F356592
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 244 | 170 | 488 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300026075|Ga0207708_10000030|Ga0207708_1000003080 |
| Length | 268 |
| Sequence | MNPPVSTPPAQPMTGAPSVDGARRGIAAQAVDLSKTYGSGDTQVRALNSVSVDFLRGEFTAIMGPSGSGKSTLMHCLAGLDTASSGSVRIGDTELTGLSDKKMTQLRRDRIGFVFQAFNLVPTLTALENITLPMDIAGRHRTAEDQAWLTSVIDTLGLADRLGHRPSELSGGQQQRVACARALAGRPEIIFGDEPTGNLDSRSSGEVMGILRSSVTELGQTVVIVTHDPRAASYADRVVFLADGRIVDEMRSPTADTVLDRMKNLEQV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 59 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 96 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 98 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 99 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 100 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 103 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 105 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 106 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 107 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 113 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 114 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 115 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 127 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 130 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 131 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 132 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 133 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 134 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 135 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 136 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 137 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 138 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 142 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 143 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 149 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 150 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 151 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 152 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 153 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 154 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 155 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 156 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 157 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 158 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 159 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 160 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 161 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 162 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 163 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 164 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 165 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 166 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 167 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 168 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 169 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 170 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.57 |
| Metatranscriptomes | 1.23 |
| Isolates | 8.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.23 |
| Nodule | 0 |
| Rhizoplane | 5.33 |
