F356592

General Info

Members Datasets Scaffolds Average Seq Length
244 170 488 252

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10000030|Ga0207708_1000003080
Length 268
Sequence MNPPVSTPPAQPMTGAPSVDGARRGIAAQAVDLSKTYGSGDTQVRALNSVSVDFLRGEFTAIMGPSGSGKSTLMHCLAGLDTASSGSVRIGDTELTGLSDKKMTQLRRDRIGFVFQAFNLVPTLTALENITLPMDIAGRHRTAEDQAWLTSVIDTLGLADRLGHRPSELSGGQQQRVACARALAGRPEIIFGDEPTGNLDSRSSGEVMGILRSSVTELGQTVVIVTHDPRAASYADRVVFLADGRIVDEMRSPTADTVLDRMKNLEQV

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
99 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
113 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
135 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
147 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
148 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
149 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
150 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
152 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
153 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
154 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
155 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
156 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
157 2867475112 Streptomyces sp. TM32 Isolate Unclassified
158 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
159 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
160 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
161 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
162 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
163 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
164 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
165 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
166 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
167 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
168 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
169 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
170 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 1.23
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 5.33
Rhizosphere 86.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10000030 3300026075 Bacteria 157064
2 Ga0070658_10064933 3300005327 Bacteria 2978
3 Ga0070683_100025623 3300005329 Bacteria 5299
4 Ga0070683_100152679 3300005329 Bacteria 2189
5 Ga0070683_100155165 3300005329 Bacteria 2171
6 Ga0070680_100001295 3300005336 Bacteria 18097
7 Ga0070680_100003101 3300005336 Bacteria 12334
8 Ga0070680_100644166 3300005336 Bacteria 910
9 Ga0070682_100035105 3300005337 Bacteria 3059
10 Ga0070682_100142656 3300005337 Bacteria 1635
11 Ga0070660_100004994 3300005339 Bacteria 9172
12 Ga0070689_100415026 3300005340 Bacteria 1140
13 Ga0070661_100005797 3300005344 Bacteria 8494
14 Ga0070692_10005081 3300005345 Bacteria 5563
15 Ga0070669_100003124 3300005353 Bacteria 11913
16 Ga0070671_100002862 3300005355 Bacteria 13424
17 Ga0070659_100000013 3300005366 Bacteria 178795
18 Ga0070659_100004324 3300005366 Bacteria 10142
19 Ga0070709_10078056 3300005434 Bacteria 2154
20 Ga0070714_100000137 3300005435 Bacteria 58260
21 Ga0070714_100010889 3300005435 Bacteria 7200
22 Ga0070714_100018985 3300005435 Bacteria 5595
23 Ga0070713_100266515 3300005436 Bacteria 1567
24 Ga0070713_100575170 3300005436 Bacteria 1068
25 Ga0070710_10000005 3300005437 Bacteria 238049
26 Ga0070710_10271782 3300005437 Bacteria 1096
