F356645

General Info

Members Datasets Scaffolds Average Seq Length
244 180 216 205

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10258941|Ga0307405_102589412
Length 237
Sequence MPDRRDRRTRAVAWVVVSSDPIRPVIGVLALQGDVREHLAALREQGAEAVTVRRPTELAAVDGLVIPGGESTTMVKLAARFELLEPLRAAIKGGLPAYGSCAGMILLADRILDAPPDQETVGGLDATVRRNAFGRQVDSFESDIAFEGLAGGDVHAVFIRAPWVEEAGEGVAVLGRVVGGAADGRIVAVRQGNLVATSFHPELTGDRRVHALFVDIVRAHLAEQAGAAAGDERGTKR

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
5 2626541554 Frankia sp. AvcI.1 Isolate Nodule
6 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
7 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
8 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
9 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
10 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
11 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
12 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
13 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
14 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
15 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
16 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
17 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
18 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
19 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
20 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
21 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
94 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
95 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
96 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
97 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
101 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
166 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
167 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
168 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
171 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
172 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
175 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
176 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
177 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
178 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
179 8054920844 Frankia tisae Agncl-8 Isolate Nodule
180 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.89
Metatranscriptomes 1.64
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 3.69
Nodule 2.87
Rhizoplane 4.1
Rhizosphere 79.92
Stem 0
Stem Tuber 0
Unclassified 9.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10065484 3300005327 Bacteria 2966
2 Ga0070676_10273672 3300005328 Bacteria 1135
3 Ga0070683_100308478 3300005329 Bacteria 1506
4 Ga0070683_101089034 3300005329 Bacteria 767
5 Ga0070689_100638664 3300005340 Bacteria 925
6 Ga0070668_100831974 3300005347 Bacteria 822
7 Ga0070675_100621133 3300005354 Bacteria 981
8 Ga0070667_100058112 3300005367 Bacteria 3270
9 Ga0070714_100210775 3300005435 Bacteria 1781
10 Ga0070713_100150305 3300005436 Bacteria 2071
11 Ga0070663_100669225 3300005455 Bacteria 880
12 Ga0068855_100404933 3300005563 Bacteria 1495
13 Ga0068852_100566018 3300005616 Bacteria 1138
14 Ga0068862_100812879 3300005844 Bacteria 914
15 Ga0075365_10173279 3300006038 Bacteria 1507
16 Ga0070712_100617161 3300006175 Bacteria 919
17 Ga0075428_100190389 3300006844 Bacteria 2219
18 Ga0075430_100218327 3300006846 Bacteria 1582
19 Ga0075430_100566370 3300006846 Bacteria 937
20 Ga0075429_100149958 3300006880 Bacteria 2041
21 Ga0075429_100625532 3300006880 Bacteria 943
22 Ga0111539_11441935 3300009094 Bacteria 798
23 Ga0105245_10510369 3300009098 Bacteria 1219
24 Ga0105245_10648799 3300009098 Bacteria 1086
25 Ga0105247_10232837 3300009101 Bacteria 1252
26 Ga0114129_10923586 3300009147 Bacteria 1104
27 Ga0105237_10000883 3300009545 Bacteria 40461
28 Ga0105237_11721547 3300009545 Bacteria 634