| Rhizosphere | 86.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207708_10000030 | 3300026075 | Bacteria | 157064 |
| 2 | Ga0070658_10064933 | 3300005327 | Bacteria | 2978 |
| 3 | Ga0070683_100025623 | 3300005329 | Bacteria | 5299 |
| 4 | Ga0070683_100152679 | 3300005329 | Bacteria | 2189 |
| 5 | Ga0070683_100155165 | 3300005329 | Bacteria | 2171 |
| 6 | Ga0070680_100001295 | 3300005336 | Bacteria | 18097 |
| 7 | Ga0070680_100003101 | 3300005336 | Bacteria | 12334 |
| 8 | Ga0070680_100644166 | 3300005336 | Bacteria | 910 |
| 9 | Ga0070682_100035105 | 3300005337 | Bacteria | 3059 |
| 10 | Ga0070682_100142656 | 3300005337 | Bacteria | 1635 |
| 11 | Ga0070660_100004994 | 3300005339 | Bacteria | 9172 |
| 12 | Ga0070689_100415026 | 3300005340 | Bacteria | 1140 |
| 13 | Ga0070661_100005797 | 3300005344 | Bacteria | 8494 |
| 14 | Ga0070692_10005081 | 3300005345 | Bacteria | 5563 |
| 15 | Ga0070669_100003124 | 3300005353 | Bacteria | 11913 |
| 16 | Ga0070671_100002862 | 3300005355 | Bacteria | 13424 |
| 17 | Ga0070659_100000013 | 3300005366 | Bacteria | 178795 |
| 18 | Ga0070659_100004324 | 3300005366 | Bacteria | 10142 |
| 19 | Ga0070709_10078056 | 3300005434 | Bacteria | 2154 |
| 20 | Ga0070714_100000137 | 3300005435 | Bacteria | 58260 |
| 21 | Ga0070714_100010889 | 3300005435 | Bacteria | 7200 |
| 22 | Ga0070714_100018985 | 3300005435 | Bacteria | 5595 |
| 23 | Ga0070713_100266515 | 3300005436 | Bacteria | 1567 |
| 24 | Ga0070713_100575170 | 3300005436 | Bacteria | 1068 |
| 25 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 26 | Ga0070710_10271782 | 3300005437 | Bacteria | 1096 |
| 27 | Ga0070705_100001368 | 3300005440 | Bacteria | 13011 |
| 28 | Ga0070700_100000035 | 3300005441 | Bacteria | 112177 |
| 29 | Ga0070708_100009715 | 3300005445 | Bacteria | 7764 |
| 30 | Ga0070663_100087160 | 3300005455 | Bacteria | 2307 |
| 31 | Ga0070681_10005112 | 3300005458 | Bacteria | 12660 |
| 32 | Ga0070681_10005996 | 3300005458 | Bacteria | 11779 |
| 33 | Ga0070681_10113196 | 3300005458 | Bacteria | 2653 |
| 34 | Ga0070681_10354936 | 3300005458 | Bacteria | 1376 |
| 35 | Ga0070706_100064615 | 3300005467 | Bacteria | 3383 |
| 36 | Ga0070679_100001987 | 3300005530 | Bacteria | 18362 |
| 37 | Ga0070679_100012603 | 3300005530 | Bacteria | 8085 |
| 38 | Ga0070679_100127551 | 3300005530 | Bacteria | 2526 |
| 39 | Ga0070679_100355877 | 3300005530 | Bacteria | 1411 |
| 40 | Ga0070684_100009511 | 3300005535 | Bacteria | 7659 |
| 41 | Ga0070684_100358694 | 3300005535 | Bacteria | 1341 |
| 42 | Ga0070672_100377410 | 3300005543 | Bacteria | 1212 |
| 43 | Ga0070693_100184599 | 3300005547 | Bacteria | 1345 |
| 44 | Ga0070665_100003340 | 3300005548 | Bacteria | 17181 |
| 45 | Ga0068855_100021951 | 3300005563 | Bacteria | 7653 |
| 46 | Ga0068855_100495744 | 3300005563 | Bacteria | 1328 |
| 47 | Ga0070664_100017242 | 3300005564 | Bacteria | 5931 |
| 48 | Ga0070664_100365837 | 3300005564 | Bacteria | 1314 |
| 49 | Ga0068856_100076176 | 3300005614 | Bacteria | 3323 |
| 50 | Ga0068856_100215266 | 3300005614 | Bacteria | 1936 |
| 51 | Ga0068852_100024029 | 3300005616 | Bacteria | 4918 |
| 52 | Ga0068863_100002777 | 3300005841 | Bacteria | 17340 |
| 53 | Ga0068858_100000014 | 3300005842 | Bacteria | 214686 |
| 54 | Ga0068860_100000054 | 3300005843 | Bacteria | 206114 |
| 55 | Ga0068860_100005792 | 3300005843 | Bacteria | 12444 |
| 56 | Ga0070717_10000004 | 3300006028 | Bacteria | 365525 |
