F356741

General Info

Members Datasets Scaffolds Average Seq Length
244 188 488 158

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0966648|Ga0451576_0966648_40_579
Length 179
Sequence MDMQDITHRRSSAFIGSQVVSMPRLTHFDSKGNAAMVDVTAKAVTERTATAKGSVLMQPETIALISAGGVKKGDVLSVARLAGIMGAKRTPDLIPLCHPLALTSVQVDLAIDKKRNAVDITATCKLAGKTGVEMEALTAVAVAALTVYDMCKAVDRSMRLTEIRLIRKSGGKSGTYEAT

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
73 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
74 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
86 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
87 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
97 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
98 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
102 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
131 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
137 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
148 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
154 2501939600 Micromonospora sp. L5 Isolate Unclassified
155 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
156 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
157 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
158 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
159 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
160 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
161 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
162 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
163 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
164 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
165 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
166 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
167 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
168 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
169 2855683550 Micromonospora sp. RP3T Isolate Unclassified
170 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
171 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
172 2858868258 Micromonospora sp. MH33 Isolate Unclassified
173 2858882152 Micromonospora noduli MED15 Isolate Nodule
174 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
175 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
176 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
177 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
178 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
179 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
180 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
181 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
182 2902582711 Micromonospora sp. AP08 Isolate Unclassified
183 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
184 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
185 649633069 Micromonospora sp. L5 Isolate Unclassified
186 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
187 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
188 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.84
Metatranscriptomes 0.82
Isolates 14.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.51
Nodule 2.46
Rhizoplane 0
Rhizosphere 75.41
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0966648 3300045051 Bacteria 893
2 JGI25152J39213_1000744 3300002773 Bacteria 16643
3 JGI25406J46586_10018052 3300003203 Bacteria 2903
4 Ga0055536_1018249 3300003781 Bacteria 2257
5 Ga0058692_1000955 3300003856 Bacteria 11366
6 Ga0058692_1002632 3300003856 Bacteria 5915
7 Ga0065704_10177229 3300005289 Bacteria 1257
8 Ga0065712_10390296 3300005290 Bacteria 742
9 Ga0070658_10722116 3300005327 Bacteria 865
10 Ga0070676_10751659 3300005328 Bacteria 716
11 Ga0070670_100138692 3300005331 Bacteria 2103
12 Ga0070680_100017505 3300005336 Bacteria 5652
13 Ga0070660_100029049 3300005339 Bacteria 4141
14 Ga0070668_100027806 3300005347 Bacteria 4293
15 Ga0070669_100033643 3300005353 Bacteria 3708
16 Ga0070674_100042190 3300005356 Bacteria 3097
17 Ga0070659_100131902 3300005366 Bacteria 2030
18 Ga0070708_101087408 3300005445 Bacteria 749
19 Ga0070681_10001274 3300005458 Bacteria 21993
20 Ga0070681_10080521 3300005458 Bacteria 3213
21 Ga0070681_10118631 3300005458 Bacteria 2582
22 Ga0070685_10057975 3300005466 Bacteria 2256
