
47 Ga0105238_10196177 3300009551 Bacteria 1995
48 Ga0105238_10213308 3300009551 Bacteria 1907
49 Ga0105249_10146209 3300009553 Bacteria 2271
50 Ga0105239_10230930 3300010375 Bacteria 2076
51 Ga0157379_10507884 3300014968 Bacteria 1118
52 Ga0213872_10000864 3300021361 Bacteria 21926
53 Ga0207710_10104344 3300025900 Bacteria 1340
54 Ga0207684_10025652 3300025910 Bacteria 5023
55 Ga0207684_10027638 3300025910 Bacteria 4832
56 Ga0207707_10009879 3300025912 Bacteria 8274
57 Ga0207707_10170320 3300025912 Unclassified 1903
58 Ga0207695_10000109 3300025913 Bacteria 251757
59 Ga0207695_10064427 3300025913 Bacteria 3774
60 Ga0207695_10127122 3300025913 Bacteria 2510
61 Ga0207695_10266039 3300025913 Bacteria 1611
62 Ga0207695_10351647 3300025913 Bacteria 1361
63 Ga0207695_10402600 3300025913 Bacteria 1253
64 Ga0207660_10019772 3300025917 Bacteria 4508
65 Ga0207652_10002757 3300025921 Bacteria 14751
66 Ga0207652_10228603 3300025921 Bacteria 1677
67 Ga0207694_10000755 3300025924 Bacteria 29027
68 Ga0207700_10008002 3300025928 Bacteria 6514
69 Ga0207700_10402871 3300025928 Bacteria 1199
70 Ga0207664_10000277 3300025929 Bacteria 38796
71 Ga0207664_10006529 3300025929 Bacteria 8028
72 Ga0207711_10298136 3300025941 Unclassified 1486
73 Ga0207689_10426483 3300025942 Bacteria 1107
74 Ga0207661_10244535 3300025944 Bacteria 1593
75 Ga0207667_10233329 3300025949 Bacteria 1884
76 Ga0207703_10965027 3300026035 Bacteria 817
77 Ga0207708_10191964 3300026075 Bacteria 1626
78 Ga0207702_10390796 3300026078 Bacteria 1339
79 Ga0207641_10004060 3300026088 Bacteria 12769
80 Ga0207674_10047865 3300026116 Bacteria 4381
81 Ga0268266_10009801 3300028379 Bacteria 8425
82 Ga0268264_10000295 3300028381 Bacteria 82396
83 Ga0265337_1018649 3300028556 Bacteria 2200
84 Ga0265326_10000415 3300028558 Bacteria 17009
85 Ga0265319_1000228 3300028563 Bacteria 42152
86 Ga0265319_1000545 3300028563 Bacteria 25590
87 Ga0265319_1021376 3300028563 Bacteria 2377
88 Ga0265334_10000771 3300028573 Bacteria 16029
89 Ga0265334_10024216 3300028573 Bacteria 2465
90 Ga0265334_10041508 3300028573 Bacteria 1798
91 Ga0265318_10003298 3300028577 Bacteria 8195
92 Ga0265318_10038693 3300028577 Bacteria 1822
93 Ga0265318_10052213 3300028577 Bacteria 1534
94 Ga0265323_10000994 3300028653 Bacteria 14747
95 Ga0265323_10012123 3300028653 Bacteria 3462
96 Ga0265323_10052195 3300028653 Bacteria 1447
97 Ga0265322_10000385 3300028654 Bacteria 18261
98 Ga0265322_10000646 3300028654 Bacteria 13108
99 Ga0265322_10001164 3300028654 Bacteria 9034
100 Ga0265322_10001269 3300028654 Bacteria 8508
101 Ga0265336_10000403 3300028666 Bacteria 27135
102 Ga0265336_10003792 3300028666 Bacteria 5834
103 Ga0307515_10042684 3300028794 Bacteria 7084
104 Ga0265338_10000019 3300028800 Bacteria 336040
105 Ga0265338_10000123 3300028800 Bacteria 142127
106 Ga0265338_10001321 3300028800 Bacteria 40561
107 Ga0265338_10006206 3300028800 Bacteria 15311
108 Ga0265338_10008104 3300028800 Bacteria 12837
109 Ga0265338_10008728 3300028800 Bacteria 12252
110 Ga0265338_10009038 3300028800 Bacteria 11983
111 Ga0265338_10010996 3300028800 Bacteria 10513
112 Ga0265338_10011758 3300028800 Bacteria 10067
113 Ga0265338_10013068 3300028800 Bacteria 9409