| 57 | Ga0070717_10471696 | 3300006028 | Bacteria | 1133 |
| 58 | Ga0070715_10254779 | 3300006163 | Bacteria | 919 |
| 59 | Ga0068871_100434727 | 3300006358 | Bacteria | 1174 |
| 60 | Ga0075430_100006220 | 3300006846 | Bacteria | 10069 |
| 61 | Ga0075429_100007783 | 3300006880 | Bacteria | 9305 |
| 62 | Ga0105240_10045440 | 3300009093 | Bacteria | 5571 |
| 63 | Ga0105240_10146005 | 3300009093 | Bacteria | 2822 |
| 64 | Ga0105245_10638417 | 3300009098 | Bacteria | 1094 |
| 65 | Ga0105247_10001130 | 3300009101 | Bacteria | 19770 |
| 66 | Ga0105241_10044848 | 3300009174 | Bacteria | 3352 |
| 67 | Ga0105248_10136481 | 3300009177 | Bacteria | 2767 |
| 68 | Ga0105237_10013795 | 3300009545 | Bacteria | 8457 |
| 69 | Ga0105237_10081799 | 3300009545 | Bacteria | 3220 |
| 70 | Ga0105238_10128777 | 3300009551 | Bacteria | 2510 |
| 71 | Ga0105238_10129394 | 3300009551 | Bacteria | 2503 |
| 72 | Ga0105249_10754029 | 3300009553 | Bacteria | 1036 |
| 73 | Ga0105239_10063476 | 3300010375 | Bacteria | 4056 |
| 74 | Ga0157371_10127007 | 3300013102 | Bacteria | 1814 |
| 75 | Ga0157369_10181008 | 3300013105 | Bacteria | 2218 |
| 76 | Ga0163162_10319444 | 3300013306 | Bacteria | 1685 |
| 77 | Ga0163162_10397497 | 3300013306 | Bacteria | 1511 |
| 78 | Ga0157372_10009971 | 3300013307 | Bacteria | 10105 |
| 79 | Ga0157372_10437913 | 3300013307 | Bacteria | 1524 |
| 80 | Ga0157375_10185812 | 3300013308 | Bacteria | 2232 |
| 81 | Ga0157380_10104710 | 3300014326 | Bacteria | 2364 |
| 82 | Ga0157379_10000548 | 3300014968 | Bacteria | 30342 |
| 83 | Ga0163161_10105866 | 3300017792 | Bacteria | 2098 |
| 84 | Ga0206354_10772836 | 3300020081 | Bacteria | 1369 |
| 85 | Ga0206354_11411810 | 3300020081 | Bacteria | 1247 |
| 86 | Ga0206353_10944081 | 3300020082 | Bacteria | 1711 |
| 87 | Ga0207692_10000009 | 3300025898 | Bacteria | 159859 |
| 88 | Ga0207692_10162246 | 3300025898 | Bacteria | 1289 |
| 89 | Ga0207710_10000035 | 3300025900 | Bacteria | 253729 |
| 90 | Ga0207705_10002141 | 3300025909 | Bacteria | 15316 |
| 91 | Ga0207705_10115095 | 3300025909 | Bacteria | 1990 |
| 92 | Ga0207684_10046597 | 3300025910 | Bacteria | 3678 |
| 93 | Ga0207654_10052215 | 3300025911 | Bacteria | 2356 |
| 94 | Ga0207707_10001604 | 3300025912 | Bacteria | 20867 |
| 95 | Ga0207707_10006554 | 3300025912 | Bacteria | 10160 |
| 96 | Ga0207707_10197010 | 3300025912 | Bacteria | 1757 |
| 97 | Ga0207695_10032125 | 3300025913 | Bacteria | 5748 |
| 98 | Ga0207695_10106260 | 3300025913 | Bacteria | 2793 |
| 99 | Ga0207671_10057761 | 3300025914 | Bacteria | 2876 |
| 100 | Ga0207671_10377592 | 3300025914 | Bacteria | 1126 |
| 101 | Ga0207693_10064019 | 3300025915 | Bacteria | 2881 |
| 102 | Ga0207663_10337871 | 3300025916 | Bacteria | 1137 |
| 103 | Ga0207660_10000735 | 3300025917 | Bacteria | 21790 |
| 104 | Ga0207660_10003890 | 3300025917 | Bacteria | 9730 |
| 105 | Ga0207657_10006760 | 3300025919 | Bacteria | 11845 |
| 106 | Ga0207649_10004998 | 3300025920 | Bacteria | 7167 |
| 107 | Ga0207652_10001488 | 3300025921 | Bacteria | 20709 |
| 108 | Ga0207652_10044998 | 3300025921 | Bacteria | 3762 |
| 109 | Ga0207652_10176236 | 3300025921 | Bacteria | 1920 |
| 110 | Ga0207694_10312165 | 3300025924 | Bacteria | 1296 |
| 111 | Ga0207694_10459281 | 3300025924 | Bacteria | 1064 |
| 112 | Ga0207687_10532233 | 3300025927 | Bacteria | 984 |
| 113 | Ga0207664_10000006 | 3300025929 | Bacteria | 408702 |