27 Ga0070705_100001368 3300005440 Bacteria 13011
28 Ga0070700_100000035 3300005441 Bacteria 112177
29 Ga0070708_100009715 3300005445 Bacteria 7764
30 Ga0070663_100087160 3300005455 Bacteria 2307
31 Ga0070681_10005112 3300005458 Bacteria 12660
32 Ga0070681_10005996 3300005458 Bacteria 11779
33 Ga0070681_10113196 3300005458 Bacteria 2653
34 Ga0070681_10354936 3300005458 Bacteria 1376
35 Ga0070706_100064615 3300005467 Bacteria 3383
36 Ga0070679_100001987 3300005530 Bacteria 18362
37 Ga0070679_100012603 3300005530 Bacteria 8085
38 Ga0070679_100127551 3300005530 Bacteria 2526
39 Ga0070679_100355877 3300005530 Bacteria 1411
40 Ga0070684_100009511 3300005535 Bacteria 7659
41 Ga0070684_100358694 3300005535 Bacteria 1341
42 Ga0070672_100377410 3300005543 Bacteria 1212
43 Ga0070693_100184599 3300005547 Bacteria 1345
44 Ga0070665_100003340 3300005548 Bacteria 17181
45 Ga0068855_100021951 3300005563 Bacteria 7653
46 Ga0068855_100495744 3300005563 Bacteria 1328
47 Ga0070664_100017242 3300005564 Bacteria 5931
48 Ga0070664_100365837 3300005564 Bacteria 1314
49 Ga0068856_100076176 3300005614 Bacteria 3323
50 Ga0068856_100215266 3300005614 Bacteria 1936
51 Ga0068852_100024029 3300005616 Bacteria 4918
52 Ga0068863_100002777 3300005841 Bacteria 17340
53 Ga0068858_100000014 3300005842 Bacteria 214686
54 Ga0068860_100000054 3300005843 Bacteria 206114
55 Ga0068860_100005792 3300005843 Bacteria 12444
56 Ga0070717_10000004 3300006028 Bacteria 365525
57 Ga0070717_10471696 3300006028 Bacteria 1133
58 Ga0070715_10254779 3300006163 Bacteria 919
59 Ga0068871_100434727 3300006358 Bacteria 1174
60 Ga0075430_100006220 3300006846 Bacteria 10069
61 Ga0075429_100007783 3300006880 Bacteria 9305
62 Ga0105240_10045440 3300009093 Bacteria 5571
63 Ga0105240_10146005 3300009093 Bacteria 2822
64 Ga0105245_10638417 3300009098 Bacteria 1094
65 Ga0105247_10001130 3300009101 Bacteria 19770
66 Ga0105241_10044848 3300009174 Bacteria 3352
67 Ga0105248_10136481 3300009177 Bacteria 2767
68 Ga0105237_10013795 3300009545 Bacteria 8457
69 Ga0105237_10081799 3300009545 Bacteria 3220
70 Ga0105238_10128777 3300009551 Bacteria 2510
71 Ga0105238_10129394 3300009551 Bacteria 2503
72 Ga0105249_10754029 3300009553 Bacteria 1036
73 Ga0105239_10063476 3300010375 Bacteria 4056
74 Ga0157371_10127007 3300013102 Bacteria 1814
75 Ga0157369_10181008 3300013105 Bacteria 2218
76 Ga0163162_10319444 3300013306 Bacteria 1685
77 Ga0163162_10397497 3300013306 Bacteria 1511
78 Ga0157372_10009971 3300013307 Bacteria 10105
79 Ga0157372_10437913 3300013307 Bacteria 1524
80 Ga0157375_10185812 3300013308 Bacteria 2232
81 Ga0157380_10104710 3300014326 Bacteria 2364
82 Ga0157379_10000548 3300014968 Bacteria 30342
83 Ga0163161_10105866 3300017792 Bacteria 2098
84 Ga0206354_10772836 3300020081 Bacteria 1369
85 Ga0206354_11411810 3300020081 Bacteria 1247
86 Ga0206353_10944081 3300020082 Bacteria 1711
87 Ga0207692_10000009 3300025898 Bacteria 159859
88 Ga0207692_10162246 3300025898 Bacteria 1289
89 Ga0207710_10000035 3300025900 Bacteria 253729
90 Ga0207705_10002141 3300025909 Bacteria 15316
91 Ga0207705_10115095 3300025909 Bacteria 1990
92 Ga0207684_10046597 3300025910 Bacteria 3678
93 Ga0207654_10052215 3300025911 Bacteria 2356
94 Ga0207707_10001604 3300025912 Bacteria 20867
95 Ga0207707_10006554 3300025912 Bacteria 10160
96 Ga0207707_10197010 3300025912 Bacteria 1757
97 Ga0207695_10032125 3300025913 Bacteria 5748
98 Ga0207695_10106260 3300025913 Bacteria 2793