114 Ga0265338_10036178 3300028800 Bacteria 4731
115 Ga0265338_10049702 3300028800 Bacteria 3798
116 Ga0265338_10050089 3300028800 Unclassified 3779
117 Ga0265338_10077298 3300028800 Bacteria 2814
118 Ga0265338_10131987 3300028800 Bacteria 1970
119 Ga0265338_10601269 3300028800 Bacteria 766
120 Ga0265324_10003098 3300029957 Bacteria 8105
121 Ga0265324_10006312 3300029957 Bacteria 4973
122 Ga0265324_10011866 3300029957 Bacteria 3307
123 Ga0265324_10105022 3300029957 Bacteria 959
124 Ga0265330_10002189 3300031235 Bacteria 10779
125 Ga0265332_10000911 3300031238 Bacteria 17747
126 Ga0265328_10002039 3300031239 Bacteria 9136
127 Ga0265320_10001006 3300031240 Bacteria 20958
128 Ga0265320_10004212 3300031240 Bacteria 9454
129 Ga0265320_10004673 3300031240 Bacteria 8940
130 Ga0265320_10150201 3300031240 Bacteria 1052
131 Ga0265325_10006470 3300031241 Bacteria 7104
132 Ga0265325_10063213 3300031241 Bacteria 1873
133 Ga0265329_10003569 3300031242 Bacteria 6732
134 Ga0265340_10004774 3300031247 Bacteria 7537
135 Ga0265339_10003012 3300031249 Bacteria 11874
136 Ga0265331_10001530 3300031250 Bacteria 17041
137 Ga0265316_10005527 3300031344 Bacteria 12258
138 Ga0265313_10001199 3300031595 Bacteria 24807
139 Ga0307508_10001897 3300031616 Bacteria 22951
140 Ga0307514_10142935 3300031649 Bacteria 1623
141 Ga0265314_10007862 3300031711 Bacteria 9206
142 Ga0265314_10085934 3300031711 Bacteria 2061
143 Ga0265314_10127109 3300031711 Bacteria 1595
144 Ga0265342_10000850 3300031712 Bacteria 30509
145 Ga0265342_10002512 3300031712 Bacteria 15789
146 Ga0265342_10020079 3300031712 Bacteria 4293
147 Ga0316576_10002068 3300031727 Bacteria 11266
148 Ga0316576_10352802 3300031727 Bacteria 1094
149 Ga0316578_10032931 3300031728 Bacteria 2965
150 Ga0307414_10085538 3300032004 Bacteria 2324
151 Ga0307510_10000014 3300033180 Bacteria 271607
152 Ga0373932_0069276 3300035112 Unclassified 1090
153 Ga0373939_0043250 3300035114 Unclassified 1366
154 Ga0373931_0108950 3300035691 Unclassified 1568
155 Ga0316584_0008813 3300036712 Bacteria 6969
156 Ga0373925_0217812 3300037068 Bacteria 1523
157 Ga0395899_0112996 3300037312 Bacteria 1951
158 Ga0436364_0713661 3300037853 Bacteria 2827
159 Ga0436364_0984753 3300037853 Bacteria 1056
160 Ga0395901_0607026 3300038443 Bacteria 1103
161 Ga0436361_0864045 3300039447 Bacteria 28061
162 Ga0451577_0024188 3300042876 Bacteria 5527
163 Ga0451577_0028631 3300042876 Bacteria 5036
164 Ga0451577_0055483 3300042876 Bacteria 3535
165 Ga0453684_0002150 3300044712 Bacteria 49388
166 Ga0453684_0005525 3300044712 Bacteria 24951
167 Ga0453684_0011539 3300044712 Bacteria 14782
168 Ga0453684_0114903 3300044712 Bacteria 3262
169 Ga0466970_0032751 3300044765 Bacteria 2746
170 Ga0451576_0003851 3300045051 Bacteria 20138
171 Ga0451576_0016066 3300045051 Bacteria 8271
172 Ga0451576_0124805 3300045051 Bacteria 2682
173 Ga0451576_0268711 3300045051 Bacteria 1783
174 Ga0451576_0360622 3300045051 Bacteria 1522
175 Ga0451576_0563923 3300045051 Bacteria 1196
176 Ga0495651_0217987 3300046462 Bacteria 1323
177 Ga0495628_0077993 3300046516 Bacteria 2577
178 Ga0495630_0676580 3300046517 Bacteria 790
179 Ga0495652_0306728 3300046529 Bacteria 1152
180 Ga0495640_0136972 3300046533 Bacteria 1580