| 114 | Ga0207664_10001425 | 3300025929 | Bacteria | 15730 |
| 115 | Ga0207664_10007092 | 3300025929 | Bacteria | 7766 |
| 116 | Ga0207664_10040623 | 3300025929 | Bacteria | 3619 |
| 117 | Ga0207644_10138667 | 3300025931 | Bacteria | 1870 |
| 118 | Ga0207690_10000017 | 3300025932 | Bacteria | 243513 |
| 119 | Ga0207690_10008005 | 3300025932 | Bacteria | 6276 |
| 120 | Ga0207709_10072256 | 3300025935 | Bacteria | 2194 |
| 121 | Ga0207709_10270440 | 3300025935 | Bacteria | 1250 |
| 122 | Ga0207665_10400181 | 3300025939 | Bacteria | 1046 |
| 123 | Ga0207691_10155932 | 3300025940 | Bacteria | 2005 |
| 124 | Ga0207661_10002443 | 3300025944 | Bacteria | 12802 |
| 125 | Ga0207661_10027579 | 3300025944 | Bacteria | 4339 |
| 126 | Ga0207661_10100989 | 3300025944 | Bacteria | 2422 |
| 127 | Ga0207679_10010319 | 3300025945 | Bacteria | 6009 |
| 128 | Ga0207679_10442025 | 3300025945 | Bacteria | 1152 |
| 129 | Ga0207667_10060965 | 3300025949 | Bacteria | 3948 |
| 130 | Ga0207667_10532516 | 3300025949 | Bacteria | 1189 |
| 131 | Ga0207703_10000005 | 3300026035 | Bacteria | 506356 |
| 132 | Ga0207639_10018977 | 3300026041 | Bacteria | 4896 |
| 133 | Ga0207702_10015337 | 3300026078 | Bacteria | 6351 |
| 134 | Ga0207702_10173147 | 3300026078 | Bacteria | 1981 |
| 135 | Ga0207702_10718615 | 3300026078 | Bacteria | 985 |
| 136 | Ga0207641_10002048 | 3300026088 | Bacteria | 19177 |
| 137 | Ga0207675_100109142 | 3300026118 | Bacteria | 2610 |
| 138 | Ga0207683_10111456 | 3300026121 | Bacteria | 2450 |
| 139 | Ga0268266_10000968 | 3300028379 | Bacteria | 36525 |
| 140 | Ga0268266_10099663 | 3300028379 | Bacteria | 2558 |
| 141 | Ga0268264_10000097 | 3300028381 | Bacteria | 229722 |
| 142 | Ga0268264_10006971 | 3300028381 | Bacteria | 9486 |
| 143 | Ga0265326_10000045 | 3300028558 | Bacteria | 79810 |
| 144 | Ga0265319_1059077 | 3300028563 | Bacteria | 1248 |
| 145 | Ga0265334_10000012 | 3300028573 | Bacteria | 174358 |
| 146 | Ga0265338_10007079 | 3300028800 | Bacteria | 14059 |
| 147 | Ga0265324_10007445 | 3300029957 | Bacteria | 4432 |
| 148 | Ga0307508_10021617 | 3300031616 | Bacteria | 5850 |
| 149 | Ga0316576_10007314 | 3300031727 | Bacteria | 6940 |
| 150 | Ga0316578_10016418 | 3300031728 | Bacteria | 4007 |
| 151 | Ga0316577_10037467 | 3300031733 | Bacteria | 2711 |
| 152 | Ga0307415_100457551 | 3300032126 | Bacteria | 1105 |
| 153 | Ga0307510_10270464 | 3300033180 | Bacteria | 1176 |
| 154 | Ga0373934_0100478 | 3300035086 | Bacteria | 1170 |
| 155 | Ga0373931_0314688 | 3300035691 | Bacteria | 970 |
| 156 | Ga0316584_0027816 | 3300036712 | Bacteria | 4164 |
| 157 | Ga0400483_051056 | 3300039062 | Bacteria | 3274 |
| 158 | Ga0400483_253308 | 3300039062 | Bacteria | 5430 |
| 159 | Ga0439431_0019033 | 3300041997 | Bacteria | 1629 |
| 160 | Ga0466963_0008763 | 3300044694 | Bacteria | 6075 |
| 161 | Ga0466963_0045175 | 3300044694 | Bacteria | 2901 |
| 162 | Ga0466963_0068014 | 3300044694 | Bacteria | 2391 |
| 163 | Ga0466963_0270749 | 3300044694 | Bacteria | 1193 |
| 164 | Ga0466964_0054876 | 3300044706 | Bacteria | 1644 |
| 165 | Ga0466970_0020269 | 3300044765 | Bacteria | 3453 |
| 166 | Ga0466957_0025328 | 3300044842 | Bacteria | 3516 |
| 167 | Ga0466957_0042404 | 3300044842 | Bacteria | 2753 |
| 168 | Ga0466957_0110453 | 3300044842 | Bacteria | 1743 |
| 169 | Ga0466959_0027203 | 3300045049 | Bacteria | 4242 |
| 170 | Ga0466959_0071742 | 3300045049 | Bacteria | 2507 |