29 Ga0105239_10016122 3300010375 Bacteria 8267
30 Ga0105239_10088052 3300010375 Bacteria 3423
31 Ga0105239_10670842 3300010375 Bacteria 1185
32 Ga0105239_10680323 3300010375 Bacteria 1176
33 Ga0163162_10363112 3300013306 Bacteria 1581
34 Ga0157375_10200514 3300013308 Bacteria 2151
35 Ga0163163_10339668 3300014325 Bacteria 1557
36 Ga0157379_10090120 3300014968 Bacteria 2751
37 Ga0197907_10780550 3300020069 Bacteria 792
38 Ga0206354_10078329 3300020081 Bacteria 970
39 Ga0206353_10237878 3300020082 Bacteria 3234
40 Ga0207647_10181796 3300025904 Bacteria 1221
41 Ga0207705_10110711 3300025909 Bacteria 2029
42 Ga0207671_10008241 3300025914 Bacteria 8870
43 Ga0207693_10606435 3300025915 Bacteria 852
44 Ga0207660_10321977 3300025917 Bacteria 1235
45 Ga0207659_10342759 3300025926 Bacteria 1238
46 Ga0207700_10124104 3300025928 Bacteria 2098
47 Ga0207670_10218982 3300025936 Bacteria 1456
48 Ga0207704_10449675 3300025938 Bacteria 1028
49 Ga0207661_10386061 3300025944 Bacteria 1268
50 Ga0207667_10535414 3300025949 Bacteria 1186
51 Ga0207712_10508954 3300025961 Bacteria 1030
52 Ga0207703_10834619 3300026035 Bacteria 881
53 Ga0207678_10577472 3300026067 Bacteria 985
54 Ga0268266_10662792 3300028379 Bacteria 1005
55 Ga0307517_10078742 3300028786 Bacteria 2846
56 Ga0307515_10042790 3300028794 Bacteria 7070
57 Ga0307515_10085250 3300028794 Bacteria 4045
58 Ga0265338_10019177 3300028800 Bacteria 7279
59 Ga0307512_10036441 3300030522 Bacteria 4171
60 Ga0265320_10071622 3300031240 Bacteria 1632
61 Ga0265325_10017978 3300031241 Bacteria 3924
62 Ga0265340_10036400 3300031247 Bacteria 2439
63 Ga0265339_10011027 3300031249 Bacteria 5587
64 Ga0307513_10018039 3300031456 Bacteria 8449
65 Ga0316575_10007439 3300031665 Bacteria 3965
66 Ga0316579_10004874 3300031691 Bacteria 5366
67 Ga0316576_10000756 3300031727 Bacteria 16105
68 Ga0316578_10005946 3300031728 Bacteria 5972
69 Ga0307405_10241942 3300031731 Bacteria 1337
70 Ga0307405_10258941 3300031731 Bacteria 1298
71 Ga0316577_10001385 3300031733 Bacteria 11424
72 Ga0307413_10188017 3300031824 Bacteria 1480
73 Ga0307413_10488134 3300031824 Bacteria 986
74 Ga0307518_10185705 3300031838 Bacteria 1399
75 Ga0307410_10015352 3300031852 Bacteria 4540
76 Ga0307410_10091013 3300031852 Bacteria 2165
77 Ga0307410_10094061 3300031852 Bacteria 2134
78 Ga0307410_10278298 3300031852 Bacteria 1312
79 Ga0307406_10491835 3300031901 Bacteria 993
80 Ga0307407_10006618 3300031903 Bacteria 5174
81 Ga0307407_10012036 3300031903 Bacteria 4145
82 Ga0307407_10422190 3300031903 Bacteria 961
83 Ga0307412_10087009 3300031911 Bacteria 2176
84 Ga0307412_10475811 3300031911 Bacteria 1035
85 Ga0307412_10641238 3300031911 Bacteria 905
86 Ga0307409_100008798 3300031995 Bacteria 6155
87 Ga0307409_100010615 3300031995 Bacteria 5741
88 Ga0307409_100283984 3300031995 Bacteria 1531
89 Ga0307409_100540188 3300031995 Bacteria 1142
90 Ga0307416_100126436 3300032002 Bacteria 2290
91 Ga0307416_100250499 3300032002 Bacteria 1723
92 Ga0307416_100262896 3300032002 Bacteria 1688
93 Ga0307416_100599423 3300032002 Bacteria 1181
94 Ga0307414_10153995 3300032004 Bacteria 1817
95 Ga0307414_10228383 3300032004 Bacteria 1533
96 Ga0307414_10462435 3300032004 Bacteria 1115
97 Ga0307411_10427407 3300032005 Bacteria 1102
98 Ga0307411_10494342 3300032005 Bacteria 1033
99 Ga0307415_100016037 3300032126 Bacteria 4453
100 Ga0307415_100085624 3300032126 Bacteria 2265
101 Ga0307415_100140258 3300032126 Bacteria 1845
102 Ga0307415_100440814 3300032126 Bacteria 1123
103 Ga0307415_100512186 3300032126 Bacteria 1051
104 Ga0316583_10001367 3300032133 Bacteria 8095
105 Ga0316585_10008411 3300032137 Bacteria 2994
106 Ga0316580_10003823 3300032139 Bacteria 4313
107 Ga0316596_1008397 3300033541 Bacteria 2460
108 Ga0316574_0001142 3300035398 Bacteria 12208
109 Ga0373947_0448240 3300035725 Bacteria 874
110 Ga0316582_0003402 3300036647 Bacteria 7793
111 Ga0316584_0000227 3300036712 Bacteria 27831