181 Ga0495586_0001127 3300046535 Bacteria 15038
182 Ga0495645_0088089 3300046543 Bacteria 2221
183 Ga0495645_0131197 3300046543 Bacteria 1756
184 Ga0495667_0449473 3300046559 Bacteria 810
185 Ga0495634_0019274 3300046642 Bacteria 4848
186 Ga0495599_0017123 3300046678 Bacteria 4504
187 Ga0495613_0004565 3300046689 Bacteria 10390
188 Ga0495600_0222165 3300046809 Bacteria 1208
189 Ga0495680_0285179 3300047322 Bacteria 1163
190 Ga0495675_0096433 3300047444 Bacteria 1854
191 Ga0495686_0019983 3300047472 Bacteria 4470
192 Ga0496102_0056215 3300048905 Bacteria 3589
193 Ga0496104_0002331 3300048907 Bacteria 16412
194 Ga0496104_0021050 3300048907 Bacteria 5982
195 Ga0496105_0001808 3300048908 Bacteria 15303
196 Ga0496114_0443884 3300048917 Bacteria 1149
197 Ga0496114_0682125 3300048917 Bacteria 902
198 Ga0496115_0008365 3300048918 Bacteria 7655
199 Ga0496116_0133616 3300048919 Bacteria 1409
200 Ga0496117_0000156 3300048920 Bacteria 145285
201 Ga0496118_0000005 3300048921 Bacteria 697350
202 Ga0496119_0014325 3300048922 Bacteria 6218
203 Ga0496120_0000173 3300048923 Bacteria 109909
204 Ga0496120_0026129 3300048923 Bacteria 3610
205 Ga0496124_0187417 3300048927 Bacteria 1586
206 Ga0496125_0004587 3300048928 Bacteria 15797
207 Ga0496126_0057272 3300048929 Bacteria 3519
208 Ga0501034_0000006 3300049571 Bacteria 358887
209 Ga0501034_0000071 3300049571 Bacteria 180636
210 Ga0501034_0000511 3300049571 Bacteria 62485
211 Ga0501034_0015912 3300049571 Bacteria 7721
212 Ga0501034_0201016 3300049571 Bacteria 1951
213 Ga0501037_0030361 3300049573 Bacteria 3995
214 Ga0501039_0022895 3300049575 Bacteria 4792
215 Ga0501043_0011750 3300049579 Bacteria 6856
216 Ga0501046_0239887 3300049580 Bacteria 1337
217 Ga0501047_0001794 3300049581 Bacteria 20777
218 Ga0501067_0000875 3300049583 Bacteria 16166
219 Ga0501070_0075632 3300049586 Bacteria 2788
220 Ga0501073_0000001 3300049589 Bacteria 677932
221 Ga0501073_0143182 3300049589 Bacteria 1656
222 Ga0501073_0196248 3300049589 Bacteria 1396
223 Ga0501073_0307025 3300049589 Bacteria 1095
224 Ga0501074_0001557 3300049590 Bacteria 15507
225 Ga0501074_0027388 3300049590 Bacteria 4133
226 Ga0501077_0041361 3300049593 Bacteria 2934
227 Ga0501080_0002370 3300049742 Bacteria 16439
228 Ga0501080_0009674 3300049742 Bacteria 8801
229 Ga0501080_0565002 3300049742 Bacteria 1012
230 Ga0501081_0418719 3300049743 Bacteria 993
231 Ga0501081_0490856 3300049743 Bacteria 915
232 Ga0501083_0070458 3300049744 Bacteria 2325
233 nmdc:mga05p37_113039_c1 3300050507 Unclassified 3339
234 nmdc:mga0n895_629212_c1 3300050512 Bacteria 1073
235 Ga0500643_000453 3300053087 Bacteria 30334
236 Ga0500577_0248448 3300053142 Bacteria 773
237 Ga0500596_011731 3300053735 Bacteria 1337
238 Ga0501084_0042904 3300054114 Bacteria 3784
239 Ga0501084_0575295 3300054114 Bacteria 952
240 Ga0501082_0001140 3300060353 Bacteria 23441
241 Ga0530510_0006218 3300061734 Bacteria 8302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0032751 Ga0466970_0032751_1613_2275 169
2 3300031711 Ga0265314_10127109 Ga0265314_101271091 173
3 3300005458 Ga0070681_10014683 Ga0070681_100146836 179
4 3300005530 Ga0070679_100013890 Ga0070679_10001389010 179
5 3300025912 Ga0207707_10009879 Ga0207707_100098795 179