| 171 | Ga0466959_0294521 | 3300045049 | Bacteria | 1112 |
| 172 | Ga0466958_0001886 | 3300045836 | Bacteria | 10241 |
| 173 | Ga0466958_0008281 | 3300045836 | Bacteria | 5756 |
| 174 | Ga0466958_0354386 | 3300045836 | Bacteria | 945 |
| 175 | Ga0466967_0000474 | 3300045976 | Bacteria | 19438 |
| 176 | Ga0466967_0015535 | 3300045976 | Bacteria | 5970 |
| 177 | Ga0466967_0021389 | 3300045976 | Bacteria | 5253 |
| 178 | Ga0466967_0118290 | 3300045976 | Bacteria | 2444 |
| 179 | Ga0466967_0137451 | 3300045976 | Bacteria | 2273 |
| 180 | Ga0466967_0211604 | 3300045976 | Bacteria | 1839 |
| 181 | Ga0466967_0300836 | 3300045976 | Bacteria | 1543 |
| 182 | Ga0466967_0305315 | 3300045976 | Bacteria | 1532 |
| 183 | Ga0466967_0476542 | 3300045976 | Bacteria | 1222 |
| 184 | Ga0495603_0006739 | 3300046455 | Bacteria | 6894 |
| 185 | Ga0495588_0034186 | 3300046674 | Bacteria | 2572 |
| 186 | Ga0495647_0163818 | 3300046681 | Bacteria | 960 |
| 187 | Ga0495658_0027115 | 3300046683 | Bacteria | 3079 |
| 188 | Ga0495613_0369782 | 3300046689 | Bacteria | 982 |
| 189 | Ga0495600_0223735 | 3300046809 | Bacteria | 1203 |
| 190 | Ga0495604_0000148 | 3300047317 | Bacteria | 60608 |
| 191 | Ga0495604_0014629 | 3300047317 | Bacteria | 6255 |
| 192 | Ga0495675_0004773 | 3300047444 | Bacteria | 8236 |
| 193 | Ga0496100_0003950 | 3300048903 | Bacteria | 7794 |
| 194 | Ga0496100_0695750 | 3300048903 | Bacteria | 793 |
| 195 | Ga0496101_0301560 | 3300048904 | Bacteria | 1255 |
| 196 | Ga0496102_0038078 | 3300048905 | Bacteria | 4339 |
| 197 | Ga0496103_0122240 | 3300048906 | Bacteria | 1659 |
| 198 | Ga0496104_0637062 | 3300048907 | Bacteria | 975 |
| 199 | Ga0496109_0130313 | 3300048912 | Bacteria | 2347 |
| 200 | Ga0496110_0213591 | 3300048913 | Bacteria | 1754 |
| 201 | Ga0496114_0291843 | 3300048917 | Bacteria | 1439 |
| 202 | Ga0496115_0000059 | 3300048918 | Bacteria | 102022 |
| 203 | Ga0496115_0000087 | 3300048918 | Bacteria | 86513 |
| 204 | Ga0496115_0001973 | 3300048918 | Bacteria | 14639 |
| 205 | Ga0496119_0017793 | 3300048922 | Bacteria | 5328 |
| 206 | Ga0496121_0010457 | 3300048924 | Bacteria | 10465 |
| 207 | Ga0496122_0000659 | 3300048925 | Bacteria | 69472 |
| 208 | Ga0496124_0080998 | 3300048927 | Bacteria | 2670 |
| 209 | Ga0496125_0000025 | 3300048928 | Bacteria | 440074 |
| 210 | Ga0496126_0210634 | 3300048929 | Bacteria | 1637 |
| 211 | Ga0501033_0003804 | 3300049570 | Bacteria | 12273 |
| 212 | Ga0501034_0028674 | 3300049571 | Bacteria | 5663 |
| 213 | Ga0501043_0107352 | 3300049579 | Bacteria | 2192 |
| 214 | Ga0501047_0012072 | 3300049581 | Bacteria | 8176 |
| 215 | Ga0501070_0164448 | 3300049586 | Bacteria | 1829 |
| 216 | Ga0501044_0420037 | 3300049823 | Bacteria | 1247 |
| 217 | nmdc:mga09592_3784_c1 | 3300050508 | Bacteria | 12177 |
| 218 | nmdc:mga0qj67_677314_c1 | 3300050509 | Bacteria | 822 |
| 219 | Ga0495601_0005538 | 3300053077 | Bacteria | 7367 |
| 220 | Ga0495612_0000032 | 3300053078 | Bacteria | 78122 |
| 221 | Ga0500566_0066511 | 3300053094 | Bacteria | 2031 |
| 222 | Ga0500553_115435 | 3300053101 | Bacteria | 1119 |
| 223 | Ga0500614_033883 | 3300053123 | Bacteria | 1264 |
| 224 | Ga0466962_0093170 | 3300061719 | Bacteria | 1444 |
| 225 | 2552110246 | 2551306166 | Bacteria | 9731570 |
| 226 | 2744957553 | 2744054611 | Bacteria | 5611514 |
| 227 | 2768647478 | 2767802112 | Bacteria | 6465194 |