99 Ga0207671_10057761 3300025914 Bacteria 2876
100 Ga0207671_10377592 3300025914 Bacteria 1126
101 Ga0207693_10064019 3300025915 Bacteria 2881
102 Ga0207663_10337871 3300025916 Bacteria 1137
103 Ga0207660_10000735 3300025917 Bacteria 21790
104 Ga0207660_10003890 3300025917 Bacteria 9730
105 Ga0207657_10006760 3300025919 Bacteria 11845
106 Ga0207649_10004998 3300025920 Bacteria 7167
107 Ga0207652_10001488 3300025921 Bacteria 20709
108 Ga0207652_10044998 3300025921 Bacteria 3762
109 Ga0207652_10176236 3300025921 Bacteria 1920
110 Ga0207694_10312165 3300025924 Bacteria 1296
111 Ga0207694_10459281 3300025924 Bacteria 1064
112 Ga0207687_10532233 3300025927 Bacteria 984
113 Ga0207664_10000006 3300025929 Bacteria 408702
114 Ga0207664_10001425 3300025929 Bacteria 15730
115 Ga0207664_10007092 3300025929 Bacteria 7766
116 Ga0207664_10040623 3300025929 Bacteria 3619
117 Ga0207644_10138667 3300025931 Bacteria 1870
118 Ga0207690_10000017 3300025932 Bacteria 243513
119 Ga0207690_10008005 3300025932 Bacteria 6276
120 Ga0207709_10072256 3300025935 Bacteria 2194
121 Ga0207709_10270440 3300025935 Bacteria 1250
122 Ga0207665_10400181 3300025939 Bacteria 1046
123 Ga0207691_10155932 3300025940 Bacteria 2005
124 Ga0207661_10002443 3300025944 Bacteria 12802
125 Ga0207661_10027579 3300025944 Bacteria 4339
126 Ga0207661_10100989 3300025944 Bacteria 2422
127 Ga0207679_10010319 3300025945 Bacteria 6009
128 Ga0207679_10442025 3300025945 Bacteria 1152
129 Ga0207667_10060965 3300025949 Bacteria 3948
130 Ga0207667_10532516 3300025949 Bacteria 1189
131 Ga0207703_10000005 3300026035 Bacteria 506356
132 Ga0207639_10018977 3300026041 Bacteria 4896
133 Ga0207702_10015337 3300026078 Bacteria 6351
134 Ga0207702_10173147 3300026078 Bacteria 1981
135 Ga0207702_10718615 3300026078 Bacteria 985
136 Ga0207641_10002048 3300026088 Bacteria 19177
137 Ga0207675_100109142 3300026118 Bacteria 2610
138 Ga0207683_10111456 3300026121 Bacteria 2450
139 Ga0268266_10000968 3300028379 Bacteria 36525
140 Ga0268266_10099663 3300028379 Bacteria 2558
141 Ga0268264_10000097 3300028381 Bacteria 229722
142 Ga0268264_10006971 3300028381 Bacteria 9486
143 Ga0265326_10000045 3300028558 Bacteria 79810
144 Ga0265319_1059077 3300028563 Bacteria 1248
145 Ga0265334_10000012 3300028573 Bacteria 174358
146 Ga0265338_10007079 3300028800 Bacteria 14059
147 Ga0265324_10007445 3300029957 Bacteria 4432
148 Ga0307508_10021617 3300031616 Bacteria 5850
149 Ga0316576_10007314 3300031727 Bacteria 6940
150 Ga0316578_10016418 3300031728 Bacteria 4007
151 Ga0316577_10037467 3300031733 Bacteria 2711
152 Ga0307415_100457551 3300032126 Bacteria 1105
153 Ga0307510_10270464 3300033180 Bacteria 1176
154 Ga0373934_0100478 3300035086 Bacteria 1170
155 Ga0373931_0314688 3300035691 Bacteria 970
156 Ga0316584_0027816 3300036712 Bacteria 4164
157 Ga0400483_051056 3300039062 Bacteria 3274
158 Ga0400483_253308 3300039062 Bacteria 5430
159 Ga0439431_0019033 3300041997 Bacteria 1629
160 Ga0466963_0008763 3300044694 Bacteria 6075
161 Ga0466963_0045175 3300044694 Bacteria 2901
162 Ga0466963_0068014 3300044694 Bacteria 2391
163 Ga0466963_0270749 3300044694 Bacteria 1193
164 Ga0466964_0054876 3300044706 Bacteria 1644
165 Ga0466970_0020269 3300044765 Bacteria 3453
166 Ga0466957_0025328 3300044842 Bacteria 3516
167 Ga0466957_0042404 3300044842 Bacteria 2753
168 Ga0466957_0110453 3300044842 Bacteria 1743
169 Ga0466959_0027203 3300045049 Bacteria 4242