6 3300047472 Ga0495686_0019983 Ga0495686_0019983_2465_3184 191
7 3300005336 Ga0070680_100161478 Ga0070680_1001614782 192
8 3300005530 Ga0070679_100367293 Ga0070679_1003672932 192
9 3300028577 Ga0265318_10038693 Ga0265318_100386932 192
10 3300035112 Ga0373932_0069276 Ga0373932_0069276_190_861 192
11 3300035114 Ga0373939_0043250 Ga0373939_0043250_126_797 192
12 3300037068 Ga0373925_0217812 Ga0373925_0217812_509_1180 192
13 3300046529 Ga0495652_0306728 Ga0495652_0306728_32_694 192
14 3300053142 Ga0500577_0248448 Ga0500577_0248448_23_694 192
15 3300003373 JGI25407J50210_10008808 JGI25407J50210_100088082 193
16 3300005295 Ga0065707_10089618 Ga0065707_100896185 193
17 3300005329 Ga0070683_100035617 Ga0070683_1000356177 193
18 3300005336 Ga0070680_100022787 Ga0070680_1000227873 193
19 3300005354 Ga0070675_100478484 Ga0070675_1004784842 193
20 3300005434 Ga0070709_10004374 Ga0070709_100043744 193
21 3300005434 Ga0070709_10522165 Ga0070709_105221651 193
22 3300005435 Ga0070714_100007208 Ga0070714_1000072087 193
23 3300005435 Ga0070714_100009325 Ga0070714_1000093255 193
24 3300005435 Ga0070714_100230016 Ga0070714_1002300162 193
25 3300005436 Ga0070713_100361701 Ga0070713_1003617012 193
26 3300005436 Ga0070713_100401816 Ga0070713_1004018161 193
27 3300005445 Ga0070708_100085987 Ga0070708_1000859871 193
28 3300005445 Ga0070708_100281217 Ga0070708_1002812172 193
29 3300005458 Ga0070681_10050735 Ga0070681_100507352 193
30 3300005467 Ga0070706_100059676 Ga0070706_1000596763 193
31 3300005471 Ga0070698_100389634 Ga0070698_1003896342 193
32 3300005518 Ga0070699_100525360 Ga0070699_1005253602 193
33 3300005530 Ga0070679_100000343 Ga0070679_10000034343 193
34 3300005530 Ga0070679_100264972 Ga0070679_1002649721 193
35 3300005544 Ga0070686_100041513 Ga0070686_1000415133 193
36 3300005563 Ga0068855_100625439 Ga0068855_1006254391 193
37 3300005577 Ga0068857_100051417 Ga0068857_1000514171 193
38 3300005614 Ga0068856_100280473 Ga0068856_1002804733 193
39 3300005617 Ga0068859_100007027 Ga0068859_1000070277 193
40 3300005841 Ga0068863_100001879 Ga0068863_1000018792 193
41 3300005842 Ga0068858_100096170 Ga0068858_1000961703 193
42 3300005842 Ga0068858_100468363 Ga0068858_1004683632 193
43 3300005843 Ga0068860_100000177 Ga0068860_10000017752 193
44 3300005981 Ga0081538_10005087 Ga0081538_100050877 193
45 3300006931 Ga0097620_100007027 Ga0097620_1000070276 193
46 3300009093 Ga0105240_10000638 Ga0105240_1000063840 193
47 3300009093 Ga0105240_10012978 Ga0105240_100129784 193
48 3300009093 Ga0105240_10021327 Ga0105240_100213275 193
49 3300009093 Ga0105240_10050089 Ga0105240_100500896 193
50 3300009093 Ga0105240_10140872 Ga0105240_101408723 193
51 3300009093 Ga0105240_10195197 Ga0105240_101951972 193
52 3300009147 Ga0114129_10012463 Ga0114129_1001246311 193
53 3300009147 Ga0114129_10944461 Ga0114129_109444611 193
54 3300009177 Ga0105248_10322905 Ga0105248_103229053 193
55 3300009177 Ga0105248_10512848 Ga0105248_105128482 193
56 3300009551 Ga0105238_10009613 Ga0105238_100096135 193
57 3300009551 Ga0105238_10196177 Ga0105238_101961772 193
58 3300009551 Ga0105238_10213308 Ga0105238_102133082 193
59 3300009553 Ga0105249_10146209 Ga0105249_101462093 193
60 3300010375 Ga0105239_10230930 Ga0105239_102309302 193