112 Ga0373925_0000030 3300037068 Bacteria 146196
113 Ga0395899_0215244 3300037312 Bacteria 1333
114 Ga0395900_0049607 3300037418 Bacteria 4325
115 Ga0395900_0351188 3300037418 Bacteria 1448
116 Ga0395900_0464348 3300037418 Bacteria 1220
117 Ga0395898_0033267 3300037466 Bacteria 5146
118 Ga0395898_0149502 3300037466 Bacteria 2235
119 Ga0316581_0005374 3300037588 Bacteria 3331
120 Ga0436364_0722735 3300037853 Bacteria 11583
121 Ga0395901_0014043 3300038443 Bacteria 8151
122 Ga0395901_0081625 3300038443 Bacteria 3377
123 Ga0436365_1659885 3300039437 Bacteria 942
124 Ga0451793_0389553 3300041452 Bacteria 2986
125 Ga0466969_0030096 3300044656 Bacteria 2768
126 Ga0466965_0003786 3300044683 Bacteria 6670
127 Ga0466965_0121769 3300044683 Bacteria 1348
128 Ga0466965_0153142 3300044683 Bacteria 1205
129 Ga0466966_0001272 3300044684 Bacteria 16152
130 Ga0466966_0090195 3300044684 Bacteria 1903
131 Ga0466966_0123401 3300044684 Bacteria 1590
132 Ga0466966_0202502 3300044684 Bacteria 1201
133 Ga0466966_0362441 3300044684 Bacteria 871
134 Ga0466963_0060727 3300044694 Bacteria 2525
135 Ga0466963_0373590 3300044694 Bacteria 1005
136 Ga0466963_0417876 3300044694 Bacteria 946
137 Ga0466971_0071644 3300044719 Bacteria 1574
138 Ga0466970_0005048 3300044765 Bacteria 6525
139 Ga0466970_0063234 3300044765 Bacteria 1984
140 Ga0466970_0116046 3300044765 Bacteria 1464
141 Ga0466970_0151592 3300044765 Bacteria 1280
142 Ga0466957_0036728 3300044842 Bacteria 2947
143 Ga0466957_0123001 3300044842 Bacteria 1655
144 Ga0466960_0003602 3300044901 Bacteria 5978
145 Ga0466960_0024934 3300044901 Bacteria 2702
146 Ga0466960_0040751 3300044901 Bacteria 2197
147 Ga0466960_0098338 3300044901 Bacteria 1503
148 Ga0466959_0237630 3300045049 Bacteria 1259
149 Ga0466958_0218559 3300045836 Bacteria 1215
150 Ga0466958_0292844 3300045836 Bacteria 1044
151 Ga0466958_0364184 3300045836 Bacteria 931
152 Ga0466967_0012397 3300045976 Bacteria 6516
153 Ga0466967_0087962 3300045976 Bacteria 2818
154 Ga0466967_0637190 3300045976 Bacteria 1053
155 Ga0466967_0783432 3300045976 Bacteria 946
156 Ga0495638_0169027 3300046460 Bacteria 1256
157 Ga0495639_0078153 3300046475 Bacteria 1537
158 Ga0495596_0049918 3300046500 Bacteria 1640
159 Ga0495620_0181868 3300046515 Bacteria 813
160 Ga0495656_0142517 3300046615 Bacteria 1151
161 Ga0495668_0444181 3300046616 Bacteria 714
162 Ga0495657_0230327 3300046675 Bacteria 1121
163 Ga0496100_0364777 3300048903 Bacteria 1094
164 Ga0496102_0458483 3300048905 Bacteria 1196
165 Ga0496109_0147212 3300048912 Bacteria 2204
166 Ga0496109_0195512 3300048912 Bacteria 1901
167 Ga0496110_0919402 3300048913 Bacteria 781
168 Ga0496111_0222639 3300048914 Bacteria 1402
169 Ga0496114_0235202 3300048917 Bacteria 1610
170 Ga0496114_0241155 3300048917 Bacteria 1590
171 Ga0496114_1317112 3300048917 Bacteria 609
172 Ga0501031_0073965 3300049568 Bacteria 2219
173 Ga0501031_0215486 3300049568 Bacteria 1251
174 Ga0501032_0021369 3300049569 Bacteria 4498
175 Ga0501033_0027477 3300049570 Bacteria 4277
176 Ga0501034_0039406 3300049571 Bacteria 4786
177 Ga0501034_0513788 3300049571 Bacteria 1110
178 Ga0501036_0024921 3300049572 Bacteria 5045
179 Ga0501036_0033374 3300049572 Bacteria 4353
180 Ga0501037_0030518 3300049573 Bacteria 3983
181 Ga0501038_0008141 3300049574 Bacteria 9647
182 Ga0501039_0036668 3300049575 Bacteria 3784
183 Ga0501040_0057604 3300049576 Bacteria 2668
184 Ga0501042_0147500 3300049578 Bacteria 1696
185 Ga0501043_0012549 3300049579 Bacteria 6625
186 Ga0501046_0030781 3300049580 Bacteria 4354
187 Ga0501047_0079018 3300049581 Bacteria 3163
188 Ga0501048_0000008 3300049582 Bacteria 86492
189 Ga0501068_0045635 3300049584 Bacteria 2640
190 Ga0501069_0004306 3300049585 Bacteria 7356
191 Ga0501070_0023527 3300049586 Bacteria 5160
192 Ga0501071_0062946 3300049587 Bacteria 2689
193 Ga0501073_0035778 3300049589 Bacteria 3528
194 Ga0501074_0008320 3300049590 Bacteria 7522