| 228 | 2793978004 | 2791355406 | Bacteria | 11364898 |
| 229 | 2862710092 | 2862705112 | Bacteria | 6563286 |
| 230 | 2867480696 | 2867475112 | Bacteria | 6909112 |
| 231 | 2995466807 | 2995463766 | Bacteria | 8577691 |
| 232 | 2997454525 | 2997451912 | Bacteria | 8492419 |
| 233 | 2997604118 | 2997600082 | Bacteria | 9896405 |
| 234 | 8008488342 | 8008485437 | Bacteria | 7198341 |
| 235 | 8025530199 | 8025524527 | Bacteria | 7197316 |
| 236 | 8033688309 | 8033684223 | Bacteria | 6906479 |
| 237 | 8047898317 | 8047893842 | Bacteria | 11723082 |
| 238 | 8048133002 | 8048127548 | Bacteria | 11053136 |
| 239 | 8048360577 | 8048356638 | Bacteria | 11044339 |
| 240 | 8048375280 | 8048369669 | Bacteria | 11666822 |
| 241 | 8048382925 | 8048379754 | Bacteria | 11877923 |
| 242 | 8054162588 | 8054160619 | Bacteria | 7783213 |
| 243 | 8056450661 | 8056447290 | Bacteria | 7680491 |
| 244 | 8056450748 | 8056447290 | Bacteria | 7680491 |
| 245 | Ga0207708_10000030 | |||
| 246 | Ga0070658_10064933 | |||
| 247 | Ga0070683_100025623 | |||
| 248 | Ga0070683_100152679 | |||
| 249 | Ga0070683_100155165 | |||
| 250 | Ga0070680_100001295 | |||
| 251 | Ga0070680_100003101 | |||
| 252 | Ga0070680_100644166 | |||
| 253 | Ga0070682_100035105 | |||
| 254 | Ga0070682_100142656 | |||
| 255 | Ga0070660_100004994 | |||
| 256 | Ga0070689_100415026 | |||
| 257 | Ga0070661_100005797 | |||
| 258 | Ga0070692_10005081 | |||
| 259 | Ga0070669_100003124 | |||
| 260 | Ga0070671_100002862 | |||
| 261 | Ga0070659_100000013 | |||
| 262 | Ga0070659_100004324 | |||
| 263 | Ga0070709_10078056 | |||
| 264 | Ga0070714_100000137 | |||
| 265 | Ga0070714_100010889 | |||
| 266 | Ga0070714_100018985 | |||
| 267 | Ga0070713_100266515 | |||
| 268 | Ga0070713_100575170 | |||
| 269 | Ga0070710_10000005 | |||
| 270 | Ga0070710_10271782 | |||
| 271 | Ga0070705_100001368 | |||
| 272 | Ga0070700_100000035 | |||
| 273 | Ga0070708_100009715 | |||
| 274 | Ga0070663_100087160 | |||
| 275 | Ga0070681_10005112 | |||
| 276 | Ga0070681_10005996 | |||
| 277 | Ga0070681_10113196 | |||
| 278 | Ga0070681_10354936 | |||
| 279 | Ga0070706_100064615 | |||
| 280 | Ga0070679_100001987 | |||
| 281 | Ga0070679_100012603 | |||
| 282 | Ga0070679_100127551 | |||
| 283 | Ga0070679_100355877 | |||
| 284 | Ga0070684_100009511 | |||
| 285 | Ga0070684_100358694 | |||
| 286 | Ga0070672_100377410 | |||
| 287 | Ga0070693_100184599 | |||
| 288 | Ga0070665_100003340 | |||
| 289 | Ga0068855_100021951 | |||
| 290 | Ga0068855_100495744 | |||
| 291 | Ga0070664_100017242 | |||
| 292 | Ga0070664_100365837 | |||
| 293 | Ga0068856_100076176 | |||
| 294 | Ga0068856_100215266 | |||
| 295 | Ga0068852_100024029 | |||
| 296 | Ga0068863_100002777 | |||
| 297 | Ga0068858_100000014 | |||
| 298 | Ga0068860_100000054 | |||
| 299 | Ga0068860_100005792 | |||
| 300 | Ga0070717_10000004 | |||
| 301 | Ga0070717_10471696 | |||
| 302 | Ga0070715_10254779 | |||
| 303 | Ga0068871_100434727 | |||
| 304 | Ga0075430_100006220 | |||
| 305 | Ga0075429_100007783 | |||
| 306 | Ga0105240_10045440 | |||
| 307 | Ga0105240_10146005 | |||
| 308 | Ga0105245_10638417 | |||
| 309 | Ga0105247_10001130 | |||
| 310 | Ga0105241_10044848 | |||
| 311 | Ga0105248_10136481 | |||
| 312 | Ga0105237_10013795 | |||
| 313 | Ga0105237_10081799 | |||
| 314 | Ga0105238_10128777 | |||
| 315 | Ga0105238_10129394 | |||
| 316 | Ga0105249_10754029 | |||
| 317 | Ga0105239_10063476 | |||
| 318 | Ga0157371_10127007 | |||