61 3300014968 Ga0157379_10507884 Ga0157379_105078841 193
62 3300021361 Ga0213872_10000864 Ga0213872_1000086415 193
63 3300025900 Ga0207710_10104344 Ga0207710_101043442 193
64 3300025910 Ga0207684_10025652 Ga0207684_100256522 193
65 3300025910 Ga0207684_10027638 Ga0207684_100276383 193
66 3300025912 Ga0207707_10170320 Ga0207707_101703202 193
67 3300025913 Ga0207695_10000109 Ga0207695_1000010930 193
68 3300025913 Ga0207695_10064427 Ga0207695_100644275 193
69 3300025913 Ga0207695_10127122 Ga0207695_101271223 193
70 3300025913 Ga0207695_10266039 Ga0207695_102660393 193
71 3300025913 Ga0207695_10351647 Ga0207695_103516472 193
72 3300025913 Ga0207695_10402600 Ga0207695_104026002 193
73 3300025917 Ga0207660_10019772 Ga0207660_100197724 193
74 3300025921 Ga0207652_10002757 Ga0207652_1000275715 193
75 3300025921 Ga0207652_10228603 Ga0207652_102286033 193
76 3300025924 Ga0207694_10000755 Ga0207694_1000075521 193
77 3300025928 Ga0207700_10008002 Ga0207700_100080023 193
78 3300025928 Ga0207700_10402871 Ga0207700_104028712 193
79 3300025929 Ga0207664_10000277 Ga0207664_100002776 193
80 3300025929 Ga0207664_10006529 Ga0207664_100065295 193
81 3300025941 Ga0207711_10298136 Ga0207711_102981363 193
82 3300025942 Ga0207689_10426483 Ga0207689_104264831 193
83 3300025944 Ga0207661_10244535 Ga0207661_102445352 193
84 3300025949 Ga0207667_10233329 Ga0207667_102333292 193
85 3300026035 Ga0207703_10965027 Ga0207703_109650272 193
86 3300026075 Ga0207708_10191964 Ga0207708_101919642 193
87 3300026078 Ga0207702_10390796 Ga0207702_103907962 193
88 3300026088 Ga0207641_10004060 Ga0207641_100040602 193
89 3300026116 Ga0207674_10047865 Ga0207674_100478651 193
90 3300028379 Ga0268266_10009801 Ga0268266_100098013 193
91 3300028381 Ga0268264_10000295 Ga0268264_1000029555 193
92 3300028556 Ga0265337_1018649 Ga0265337_10186493 193
93 3300028558 Ga0265326_10000415 Ga0265326_100004156 193
94 3300028563 Ga0265319_1000228 Ga0265319_100022819 193
95 3300028563 Ga0265319_1000545 Ga0265319_100054512 193
96 3300028563 Ga0265319_1021376 Ga0265319_10213763 193
97 3300028573 Ga0265334_10000771 Ga0265334_100007718 193
98 3300028573 Ga0265334_10024216 Ga0265334_100242162 193
99 3300028573 Ga0265334_10041508 Ga0265334_100415083 193
100 3300028577 Ga0265318_10003298 Ga0265318_100032986 193
101 3300028577 Ga0265318_10052213 Ga0265318_100522132 193
102 3300028653 Ga0265323_10000994 Ga0265323_1000099415 193
103 3300028653 Ga0265323_10012123 Ga0265323_100121232 193
104 3300028653 Ga0265323_10052195 Ga0265323_100521952 193
105 3300028654 Ga0265322_10000385 Ga0265322_100003856 193
106 3300028654 Ga0265322_10000646 Ga0265322_100006462 193
107 3300028654 Ga0265322_10001164 Ga0265322_100011645 193
108 3300028654 Ga0265322_10001269 Ga0265322_100012692 193
109 3300028666 Ga0265336_10000403 Ga0265336_100004032 193
110 3300028666 Ga0265336_10003792 Ga0265336_100037926 193
111 3300028794 Ga0307515_10042684 Ga0307515_100426848 193
112 3300028800 Ga0265338_10000019 Ga0265338_100000192 193
113 3300028800 Ga0265338_10000123 Ga0265338_1000012390 193
114 3300028800 Ga0265338_10001321 Ga0265338_100013219 193
115 3300028800 Ga0265338_10006206 Ga0265338_100062064 193
116 3300028800 Ga0265338_10008104 Ga0265338_100081048 193