195 Ga0501075_0393970 3300049591 Bacteria 1056
196 Ga0501202_072671 3300049652 Bacteria 796
197 Ga0501080_0000184 3300049742 Bacteria 45504
198 Ga0501080_0003278 3300049742 Bacteria 14297
199 Ga0501081_0172686 3300049743 Bacteria 1561
200 Ga0501081_0653774 3300049743 Bacteria 788
201 Ga0501083_0001818 3300049744 Bacteria 14626
202 Ga0501035_0011862 3300049822 Bacteria 8068
203 Ga0501044_0012752 3300049823 Bacteria 9101
204 Ga0501044_0036640 3300049823 Bacteria 5130
205 nmdc:mga00v17_153640_c1 3300050491 Bacteria 1479
206 nmdc:mga05p37_983489_c1 3300050507 Bacteria 899
207 nmdc:mga09592_87121_c1 3300050508 Bacteria 2665
208 Ga0500643_000978 3300053087 Bacteria 17644
209 Ga0500646_0039164 3300053090 Bacteria 1329
210 Ga0500651_0139179 3300053093 Bacteria 1464
211 Ga0500559_0002326 3300053136 Bacteria 9963
212 Ga0500577_0103122 3300053142 Bacteria 1169
213 Ga0500588_0045777 3300053146 Bacteria 1342
214 Ga0500616_0014721 3300053153 Bacteria 4486
215 Ga0501084_0011493 3300054114 Bacteria 7331
216 Ga0466962_0055129 3300061719 Bacteria 1899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_11721547 Ga0105237_117215471 159
2 3300048917 Ga0496114_0235202 Ga0496114_0235202_679_1323 170
3 3300005616 Ga0068852_100566018 Ga0068852_1005660182 178
4 3300009545 Ga0105237_10000883 Ga0105237_1000088310 178
5 3300010375 Ga0105239_10016122 Ga0105239_100161222 178
6 3300025914 Ga0207671_10008241 Ga0207671_100082412 178
7 3300041452 Ga0451793_0389553 Ga0451793_0389553_1684_2253 179
8 3300049823 Ga0501044_0012752 Ga0501044_0012752_4266_4850 180
9 3300053153 Ga0500616_0014721 Ga0500616_0014721_403_987 181
10 3300005329 Ga0070683_101089034 Ga0070683_1010890341 182
11 3300010375 Ga0105239_10088052 Ga0105239_100880525 182
12 3300013306 Ga0163162_10363112 Ga0163162_103631122 182
13 3300026035 Ga0207703_10834619 Ga0207703_108346192 182
14 3300048905 Ga0496102_0458483 Ga0496102_0458483_560_1141 182
15 3300048912 Ga0496109_0147212 Ga0496109_0147212_98_679 182
16 3300048913 Ga0496110_0919402 Ga0496110_0919402_66_647 182
17 3300048914 Ga0496111_0222639 Ga0496111_0222639_676_1257 182
18 3300048917 Ga0496114_0241155 Ga0496114_0241155_636_1217 182
19 3300048917 Ga0496114_1317112 Ga0496114_1317112_16_597 182
20 3300037068 Ga0373925_0000030 Ga0373925_0000030_62240_62890 183
21 3300044694 Ga0466963_0373590 Ga0466963_0373590_19_600 184
22 3300044901 Ga0466960_0098338 Ga0466960_0098338_776_1396 184
23 3300048903 Ga0496100_0364777 Ga0496100_0364777_166_744 184
24 3300049569 Ga0501032_0021369 Ga0501032_0021369_1444_2055 184
25 3300049570 Ga0501033_0027477 Ga0501033_0027477_1586_2197 184
26 3300049571 Ga0501034_0039406 Ga0501034_0039406_2403_3014 184
27 3300049572 Ga0501036_0024921 Ga0501036_0024921_2190_2801 184
28 3300049573 Ga0501037_0030518 Ga0501037_0030518_1603_2214 184
29 3300049574 Ga0501038_0008141 Ga0501038_0008141_7935_8546 184
30 3300049575 Ga0501039_0036668 Ga0501039_0036668_1461_2072 184
31 3300049578 Ga0501042_0147500 Ga0501042_0147500_453_1064 184
32 3300049579 Ga0501043_0012549 Ga0501043_0012549_1879_2490 184
33 3300049580 Ga0501046_0030781 Ga0501046_0030781_1727_2338 184
34 3300049581 Ga0501047_0079018 Ga0501047_0079018_1451_2062 184
35 3300049582 Ga0501048_0000008 Ga0501048_0000008_1611_2222 184
36 3300049585 Ga0501069_0004306 Ga0501069_0004306_4942_5553 184
37 3300049586 Ga0501070_0023527 Ga0501070_0023527_2245_2856 184
38 3300049587 Ga0501071_0062946 Ga0501071_0062946_1568_2179 184
39 3300049589 Ga0501073_0035778 Ga0501073_0035778_1586_2197 184
40 3300049590 Ga0501074_0008320 Ga0501074_0008320_5789_6400 184
41 3300049742 Ga0501080_0000184 Ga0501080_0000184_8552_9163 184
42 3300049822 Ga0501035_0011862 Ga0501035_0011862_1444_2055 184
43 3300049823 Ga0501044_0036640 Ga0501044_0036640_2305_2916 184
44 3300053087 Ga0500643_000978 Ga0500643_000978_14769_15353 184
45 3300054114 Ga0501084_0011493 Ga0501084_0011493_1619_2230 184