23 Ga0070698_100463672 3300005471 Bacteria 1203
24 Ga0070679_100036100 3300005530 Bacteria 4904
25 Ga0070679_100198580 3300005530 Bacteria 1972
26 Ga0070679_100621099 3300005530 Bacteria 1024
27 Ga0068853_101676665 3300005539 Bacteria 616
28 Ga0068855_100591081 3300005563 Bacteria 1198
29 Ga0068855_101447663 3300005563 Bacteria 707
30 Ga0068866_10069947 3300005718 Bacteria 1851
31 Ga0068863_101973936 3300005841 Bacteria 593
32 Ga0068862_100360148 3300005844 Bacteria 1352
33 Ga0081538_10015921 3300005981 Bacteria 5795
34 Ga0081539_10000070 3300005985 Bacteria 235651
35 Ga0070717_11234532 3300006028 Bacteria 680
36 Ga0070716_100769193 3300006173 Bacteria 743
37 Ga0075430_100154840 3300006846 Bacteria 1908
38 Ga0079104_1005246 3300006946 Bacteria 5228
39 Ga0105251_10000374 3300009011 Bacteria 43851
40 Ga0105251_10006664 3300009011 Bacteria 7301
41 Ga0105251_10108451 3300009011 Bacteria 1266
42 Ga0105244_10000006 3300009036 Bacteria 357997
43 Ga0105244_10001185 3300009036 Bacteria 21548
44 Ga0105244_10007370 3300009036 Bacteria 6991
45 Ga0105244_10021827 3300009036 Bacteria 3531
46 Ga0105244_10066222 3300009036 Bacteria 1809
47 Ga0105250_10019474 3300009092 Bacteria 2744
48 Ga0111539_11108735 3300009094 Bacteria 920
49 Ga0105247_10392774 3300009101 Bacteria 986
50 Ga0105248_10474553 3300009177 Bacteria 1410
51 Ga0105237_11038757 3300009545 Bacteria 826
52 Ga0105237_11902282 3300009545 Bacteria 603
53 Ga0105238_10395840 3300009551 Bacteria 1374
54 Ga0105249_10197737 3300009553 Bacteria 1966
55 Ga0157371_10156977 3300013102 Bacteria 1624
56 Ga0157370_10000567 3300013104 Bacteria 46134
57 Ga0157370_10033870 3300013104 Bacteria 4978
58 Ga0157370_10289353 3300013104 Bacteria 1513
59 Ga0157369_10009902 3300013105 Bacteria 10892
60 Ga0157369_10024023 3300013105 Bacteria 6783
61 Ga0157369_11470358 3300013105 Bacteria 693
62 Ga0157372_10059046 3300013307 Bacteria 4289
63 Ga0157372_12254133 3300013307 Bacteria 626
64 Ga0157375_10571411 3300013308 Bacteria 1291
65 Ga0163163_10221959 3300014325 Bacteria 1939
66 Ga0157379_10226354 3300014968 Bacteria 1695
67 Ga0154015_1294928 3300020610 Bacteria 588
68 Ga0213876_10000166 3300021384 Bacteria 69611
69 Ga0209148_1001073 3300025254 Bacteria 16706
70 Ga0209129_1000015 3300025258 Bacteria 487967
71 Ga0209455_1003349 3300025272 Bacteria 5727
72 Ga0209676_1000159 3300025292 Bacteria 161731
73 Ga0209050_1013871 3300025298 Bacteria 3532
74 Ga0207696_1001947 3300025711 Bacteria 10496
75 Ga0207655_1000149 3300025728 Bacteria 129937
76 Ga0207655_1019463 3300025728 Bacteria 3545
77 Ga0207655_1034567 3300025728 Bacteria 2270
78 Ga0207655_1162617 3300025728 Bacteria 696
79 Ga0207713_1036719 3300025735 Bacteria 2098
80 Ga0207713_1086685 3300025735 Bacteria 1111
81 Ga0207642_10057723 3300025899 Bacteria 1787
82 Ga0207705_10446181 3300025909 Bacteria 1003
83 Ga0207707_10027911 3300025912 Bacteria 4936
84 Ga0207707_10115410 3300025912 Bacteria 2346
85 Ga0207693_10542334 3300025915 Bacteria 907
86 Ga0207660_10073699 3300025917 Bacteria 2490
87 Ga0207660_10182257 3300025917 Bacteria 1631
88 Ga0207660_10459604 3300025917 Bacteria 1030
89 Ga0207657_10070634 3300025919 Bacteria 2959
90 Ga0207652_10067672 3300025921 Bacteria 3097
91 Ga0207652_10145591 3300025921 Bacteria 2120
92 Ga0207652_10388329 3300025921 Bacteria 1260
93 Ga0207681_10013307 3300025923 Bacteria 5089
94 Ga0207690_10011807 3300025932 Bacteria 5224
95 Ga0207709_11017107 3300025935 Bacteria 678
96 Ga0207669_10039317 3300025937 Bacteria 2732
97 Ga0207665_10454398 3300025939 Bacteria 983
98 Ga0209281_1004537 3300027111 Bacteria 4131
99 Ga0209371_1000047 3300027312 Bacteria 304732
100 Ga0209371_1000056 3300027312 Bacteria 242255
101 Ga0209371_1002999 3300027312 Bacteria 8745
102 Ga0268256_1000003 3300030500 Bacteria 1289401
103 Ga0268256_1000071 3300030500 Bacteria 187591
104 Ga0268256_1030732 3300030500 Bacteria 1297
105 Ga0265763_1003723 3300030763 Bacteria 1224
106 Ga0265331_10007170 3300031250 Bacteria 6483
107 Ga0265327_10000163 3300031251 Bacteria 143328
108 Ga0265327_10000242 3300031251 Bacteria 109219
109 Ga0265316_10168410 3300031344 Bacteria 1635
110 Ga0307513_10191011 3300031456 Bacteria 1900
111 Ga0265313_10003331 3300031595 Bacteria 13131
112 Ga0307410_10518450 3300031852 Bacteria 983
113 Ga0307406_10844477 3300031901 Bacteria 776