117 3300028800 Ga0265338_10008728 Ga0265338_100087289 193
118 3300028800 Ga0265338_10009038 Ga0265338_100090383 193
119 3300028800 Ga0265338_10010996 Ga0265338_100109966 193
120 3300028800 Ga0265338_10011758 Ga0265338_100117584 193
121 3300028800 Ga0265338_10013068 Ga0265338_1001306813 193
122 3300028800 Ga0265338_10036178 Ga0265338_100361785 193
123 3300028800 Ga0265338_10049702 Ga0265338_100497023 193
124 3300028800 Ga0265338_10050089 Ga0265338_100500892 193
125 3300028800 Ga0265338_10077298 Ga0265338_100772982 193
126 3300028800 Ga0265338_10131987 Ga0265338_101319871 193
127 3300028800 Ga0265338_10601269 Ga0265338_106012692 193
128 3300029957 Ga0265324_10003098 Ga0265324_100030985 193
129 3300029957 Ga0265324_10006312 Ga0265324_100063122 193
130 3300029957 Ga0265324_10011866 Ga0265324_100118664 193
131 3300029957 Ga0265324_10105022 Ga0265324_101050222 193
132 3300031235 Ga0265330_10002189 Ga0265330_100021897 193
133 3300031238 Ga0265332_10000911 Ga0265332_1000091116 193
134 3300031239 Ga0265328_10002039 Ga0265328_100020394 193
135 3300031240 Ga0265320_10001006 Ga0265320_100010065 193
136 3300031240 Ga0265320_10004212 Ga0265320_1000421213 193
137 3300031240 Ga0265320_10004673 Ga0265320_100046735 193
138 3300031240 Ga0265320_10150201 Ga0265320_101502011 193
139 3300031241 Ga0265325_10006470 Ga0265325_100064704 193
140 3300031241 Ga0265325_10063213 Ga0265325_100632132 193
141 3300031242 Ga0265329_10003569 Ga0265329_100035697 193
142 3300031247 Ga0265340_10004774 Ga0265340_100047745 193
143 3300031249 Ga0265339_10003012 Ga0265339_100030126 193
144 3300031250 Ga0265331_10001530 Ga0265331_1000153016 193
145 3300031344 Ga0265316_10005527 Ga0265316_100055276 193
146 3300031595 Ga0265313_10001199 Ga0265313_100011992 193
147 3300031616 Ga0307508_10001897 Ga0307508_100018977 193
148 3300031649 Ga0307514_10142935 Ga0307514_101429351 193
149 3300031711 Ga0265314_10007862 Ga0265314_100078624 193
150 3300031711 Ga0265314_10085934 Ga0265314_100859342 193
151 3300031712 Ga0265342_10000850 Ga0265342_100008506 193
152 3300031712 Ga0265342_10002512 Ga0265342_100025122 193
153 3300031712 Ga0265342_10020079 Ga0265342_100200794 193
154 3300031727 Ga0316576_10002068 Ga0316576_100020688 193
155 3300031727 Ga0316576_10352802 Ga0316576_103528022 193
156 3300031728 Ga0316578_10032931 Ga0316578_100329313 193
157 3300032004 Ga0307414_10085538 Ga0307414_100855383 193
158 3300033180 Ga0307510_10000014 Ga0307510_1000001454 193
159 3300035691 Ga0373931_0108950 Ga0373931_0108950_669_1343 193
160 3300036712 Ga0316584_0008813 Ga0316584_0008813_5805_6503 193
161 3300037312 Ga0395899_0112996 Ga0395899_0112996_922_1605 193
162 3300037853 Ga0436364_0713661 Ga0436364_0713661_234_893 193
163 3300037853 Ga0436364_0984753 Ga0436364_0984753_73_732 193
164 3300038443 Ga0395901_0607026 Ga0395901_0607026_107_790 193
165 3300039447 Ga0436361_0864045 Ga0436361_0864045_24852_25532 193
166 3300042876 Ga0451577_0024188 Ga0451577_0024188_253_924 193
167 3300042876 Ga0451577_0028631 Ga0451577_0028631_2411_3082 193
168 3300042876 Ga0451577_0055483 Ga0451577_0055483_2265_2939 193
169 3300044712 Ga0453684_0002150 Ga0453684_0002150_7000_7674 193
170 3300044712 Ga0453684_0005525 Ga0453684_0005525_23602_24276 193