46 3300005328 Ga0070676_10273672 Ga0070676_102736722 185
47 3300005354 Ga0070675_100621133 Ga0070675_1006211331 185
48 3300010375 Ga0105239_10680323 Ga0105239_106803232 185
49 3300014968 Ga0157379_10090120 Ga0157379_100901203 185
50 3300025926 Ga0207659_10342759 Ga0207659_103427591 185
51 3300025938 Ga0207704_10449675 Ga0207704_104496752 185
52 3300028800 Ga0265338_10019177 Ga0265338_100191775 185
53 3300031240 Ga0265320_10071622 Ga0265320_100716222 185
54 3300031241 Ga0265325_10017978 Ga0265325_100179783 185
55 3300031247 Ga0265340_10036400 Ga0265340_100364003 185
56 3300031249 Ga0265339_10011027 Ga0265339_100110277 185
57 3300039437 Ga0436365_1659885 Ga0436365_1659885_141_743 185
58 3300044694 Ga0466963_0417876 Ga0466963_0417876_302_892 185
59 3300044765 Ga0466970_0151592 Ga0466970_0151592_130_726 185
60 3300046475 Ga0495639_0078153 Ga0495639_0078153_486_1076 185
61 iso_pu_bacteria 2579778521 2579852863 185
62 iso_pu_bacteria 2619618881 2619854037 185
63 iso_pu_bacteria 2619619003 2620348987 185
64 iso_pu_bacteria 2626541554 2626638387 185
65 iso_pu_bacteria 8054913762 8054916458 185
66 iso_pu_bacteria 8054920844 8054922043 185
67 3300005435 Ga0070714_100210775 Ga0070714_1002107752 186
68 3300005436 Ga0070713_100150305 Ga0070713_1001503052 186
69 3300006175 Ga0070712_100617161 Ga0070712_1006171612 186
70 3300025915 Ga0207693_10606435 Ga0207693_106064351 186
71 3300025928 Ga0207700_10124104 Ga0207700_101241042 186
72 3300044656 Ga0466969_0030096 Ga0466969_0030096_2125_2712 186
73 3300044684 Ga0466966_0001272 Ga0466966_0001272_6731_7318 186
74 3300045049 Ga0466959_0237630 Ga0466959_0237630_76_663 186
75 3300049743 Ga0501081_0172686 Ga0501081_0172686_10_597 186
76 3300005347 Ga0070668_100831974 Ga0070668_1008319741 187
77 3300009101 Ga0105247_10232837 Ga0105247_102328372 187
78 3300010375 Ga0105239_10670842 Ga0105239_106708422 187
79 3300013308 Ga0157375_10200514 Ga0157375_102005143 187
80 3300014325 Ga0163163_10339668 Ga0163163_103396682 187
81 3300031852 Ga0307410_10094061 Ga0307410_100940612 187
82 3300031903 Ga0307407_10422190 Ga0307407_104221902 187
83 3300031911 Ga0307412_10475811 Ga0307412_104758112 187
84 3300032004 Ga0307414_10228383 Ga0307414_102283832 187
85 3300032005 Ga0307411_10427407 Ga0307411_104274072 187
86 3300032126 Ga0307415_100140258 Ga0307415_1001402582 187
87 3300044684 Ga0466966_0202502 Ga0466966_0202502_324_971 187
88 3300045836 Ga0466958_0292844 Ga0466958_0292844_284_931 187
89 3300045976 Ga0466967_0087962 Ga0466967_0087962_1586_2230 187
90 3300046500 Ga0495596_0049918 Ga0495596_0049918_864_1493 187
91 3300046615 Ga0495656_0142517 Ga0495656_0142517_92_724 187
92 3300046675 Ga0495657_0230327 Ga0495657_0230327_34_621 187
93 3300006038 Ga0075365_10173279 Ga0075365_101732792 188
94 3300045836 Ga0466958_0364184 Ga0466958_0364184_57_701 188
95 iso_pu_bacteria 2929226422 2929228664 188
96 3300005340 Ga0070689_100638664 Ga0070689_1006386642 189
97 3300005844 Ga0068862_100812879 Ga0068862_1008128792 189
98 3300025936 Ga0207670_10218982 Ga0207670_102189822 189
99 3300025961 Ga0207712_10508954 Ga0207712_105089542 189
100 3300049743 Ga0501081_0653774 Ga0501081_0653774_80_682 189
101 3300050491 nmdc:mga00v17_153640_c1 nmdc:mga00v17_153640_c1_865_1467 189
102 iso_pu_bacteria 2855676851 2855680481 189
103 iso_pu_bacteria 2858848962 2858851235 189
104 iso_pu_bacteria 2858888857 2858890838 189
105 iso_pu_bacteria 2858895516 2858899490 189
106 iso_pu_bacteria 2861520306 2861520867 189
107 iso_pu_bacteria 2869048445 2869048687 189
108 iso_pu_bacteria 2996221748 2996227857 189
109 iso_pu_bacteria 8054704163 8054707659 189
110 iso_pu_bacteria 8054727385 8054730433 189
111 iso_pu_bacteria 8054734606 8054739576 189
112 3300006844 Ga0075428_100190389 Ga0075428_1001903892 190
113 3300006846 Ga0075430_100218327 Ga0075430_1002183272 190
114 3300006846 Ga0075430_100566370 Ga0075430_1005663702 190
115 3300006880 Ga0075429_100149958 Ga0075429_1001499582 190