| 319 | Ga0157369_10181008 | |||
| 320 | Ga0163162_10319444 | |||
| 321 | Ga0163162_10397497 | |||
| 322 | Ga0157372_10009971 | |||
| 323 | Ga0157372_10437913 | |||
| 324 | Ga0157375_10185812 | |||
| 325 | Ga0157380_10104710 | |||
| 326 | Ga0157379_10000548 | |||
| 327 | Ga0163161_10105866 | |||
| 328 | Ga0206354_10772836 | |||
| 329 | Ga0206354_11411810 | |||
| 330 | Ga0206353_10944081 | |||
| 331 | Ga0207692_10000009 | |||
| 332 | Ga0207692_10162246 | |||
| 333 | Ga0207710_10000035 | |||
| 334 | Ga0207705_10002141 | |||
| 335 | Ga0207705_10115095 | |||
| 336 | Ga0207684_10046597 | |||
| 337 | Ga0207654_10052215 | |||
| 338 | Ga0207707_10001604 | |||
| 339 | Ga0207707_10006554 | |||
| 340 | Ga0207707_10197010 | |||
| 341 | Ga0207695_10032125 | |||
| 342 | Ga0207695_10106260 | |||
| 343 | Ga0207671_10057761 | |||
| 344 | Ga0207671_10377592 | |||
| 345 | Ga0207693_10064019 | |||
| 346 | Ga0207663_10337871 | |||
| 347 | Ga0207660_10000735 | |||
| 348 | Ga0207660_10003890 | |||
| 349 | Ga0207657_10006760 | |||
| 350 | Ga0207649_10004998 | |||
| 351 | Ga0207652_10001488 | |||
| 352 | Ga0207652_10044998 | |||
| 353 | Ga0207652_10176236 | |||
| 354 | Ga0207694_10312165 | |||
| 355 | Ga0207694_10459281 | |||
| 356 | Ga0207687_10532233 | |||
| 357 | Ga0207664_10000006 | |||
| 358 | Ga0207664_10001425 | |||
| 359 | Ga0207664_10007092 | |||
| 360 | Ga0207664_10040623 | |||
| 361 | Ga0207644_10138667 | |||
| 362 | Ga0207690_10000017 | |||
| 363 | Ga0207690_10008005 | |||
| 364 | Ga0207709_10072256 | |||
| 365 | Ga0207709_10270440 | |||
| 366 | Ga0207665_10400181 | |||
| 367 | Ga0207691_10155932 | |||
| 368 | Ga0207661_10002443 | |||
| 369 | Ga0207661_10027579 | |||
| 370 | Ga0207661_10100989 | |||
| 371 | Ga0207679_10010319 | |||
| 372 | Ga0207679_10442025 | |||
| 373 | Ga0207667_10060965 | |||
| 374 | Ga0207667_10532516 | |||
| 375 | Ga0207703_10000005 | |||
| 376 | Ga0207639_10018977 | |||
| 377 | Ga0207702_10015337 | |||
| 378 | Ga0207702_10173147 | |||
| 379 | Ga0207702_10718615 | |||
| 380 | Ga0207641_10002048 | |||
| 381 | Ga0207675_100109142 | |||
| 382 | Ga0207683_10111456 | |||
| 383 | Ga0268266_10000968 | |||
| 384 | Ga0268266_10099663 | |||
| 385 | Ga0268264_10000097 | |||
| 386 | Ga0268264_10006971 | |||
| 387 | Ga0265326_10000045 | |||
| 388 | Ga0265319_1059077 | |||
| 389 | Ga0265334_10000012 | |||
| 390 | Ga0265338_10007079 | |||
| 391 | Ga0265324_10007445 | |||
| 392 | Ga0307508_10021617 | |||
| 393 | Ga0316576_10007314 | |||
| 394 | Ga0316578_10016418 | |||
| 395 | Ga0316577_10037467 | |||
| 396 | Ga0307415_100457551 | |||
| 397 | Ga0307510_10270464 | |||
| 398 | Ga0373934_0100478 | |||
| 399 | Ga0373931_0314688 | |||
| 400 | Ga0316584_0027816 | |||
| 401 | Ga0400483_051056 | |||
| 402 | Ga0400483_253308 | |||
| 403 | Ga0439431_0019033 | |||
| 404 | Ga0466963_0008763 | |||
| 405 | Ga0466963_0045175 | |||
| 406 | Ga0466963_0068014 | |||
| 407 | Ga0466963_0270749 | |||
| 408 | Ga0466964_0054876 | |||
| 409 | Ga0466970_0020269 | |||
| 410 | Ga0466957_0025328 | |||
| 411 | Ga0466957_0042404 | |||
| 412 | Ga0466957_0110453 | |||
| 413 | Ga0466959_0027203 | |||
| 414 | Ga0466959_0071742 | |||
| 415 | Ga0466959_0294521 | |||
| 416 | Ga0466958_0001886 | |||
| 417 | Ga0466958_0008281 | |||
| 418 | Ga0466958_0354386 | |||
| 419 | Ga0466967_0000474 | |||
| 420 | Ga0466967_0015535 | |||
| 421 | Ga0466967_0021389 | |||