171 3300044712 Ga0453684_0011539 Ga0453684_0011539_1376_2050 193
172 3300044712 Ga0453684_0114903 Ga0453684_0114903_2443_3114 193
173 3300045051 Ga0451576_0003851 Ga0451576_0003851_4339_5022 193
174 3300045051 Ga0451576_0016066 Ga0451576_0016066_7084_7755 193
175 3300045051 Ga0451576_0124805 Ga0451576_0124805_1813_2487 193
176 3300045051 Ga0451576_0268711 Ga0451576_0268711_973_1647 193
177 3300045051 Ga0451576_0360622 Ga0451576_0360622_577_1251 193
178 3300045051 Ga0451576_0563923 Ga0451576_0563923_359_1036 193
179 3300046462 Ga0495651_0217987 Ga0495651_0217987_473_1153 193
180 3300046516 Ga0495628_0077993 Ga0495628_0077993_595_1275 193
181 3300046517 Ga0495630_0676580 Ga0495630_0676580_28_675 193
182 3300046533 Ga0495640_0136972 Ga0495640_0136972_394_1074 193
183 3300046535 Ga0495586_0001127 Ga0495586_0001127_10134_10814 193
184 3300046543 Ga0495645_0088089 Ga0495645_0088089_1259_1939 193
185 3300046543 Ga0495645_0131197 Ga0495645_0131197_327_1010 193
186 3300046559 Ga0495667_0449473 Ga0495667_0449473_83_763 193
187 3300046642 Ga0495634_0019274 Ga0495634_0019274_3740_4420 193
188 3300046678 Ga0495599_0017123 Ga0495599_0017123_497_1177 193
189 3300046689 Ga0495613_0004565 Ga0495613_0004565_2074_2754 193
190 3300046809 Ga0495600_0222165 Ga0495600_0222165_545_1189 193
191 3300047322 Ga0495680_0285179 Ga0495680_0285179_30_677 193
192 3300047444 Ga0495675_0096433 Ga0495675_0096433_1088_1777 193
193 3300048905 Ga0496102_0056215 Ga0496102_0056215_676_1356 193
194 3300048907 Ga0496104_0002331 Ga0496104_0002331_15093_15779 193
195 3300048907 Ga0496104_0021050 Ga0496104_0021050_135_821 193
196 3300048908 Ga0496105_0001808 Ga0496105_0001808_8841_9527 193
197 3300048917 Ga0496114_0443884 Ga0496114_0443884_92_772 193
198 3300048917 Ga0496114_0682125 Ga0496114_0682125_31_717 193
199 3300048918 Ga0496115_0008365 Ga0496115_0008365_5993_6679 193
200 3300048919 Ga0496116_0133616 Ga0496116_0133616_531_1211 193
201 3300048920 Ga0496117_0000156 Ga0496117_0000156_48507_49187 193
202 3300048921 Ga0496118_0000005 Ga0496118_0000005_33371_34051 193
203 3300048922 Ga0496119_0014325 Ga0496119_0014325_2380_3060 193
204 3300048923 Ga0496120_0000173 Ga0496120_0000173_76835_77515 193
205 3300048923 Ga0496120_0026129 Ga0496120_0026129_2512_3192 193
206 3300048927 Ga0496124_0187417 Ga0496124_0187417_330_1010 193
207 3300048928 Ga0496125_0004587 Ga0496125_0004587_11924_12604 193
208 3300048929 Ga0496126_0057272 Ga0496126_0057272_1285_1965 193
209 3300049571 Ga0501034_0000006 Ga0501034_0000006_272248_272922 193
210 3300049571 Ga0501034_0000071 Ga0501034_0000071_11982_12656 193
211 3300049571 Ga0501034_0000511 Ga0501034_0000511_2513_3190 193
212 3300049571 Ga0501034_0015912 Ga0501034_0015912_1193_1867 193
213 3300049571 Ga0501034_0201016 Ga0501034_0201016_68_742 193
214 3300049573 Ga0501037_0030361 Ga0501037_0030361_1819_2493 193
215 3300049575 Ga0501039_0022895 Ga0501039_0022895_1203_1877 193
216 3300049579 Ga0501043_0011750 Ga0501043_0011750_3026_3700 193
217 3300049580 Ga0501046_0239887 Ga0501046_0239887_614_1288 193
218 3300049581 Ga0501047_0001794 Ga0501047_0001794_16187_16861 193
219 3300049583 Ga0501067_0000875 Ga0501067_0000875_7332_8006 193
220 3300049586 Ga0501070_0075632 Ga0501070_0075632_1285_1959 193