116 3300006880 Ga0075429_100625532 Ga0075429_1006255322 190
117 3300009147 Ga0114129_10923586 Ga0114129_109235862 190
118 3300037312 Ga0395899_0215244 Ga0395899_0215244_639_1238 190
119 3300037418 Ga0395900_0049607 Ga0395900_0049607_1809_2408 190
120 3300037466 Ga0395898_0033267 Ga0395898_0033267_4199_4798 190
121 3300038443 Ga0395901_0014043 Ga0395901_0014043_3353_3952 190
122 3300044684 Ga0466966_0123401 Ga0466966_0123401_794_1546 190
123 3300044719 Ga0466971_0071644 Ga0466971_0071644_642_1286 190
124 3300050507 nmdc:mga05p37_983489_c1 nmdc:mga05p37_983489_c1_262_879 190
125 3300050508 nmdc:mga09592_87121_c1 nmdc:mga09592_87121_c1_135_752 190
126 3300053136 Ga0500559_0002326 Ga0500559_0002326_5055_5681 190
127 iso_pu_bacteria 2863067949 2863068298 190
128 iso_pu_bacteria 2932398195 2932399190 190
129 iso_pu_bacteria 2974315732 2974317489 190
130 iso_pu_bacteria 2984523437 2984525698 190
131 3300009094 Ga0111539_11441935 Ga0111539_114419352 191
132 3300009098 Ga0105245_10510369 Ga0105245_105103692 191
133 3300009098 Ga0105245_10648799 Ga0105245_106487992 191
134 3300028786 Ga0307517_10078742 Ga0307517_100787426 191
135 3300031456 Ga0307513_10018039 Ga0307513_1001803910 191
136 3300031731 Ga0307405_10241942 Ga0307405_102419422 191
137 3300031731 Ga0307405_10258941 Ga0307405_102589412 191
138 3300031824 Ga0307413_10188017 Ga0307413_101880172 191
139 3300031824 Ga0307413_10488134 Ga0307413_104881342 191
140 3300031852 Ga0307410_10015352 Ga0307410_100153523 191
141 3300031852 Ga0307410_10091013 Ga0307410_100910133 191
142 3300031852 Ga0307410_10278298 Ga0307410_102782982 191
143 3300031903 Ga0307407_10006618 Ga0307407_100066182 191
144 3300031903 Ga0307407_10012036 Ga0307407_100120364 191
145 3300031911 Ga0307412_10087009 Ga0307412_100870092 191
146 3300031995 Ga0307409_100008798 Ga0307409_1000087987 191
147 3300031995 Ga0307409_100010615 Ga0307409_1000106156 191
148 3300031995 Ga0307409_100283984 Ga0307409_1002839842 191
149 3300032002 Ga0307416_100126436 Ga0307416_1001264363 191
150 3300032002 Ga0307416_100262896 Ga0307416_1002628962 191
151 3300032002 Ga0307416_100599423 Ga0307416_1005994232 191
152 3300032004 Ga0307414_10153995 Ga0307414_101539953 191
153 3300032004 Ga0307414_10462435 Ga0307414_104624352 191
154 3300032005 Ga0307411_10494342 Ga0307411_104943422 191
155 3300032126 Ga0307415_100016037 Ga0307415_1000160374 191
156 3300032126 Ga0307415_100085624 Ga0307415_1000856242 191
157 3300032126 Ga0307415_100440814 Ga0307415_1004408142 191
158 3300032126 Ga0307415_100512186 Ga0307415_1005121861 191
159 3300035725 Ga0373947_0448240 Ga0373947_0448240_135_794 191
160 3300037418 Ga0395900_0464348 Ga0395900_0464348_438_1115 191
161 3300037853 Ga0436364_0722735 Ga0436364_0722735_5827_6444 191
162 3300044842 Ga0466957_0123001 Ga0466957_0123001_704_1441 191
163 3300046460 Ga0495638_0169027 Ga0495638_0169027_615_1214 191
164 3300046515 Ga0495620_0181868 Ga0495620_0181868_44_739 191
165 3300048912 Ga0496109_0195512 Ga0496109_0195512_374_979 191
166 3300049568 Ga0501031_0073965 Ga0501031_0073965_1218_1826 191
167 3300049568 Ga0501031_0215486 Ga0501031_0215486_141_782 191
168 3300049571 Ga0501034_0513788 Ga0501034_0513788_409_1029 191
169 3300049572 Ga0501036_0033374 Ga0501036_0033374_31_639 191
170 3300049576 Ga0501040_0057604 Ga0501040_0057604_1368_1976 191
171 3300049584 Ga0501068_0045635 Ga0501068_0045635_878_1498 191
172 3300049591 Ga0501075_0393970 Ga0501075_0393970_194_835 191
173 3300049652 Ga0501202_072671 Ga0501202_072671_17_682 191
174 3300049742 Ga0501080_0003278 Ga0501080_0003278_8857_9477 191
175 3300049744 Ga0501083_0001818 Ga0501083_0001818_5061_5681 191
176 3300053090 Ga0500646_0039164 Ga0500646_0039164_263_862 191
177 3300053093 Ga0500651_0139179 Ga0500651_0139179_801_1400 191
178 3300053142 Ga0500577_0103122 Ga0500577_0103122_413_1012 191
179 3300053146 Ga0500588_0045777 Ga0500588_0045777_205_804 191