| 422 | Ga0466967_0118290 | |||
| 423 | Ga0466967_0137451 | |||
| 424 | Ga0466967_0211604 | |||
| 425 | Ga0466967_0300836 | |||
| 426 | Ga0466967_0305315 | |||
| 427 | Ga0466967_0476542 | |||
| 428 | Ga0495603_0006739 | |||
| 429 | Ga0495588_0034186 | |||
| 430 | Ga0495647_0163818 | |||
| 431 | Ga0495658_0027115 | |||
| 432 | Ga0495613_0369782 | |||
| 433 | Ga0495600_0223735 | |||
| 434 | Ga0495604_0000148 | |||
| 435 | Ga0495604_0014629 | |||
| 436 | Ga0495675_0004773 | |||
| 437 | Ga0496100_0003950 | |||
| 438 | Ga0496100_0695750 | |||
| 439 | Ga0496101_0301560 | |||
| 440 | Ga0496102_0038078 | |||
| 441 | Ga0496103_0122240 | |||
| 442 | Ga0496104_0637062 | |||
| 443 | Ga0496109_0130313 | |||
| 444 | Ga0496110_0213591 | |||
| 445 | Ga0496114_0291843 | |||
| 446 | Ga0496115_0000059 | |||
| 447 | Ga0496115_0000087 | |||
| 448 | Ga0496115_0001973 | |||
| 449 | Ga0496119_0017793 | |||
| 450 | Ga0496121_0010457 | |||
| 451 | Ga0496122_0000659 | |||
| 452 | Ga0496124_0080998 | |||
| 453 | Ga0496125_0000025 | |||
| 454 | Ga0496126_0210634 | |||
| 455 | Ga0501033_0003804 | |||
| 456 | Ga0501034_0028674 | |||
| 457 | Ga0501043_0107352 | |||
| 458 | Ga0501047_0012072 | |||
| 459 | Ga0501070_0164448 | |||
| 460 | Ga0501044_0420037 | |||
| 461 | nmdc:mga09592_3784_c1 | |||
| 462 | nmdc:mga0qj67_677314_c1 | |||
| 463 | Ga0495601_0005538 | |||
| 464 | Ga0495612_0000032 | |||
| 465 | Ga0500566_0066511 | |||
| 466 | Ga0500553_115435 | |||
| 467 | Ga0500614_033883 | |||
| 468 | Ga0466962_0093170 | |||
| 469 | 2552110246 | |||
| 470 | 2744957553 | |||
| 471 | 2768647478 | |||
| 472 | 2793978004 | |||
| 473 | 2862710092 | |||
| 474 | 2867480696 | |||
| 475 | 2995466807 | |||
| 476 | 2997454525 | |||
| 477 | 2997604118 | |||
| 478 | 8008488342 | |||
| 479 | 8025530199 | |||
| 480 | 8033688309 | |||
| 481 | 8047898317 | |||
| 482 | 8048133002 | |||
| 483 | 8048360577 | |||
| 484 | 8048375280 | |||
| 485 | 8048382925 | |||
| 486 | 8054162588 | |||
| 487 | 8056450661 | |||
| 488 | 8056450748 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9549 | 7 | 227 |
| 7w7a-assembly2.cif.gz_E | heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data | 0.9468 | 6 | 221 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9412 | 4 | 226 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9408 | 4 | 231 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.94 | 4 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9656 | 4 | 227 | 3.40.50.300 |
| af_Q2FUZ1_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9586 | 5 | 239 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.949 | 4 | 227 | 3.40.50.300 |
| af_Q8T665_1_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9483 | 4 | 230 | 3.40.50.300 |
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9467 | 4 | 227 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-R7MIN1-F1-model_v4 | deleted | 0.9826 | 4 | 224 |
|
| AF-E6KSM5-F1-model_v4 | ABC superfamily ATP binding cassette transporter, ABC protein (EC 3.6.3.28) | 0.9813 | 1 | 238 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A239AIX0-F1-model_v4 | Putative ABC transport system ATP-binding protein | 0.9749 | 4 | 241 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A5P2CEQ6-F1-model_v4 | ABC transporter ATP-binding protein | 0.9742 | 5 | 242 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-R7MIN1-F1-model_v4 | deleted | 0.9739 | 4 | 224 |
|