221 3300049589 Ga0501073_0000001 Ga0501073_0000001_484968_485642 193
222 3300049589 Ga0501073_0143182 Ga0501073_0143182_938_1612 193
223 3300049589 Ga0501073_0196248 Ga0501073_0196248_259_936 193
224 3300049589 Ga0501073_0307025 Ga0501073_0307025_201_878 193
225 3300049590 Ga0501074_0001557 Ga0501074_0001557_1378_2052 193
226 3300049590 Ga0501074_0027388 Ga0501074_0027388_1113_1787 193
227 3300049593 Ga0501077_0041361 Ga0501077_0041361_91_765 193
228 3300049742 Ga0501080_0002370 Ga0501080_0002370_3862_4542 193
229 3300049742 Ga0501080_0009674 Ga0501080_0009674_67_741 193
230 3300049742 Ga0501080_0565002 Ga0501080_0565002_62_736 193
231 3300049743 Ga0501081_0418719 Ga0501081_0418719_190_867 193
232 3300049743 Ga0501081_0490856 Ga0501081_0490856_155_835 193
233 3300049744 Ga0501083_0070458 Ga0501083_0070458_1513_2187 193
234 3300050507 nmdc:mga05p37_113039_c1 nmdc:mga05p37_113039_c1_1552_2232 193
235 3300050512 nmdc:mga0n895_629212_c1 nmdc:mga0n895_629212_c1_320_1000 193
236 3300053087 Ga0500643_000453 Ga0500643_000453_12015_12686 193
237 3300053735 Ga0500596_011731 Ga0500596_011731_372_1052 193
238 3300054114 Ga0501084_0042904 Ga0501084_0042904_897_1571 193
239 3300054114 Ga0501084_0575295 Ga0501084_0575295_206_895 193
240 3300060353 Ga0501082_0001140 Ga0501082_0001140_12782_13456 193
241 3300061734 Ga0530510_0006218 Ga0530510_0006218_4404_5084 193
242 iso_pu_bacteria 2728369276 2729905050 193
243 iso_pu_bacteria 2751185782 2753270429 193
244 iso_pu_bacteria 8025530807 8025532010 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

40

150

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

182

257

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9624 6 94
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.9541 2 93
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9445 7 93
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9343 4 93
8hml-assembly1.cif.gz_B co-crystal structure of the c terminal dna binding domain of saccharopolyspora erythraea glnr in complex with its conserved promoter dna in 2.95 angstrom resolution 0.9317 104 191
ID Description Score Start End Superfamily
1ys7A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9468 101 192 1.10.10.10
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9406 6 56 3.40.50.2300
2pkxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9334 1 92 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9326 4 56 3.40.50.2300
af_P76340_118_223_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9311 101 191 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Y5Y888-F1-model_v4 Transcriptional regulatory protein, C terminal 0.8902 91 192 GO:0000160
GO:0003677
GO:0006355
AF-X1V184-F1-model_v4 Response regulatory domain-containing protein 0.859 1 95 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1Y5Y888-F1-model_v4 Transcriptional regulatory protein, C terminal 0.8422 91 192 GO:0000160
GO:0003677
GO:0006355
AF-B8HWT4-F1-model_v4 Two component transcriptional regulator, winged helix family 0.8214 6 192 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A6N8RWW5-F1-model_v4 deleted 0.801 4 192

Feature Viewer

pLDDT pTM Quality
90 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map