170 Ga0466959_0071742 3300045049 Bacteria 2507
171 Ga0466959_0294521 3300045049 Bacteria 1112
172 Ga0466958_0001886 3300045836 Bacteria 10241
173 Ga0466958_0008281 3300045836 Bacteria 5756
174 Ga0466958_0354386 3300045836 Bacteria 945
175 Ga0466967_0000474 3300045976 Bacteria 19438
176 Ga0466967_0015535 3300045976 Bacteria 5970
177 Ga0466967_0021389 3300045976 Bacteria 5253
178 Ga0466967_0118290 3300045976 Bacteria 2444
179 Ga0466967_0137451 3300045976 Bacteria 2273
180 Ga0466967_0211604 3300045976 Bacteria 1839
181 Ga0466967_0300836 3300045976 Bacteria 1543
182 Ga0466967_0305315 3300045976 Bacteria 1532
183 Ga0466967_0476542 3300045976 Bacteria 1222
184 Ga0495603_0006739 3300046455 Bacteria 6894
185 Ga0495588_0034186 3300046674 Bacteria 2572
186 Ga0495647_0163818 3300046681 Bacteria 960
187 Ga0495658_0027115 3300046683 Bacteria 3079
188 Ga0495613_0369782 3300046689 Bacteria 982
189 Ga0495600_0223735 3300046809 Bacteria 1203
190 Ga0495604_0000148 3300047317 Bacteria 60608
191 Ga0495604_0014629 3300047317 Bacteria 6255
192 Ga0495675_0004773 3300047444 Bacteria 8236
193 Ga0496100_0003950 3300048903 Bacteria 7794
194 Ga0496100_0695750 3300048903 Bacteria 793
195 Ga0496101_0301560 3300048904 Bacteria 1255
196 Ga0496102_0038078 3300048905 Bacteria 4339
197 Ga0496103_0122240 3300048906 Bacteria 1659
198 Ga0496104_0637062 3300048907 Bacteria 975
199 Ga0496109_0130313 3300048912 Bacteria 2347
200 Ga0496110_0213591 3300048913 Bacteria 1754
201 Ga0496114_0291843 3300048917 Bacteria 1439
202 Ga0496115_0000059 3300048918 Bacteria 102022
203 Ga0496115_0000087 3300048918 Bacteria 86513
204 Ga0496115_0001973 3300048918 Bacteria 14639
205 Ga0496119_0017793 3300048922 Bacteria 5328
206 Ga0496121_0010457 3300048924 Bacteria 10465
207 Ga0496122_0000659 3300048925 Bacteria 69472
208 Ga0496124_0080998 3300048927 Bacteria 2670
209 Ga0496125_0000025 3300048928 Bacteria 440074
210 Ga0496126_0210634 3300048929 Bacteria 1637
211 Ga0501033_0003804 3300049570 Bacteria 12273
212 Ga0501034_0028674 3300049571 Bacteria 5663
213 Ga0501043_0107352 3300049579 Bacteria 2192
214 Ga0501047_0012072 3300049581 Bacteria 8176
215 Ga0501070_0164448 3300049586 Bacteria 1829
216 Ga0501044_0420037 3300049823 Bacteria 1247
217 nmdc:mga09592_3784_c1 3300050508 Bacteria 12177
218 nmdc:mga0qj67_677314_c1 3300050509 Bacteria 822
219 Ga0495601_0005538 3300053077 Bacteria 7367
220 Ga0495612_0000032 3300053078 Bacteria 78122
221 Ga0500566_0066511 3300053094 Bacteria 2031
222 Ga0500553_115435 3300053101 Bacteria 1119
223 Ga0500614_033883 3300053123 Bacteria 1264
224 Ga0466962_0093170 3300061719 Bacteria 1444
225 2552110246 2551306166 Bacteria 9731570
226 2744957553 2744054611 Bacteria 5611514
227 2768647478 2767802112 Bacteria 6465194
228 2793978004 2791355406 Bacteria 11364898
229 2862710092 2862705112 Bacteria 6563286
230 2867480696 2867475112 Bacteria 6909112
231 2995466807 2995463766 Bacteria 8577691
232 2997454525 2997451912 Bacteria 8492419
233 2997604118 2997600082 Bacteria 9896405
234 8008488342 8008485437 Bacteria 7198341
235 8025530199 8025524527 Bacteria 7197316
236 8033688309 8033684223 Bacteria 6906479
237 8047898317 8047893842 Bacteria 11723082
238 8048133002 8048127548 Bacteria 11053136
239 8048360577 8048356638 Bacteria 11044339
240 8048375280 8048369669 Bacteria 11666822
241 8048382925 8048379754 Bacteria 11877923
242 8054162588 8054160619 Bacteria 7783213