180 iso_pu_bacteria 2622736605 2623500240 191
181 iso_pu_bacteria 2915358134 2915361964 191
182 iso_pu_bacteria 2915768154 2915771500 191
183 iso_pu_bacteria 3002998708 3003002157 191
184 iso_pu_bacteria 8056207758 8056208009 191
185 3300005367 Ga0070667_100058112 Ga0070667_1000581123 192
186 3300020082 Ga0206353_10237878 Ga0206353_102378783 192
187 3300025917 Ga0207660_10321977 Ga0207660_103219772 192
188 3300028379 Ga0268266_10662792 Ga0268266_106627922 192
189 3300028794 Ga0307515_10042790 Ga0307515_100427907 192
190 3300028794 Ga0307515_10085250 Ga0307515_100852502 192
191 3300030522 Ga0307512_10036441 Ga0307512_100364414 192
192 3300031665 Ga0316575_10007439 Ga0316575_100074393 192
193 3300031691 Ga0316579_10004874 Ga0316579_100048745 192
194 3300031727 Ga0316576_10000756 Ga0316576_100007569 192
195 3300031728 Ga0316578_10005946 Ga0316578_100059465 192
196 3300031733 Ga0316577_10001385 Ga0316577_100013856 192
197 3300031838 Ga0307518_10185705 Ga0307518_101857052 192
198 3300031901 Ga0307406_10491835 Ga0307406_104918352 192
199 3300031911 Ga0307412_10641238 Ga0307412_106412381 192
200 3300031995 Ga0307409_100540188 Ga0307409_1005401882 192
201 3300032002 Ga0307416_100250499 Ga0307416_1002504992 192
202 3300032133 Ga0316583_10001367 Ga0316583_100013675 192
203 3300032137 Ga0316585_10008411 Ga0316585_100084113 192
204 3300032139 Ga0316580_10003823 Ga0316580_100038237 192
205 3300033541 Ga0316596_1008397 Ga0316596_10083972 192
206 3300035398 Ga0316574_0001142 Ga0316574_0001142_3147_3752 192
207 3300036647 Ga0316582_0003402 Ga0316582_0003402_3424_4029 192
208 3300036712 Ga0316584_0000227 Ga0316584_0000227_8457_9062 192
209 3300037418 Ga0395900_0351188 Ga0395900_0351188_544_1194 192
210 3300037466 Ga0395898_0149502 Ga0395898_0149502_352_1002 192
211 3300037588 Ga0316581_0005374 Ga0316581_0005374_1286_1891 192
212 3300038443 Ga0395901_0081625 Ga0395901_0081625_890_1540 192
213 3300044683 Ga0466965_0121769 Ga0466965_0121769_431_1084 192
214 3300044683 Ga0466965_0153142 Ga0466965_0153142_464_1120 192
215 3300044684 Ga0466966_0090195 Ga0466966_0090195_1111_1767 192
216 3300044684 Ga0466966_0362441 Ga0466966_0362441_62_676 192
217 3300044694 Ga0466963_0060727 Ga0466963_0060727_1756_2427 192
218 3300044765 Ga0466970_0063234 Ga0466970_0063234_1200_1856 192
219 3300044765 Ga0466970_0116046 Ga0466970_0116046_394_1056 192
220 3300044842 Ga0466957_0036728 Ga0466957_0036728_196_852 192
221 3300044901 Ga0466960_0024934 Ga0466960_0024934_1969_2631 192
222 3300044901 Ga0466960_0040751 Ga0466960_0040751_166_837 192
223 3300045836 Ga0466958_0218559 Ga0466958_0218559_364_1020 192
224 3300045976 Ga0466967_0012397 Ga0466967_0012397_3693_4337 192
225 3300045976 Ga0466967_0637190 Ga0466967_0637190_265_936 192
226 3300045976 Ga0466967_0783432 Ga0466967_0783432_80_733 192
227 3300046616 Ga0495668_0444181 Ga0495668_0444181_50_703 192
228 3300061719 Ga0466962_0055129 Ga0466962_0055129_649_1305 192
229 iso_pu_bacteria 2791354901 2791910034 192
230 3300044683 Ga0466965_0003786 Ga0466965_0003786_2116_2748 193
231 3300044765 Ga0466970_0005048 Ga0466970_0005048_3855_4487 193
232 3300044901 Ga0466960_0003602 Ga0466960_0003602_2119_2751 193
233 iso_pu_bacteria 8054472261 8054472536 193
234 3300005327 Ga0070658_10065484 Ga0070658_100654842 195
235 3300005329 Ga0070683_100308478 Ga0070683_1003084782 195
236 3300005455 Ga0070663_100669225 Ga0070663_1006692251 195
237 3300005563 Ga0068855_100404933 Ga0068855_1004049332 195
238 3300020069 Ga0197907_10780550 Ga0197907_107805501 195
239 3300020081 Ga0206354_10078329 Ga0206354_100783292 195
240 3300025904 Ga0207647_10181796 Ga0207647_101817962 195
241 3300025909 Ga0207705_10110711 Ga0207705_101107113 195
242 3300025944 Ga0207661_10386061 Ga0207661_103860612 195
243 3300025949 Ga0207667_10535414 Ga0207667_105354142 195
244 3300026067 Ga0207678_10577472 Ga0207678_105774722 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01174