243 8056450661 8056447290 Bacteria 7680491
244 8056450748 8056447290 Bacteria 7680491
245 Ga0207708_10000030
246 Ga0070658_10064933
247 Ga0070683_100025623
248 Ga0070683_100152679
249 Ga0070683_100155165
250 Ga0070680_100001295
251 Ga0070680_100003101
252 Ga0070680_100644166
253 Ga0070682_100035105
254 Ga0070682_100142656
255 Ga0070660_100004994
256 Ga0070689_100415026
257 Ga0070661_100005797
258 Ga0070692_10005081
259 Ga0070669_100003124
260 Ga0070671_100002862
261 Ga0070659_100000013
262 Ga0070659_100004324
263 Ga0070709_10078056
264 Ga0070714_100000137
265 Ga0070714_100010889
266 Ga0070714_100018985
267 Ga0070713_100266515
268 Ga0070713_100575170
269 Ga0070710_10000005
270 Ga0070710_10271782
271 Ga0070705_100001368
272 Ga0070700_100000035
273 Ga0070708_100009715
274 Ga0070663_100087160
275 Ga0070681_10005112
276 Ga0070681_10005996
277 Ga0070681_10113196
278 Ga0070681_10354936
279 Ga0070706_100064615
280 Ga0070679_100001987
281 Ga0070679_100012603
282 Ga0070679_100127551
283 Ga0070679_100355877
284 Ga0070684_100009511
285 Ga0070684_100358694
286 Ga0070672_100377410
287 Ga0070693_100184599
288 Ga0070665_100003340
289 Ga0068855_100021951
290 Ga0068855_100495744
291 Ga0070664_100017242
292 Ga0070664_100365837
293 Ga0068856_100076176
294 Ga0068856_100215266
295 Ga0068852_100024029
296 Ga0068863_100002777
297 Ga0068858_100000014
298 Ga0068860_100000054
299 Ga0068860_100005792
300 Ga0070717_10000004
301 Ga0070717_10471696
302 Ga0070715_10254779
303 Ga0068871_100434727
304 Ga0075430_100006220
305 Ga0075429_100007783
306 Ga0105240_10045440
307 Ga0105240_10146005
308 Ga0105245_10638417
309 Ga0105247_10001130
310 Ga0105241_10044848
311 Ga0105248_10136481
312 Ga0105237_10013795
313 Ga0105237_10081799
314 Ga0105238_10128777
315 Ga0105238_10129394
316 Ga0105249_10754029
317 Ga0105239_10063476
318 Ga0157371_10127007
319 Ga0157369_10181008
320 Ga0163162_10319444
321 Ga0163162_10397497
322 Ga0157372_10009971
323 Ga0157372_10437913
324 Ga0157375_10185812
325 Ga0157380_10104710
326 Ga0157379_10000548
327 Ga0163161_10105866
328 Ga0206354_10772836
329 Ga0206354_11411810
330 Ga0206353_10944081
331 Ga0207692_10000009
332 Ga0207692_10162246
333 Ga0207710_10000035
334 Ga0207705_10002141
335 Ga0207705_10115095
336 Ga0207684_10046597
337 Ga0207654_10052215
338 Ga0207707_10001604
339 Ga0207707_10006554
340 Ga0207707_10197010
341 Ga0207695_10032125
342 Ga0207695_10106260
343 Ga0207671_10057761
344 Ga0207671_10377592
345 Ga0207693_10064019
346 Ga0207663_10337871
347 Ga0207660_10000735
348 Ga0207660_10003890
349 Ga0207657_10006760
350 Ga0207649_10004998
351 Ga0207652_10001488
352 Ga0207652_10044998
353 Ga0207652_10176236
354 Ga0207694_10312165
355 Ga0207694_10459281
356 Ga0207687_10532233
357 Ga0207664_10000006
358 Ga0207664_10001425
359 Ga0207664_10007092
360 Ga0207664_10040623
361 Ga0207644_10138667
362 Ga0207690_10000017
363 Ga0207690_10008005
364 Ga0207709_10072256
365 Ga0207709_10270440
366 Ga0207665_10400181
367 Ga0207691_10155932
368 Ga0207661_10002443
369 Ga0207661_10027579
370 Ga0207661_10100989
371 Ga0207679_10010319
372 Ga0207679_10442025
373 Ga0207667_10060965
374 Ga0207667_10532516
375 Ga0207703_10000005
376 Ga0207639_10018977
377 Ga0207702_10015337
378 Ga0207702_10173147
379 Ga0207702_10718615
380 Ga0207641_10002048
381 Ga0207675_100109142
382 Ga0207683_10111456
383 Ga0268266_10000968
384 Ga0268266_10099663
385 Ga0268264_10000097
386 Ga0268264_10006971
387 Ga0265326_10000045
388 Ga0265319_1059077
389 Ga0265334_10000012
390 Ga0265338_10007079
391 Ga0265324_10007445
392 Ga0307508_10021617
393 Ga0316576_10007314
394 Ga0316578_10016418
395 Ga0316577_10037467
396 Ga0307415_100457551
397 Ga0307510_10270464
398 Ga0373934_0100478
399 Ga0373931_0314688
400 Ga0316584_0027816
401 Ga0400483_051056
402 Ga0400483_253308
403 Ga0439431_0019033
404 Ga0466963_0008763
405 Ga0466963_0045175
406 Ga0466963_0068014
407 Ga0466963_0270749
408 Ga0466964_0054876
409 Ga0466970_0020269
410 Ga0466957_0025328
411 Ga0466957_0042404
412 Ga0466957_0110453
413 Ga0466959_0027203
414 Ga0466959_0071742
415 Ga0466959_0294521
416 Ga0466958_0001886
417 Ga0466958_0008281
418 Ga0466958_0354386
419 Ga0466967_0000474
420 Ga0466967_0015535
421 Ga0466967_0021389
422 Ga0466967_0118290
423 Ga0466967_0137451
424 Ga0466967_0211604
425 Ga0466967_0300836
426 Ga0466967_0305315
427 Ga0466967_0476542
428 Ga0495603_0006739
429 Ga0495588_0034186
430 Ga0495647_0163818
431 Ga0495658_0027115
432 Ga0495613_0369782
433 Ga0495600_0223735
434 Ga0495604_0000148
435 Ga0495604_0014629
436 Ga0495675_0004773
437 Ga0496100_0003950
438 Ga0496100_0695750
439 Ga0496101_0301560
440 Ga0496102_0038078
441 Ga0496103_0122240
442 Ga0496104_0637062
443 Ga0496109_0130313
444 Ga0496110_0213591
445 Ga0496114_0291843
446 Ga0496115_0000059
447 Ga0496115_0000087
448 Ga0496115_0001973
449 Ga0496119_0017793
450 Ga0496121_0010457
451 Ga0496122_0000659
452 Ga0496124_0080998
453 Ga0496125_0000025
454 Ga0496126_0210634
455 Ga0501033_0003804
456 Ga0501034_0028674
457 Ga0501043_0107352
458 Ga0501047_0012072
459 Ga0501070_0164448
460 Ga0501044_0420037
461 nmdc:mga09592_3784_c1
462 nmdc:mga0qj67_677314_c1
463 Ga0495601_0005538
464 Ga0495612_0000032
465 Ga0500566_0066511
466 Ga0500553_115435
467 Ga0500614_033883
468 Ga0466962_0093170
469 2552110246
470 2744957553
471 2768647478
472 2793978004
473 2862710092
474 2867480696
475 2995466807
476 2997454525
477 2997604118
478 8008488342
479 8025530199
480 8033688309
481 8047898317
482 8048133002
483 8048360577
484 8048375280
485 8048382925
486 8054162588
487 8056450661
488 8056450748

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

47

197

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9549 7 227
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9468 6 221
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9412 4 226
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9408 4 231
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.94 4 231
ID Description Score Start End Superfamily
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9656 4 227 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9586 5 239 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.949 4 227 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9483 4 230 3.40.50.300
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9467 4 227 3.40.50.300
ID Description Score Start End GO Terms
AF-R7MIN1-F1-model_v4 deleted 0.9826 4 224
AF-E6KSM5-F1-model_v4 ABC superfamily ATP binding cassette transporter, ABC protein (EC 3.6.3.28) 0.9813 1 238 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A239AIX0-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9749 4 241 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A5P2CEQ6-F1-model_v4 ABC transporter ATP-binding protein 0.9742 5 242 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-R7MIN1-F1-model_v4 deleted 0.9739 4 224

Map