SNO

SNO glutamine amidotransferase family

28

219

0.93

PF03575

Peptidase_S51

Peptidase family S51

34

121

0.88

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

34

207

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv0-assembly1.cif.gz_A structure of the glutaminase subunit pdx2 (yaae) of plp synthase from bacillus subtilis 0.9071 1 194
2iss-assembly1.cif.gz_D structure of the plp synthase holoenzyme from thermotoga maritima 0.904 1 189
2nv0-assembly2.cif.gz_B structure of the glutaminase subunit pdx2 (yaae) of plp synthase from bacillus subtilis 0.8952 1 194
2iss-assembly1.cif.gz_D structure of the plp synthase holoenzyme from thermotoga maritima 0.8947 1 189
2nv0-assembly1.cif.gz_A structure of the glutaminase subunit pdx2 (yaae) of plp synthase from bacillus subtilis 0.8845 1 194
ID Description Score Start End Superfamily
2abwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8716 2 194 3.40.50.880
af_Q03144_12_224_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8687 2 186 3.40.50.880
af_Q9UTE4_20_232_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8632 2 194 3.40.50.880
af_Q8LAD0_1_232_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8597 2 194 3.40.50.880
2abwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8588 2 194 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2S8MQI9-F1-model_v4 deleted 0.9534 2 81
AF-A0A6G3XLL1-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9396 2 81 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A6I3G6M2-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9386 2 81 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-D8GS66-F1-model_v4 glutaminase (EC 3.5.1.2) 0.9368 2 80 GO:0004359
GO:0005829
GO:0006541
GO:0008614
GO:0016829
GO:0042823
GO:1903600
AF-A0A6G9Q405-F1-model_v4 deleted 0.9326 4 80

Feature Viewer

pLDDT pTM Quality
86.68 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map