114 Ga0307406_11028565 3300031901 Bacteria 708
115 Ga0307407_10102180 3300031903 Bacteria 1782
116 Ga0307407_10118518 3300031903 Bacteria 1674
117 Ga0307416_100134324 3300032002 Bacteria 2235
118 Ga0307416_101885807 3300032002 Bacteria 701
119 Ga0307414_10258502 3300032004 Bacteria 1452
120 Ga0307411_11023294 3300032005 Bacteria 741
121 Ga0307415_101324262 3300032126 Bacteria 683
122 Ga0373938_0002040 3300034957 Bacteria 3239
123 Ga0373935_0006496 3300035692 Bacteria 6986
124 Ga0316584_0040508 3300036712 Bacteria 3471
125 Ga0316584_0250459 3300036712 Bacteria 1294
126 Ga0395900_0581668 3300037418 Bacteria 1062
127 Ga0395898_0001625 3300037466 Bacteria 30490
128 Ga0395901_0011778 3300038443 Bacteria 8868
129 Ga0436365_0105401 3300039437 Bacteria 69559
130 Ga0436360_0475164 3300039438 Bacteria 762
131 Ga0436360_1185953 3300039438 Bacteria 1940
132 Ga0436361_0282341 3300039447 Bacteria 8324
133 Ga0436361_0954393 3300039447 Bacteria 1239
134 Ga0439438_032469 3300041405 Bacteria 1384
135 Ga0439438_048992 3300041405 Bacteria 1080
136 Ga0451853_2363731 3300041512 Bacteria 619
137 Ga0451853_3738132 3300041512 Bacteria 1053
138 Ga0439452_000029 3300042010 Bacteria 197977
139 Ga0453684_0000006 3300044712 Bacteria 1364191
140 Ga0453684_0011270 3300044712 Bacteria 15040
141 Ga0453684_0030952 3300044712 Bacteria 7541
142 Ga0453684_0045205 3300044712 Bacteria 5878
143 Ga0451576_0091070 3300045051 Bacteria 3172
144 Ga0495603_0384230 3300046455 Bacteria 805
145 Ga0495591_004081 3300046458 Bacteria 7274
146 Ga0495638_0004017 3300046460 Bacteria 11289
147 Ga0495616_0083215 3300046513 Bacteria 1527
148 Ga0495620_0013817 3300046515 Bacteria 4124
149 Ga0495654_0003824 3300046530 Bacteria 9098
150 Ga0495654_0011345 3300046530 Bacteria 4824
151 Ga0495597_0001596 3300046542 Bacteria 15921
152 Ga0495625_0011116 3300046660 Bacteria 7372
153 Ga0495588_0029153 3300046674 Bacteria 2767
154 Ga0495649_0000984 3300046694 Bacteria 22473
155 Ga0495672_0000070 3300047320 Bacteria 184471
156 Ga0495679_000021 3300047446 Bacteria 226183
157 Ga0495679_000893 3300047446 Bacteria 18704
158 Ga0496117_0001907 3300048920 Bacteria 27984
159 Ga0496117_0018339 3300048920 Bacteria 5801
160 Ga0496118_0002095 3300048921 Bacteria 28029
161 Ga0496118_0302856 3300048921 Bacteria 876
162 Ga0496119_0001020 3300048922 Bacteria 35864
163 Ga0496120_0014421 3300048923 Bacteria 5267
164 Ga0496122_0019192 3300048925 Bacteria 6261
165 Ga0496122_0076837 3300048925 Bacteria 2348
166 Ga0496122_0293307 3300048925 Bacteria 881
167 Ga0496123_0000808 3300048926 Bacteria 50515
168 Ga0496123_0012809 3300048926 Bacteria 7110
169 Ga0496124_0076325 3300048927 Bacteria 2766
170 Ga0496125_0218446 3300048928 Bacteria 1230
171 Ga0496126_0118295 3300048929 Bacteria 2301
172 Ga0501034_0435073 3300049571 Bacteria 1231
173 Ga0501038_0158413 3300049574 Bacteria 1842
174 Ga0501039_0247530 3300049575 Bacteria 1402
175 Ga0501040_0275023 3300049576 Bacteria 1203
176 Ga0501041_0214601 3300049577 Bacteria 1207
177 Ga0501043_0341122 3300049579 Bacteria 1140
178 Ga0501046_0851860 3300049580 Bacteria 637
179 Ga0501047_0188956 3300049581 Bacteria 1924
180 Ga0501047_0421158 3300049581 Bacteria 1167
181 Ga0501047_0541320 3300049581 Bacteria 989
182 Ga0501048_0202932 3300049582 Bacteria 1406
183 Ga0501048_0221754 3300049582 Bacteria 1341
184 Ga0501067_0215838 3300049583 Bacteria 1068
185 Ga0501068_0988510 3300049584 Bacteria 555
186 Ga0501069_0261806 3300049585 Bacteria 1010
187 Ga0501070_0129164 3300049586 Bacteria 2088
188 Ga0501071_0114764 3300049587 Bacteria 1993
189 Ga0501072_0153309 3300049588 Bacteria 1837
190 Ga0501073_0225054 3300049589 Bacteria 1296
191 Ga0501076_0089548 3300049592 Bacteria 2474
192 Ga0501077_0029597 3300049593 Bacteria 3482
193 Ga0501079_0306120 3300049741 Bacteria 1243
194 Ga0501080_0125606 3300049742 Bacteria 2376
195 Ga0501081_0211984 3300049743 Bacteria 1407
196 Ga0501081_0622866 3300049743 Bacteria 808
197 Ga0501083_0014992 3300049744 Bacteria 5425
198 Ga0501035_1331027 3300049822 Bacteria 553
199 Ga0501044_0237225 3300049823 Bacteria 1769
200 Ga0501045_0278499 3300049824 Bacteria 1245
201 nmdc:mga08y16_370805_c1 3300050511 Bacteria 1468
202 Ga0500628_000938 3300053129 Bacteria 5126
203 Ga0500559_0031421 3300053136 Bacteria 2278
204 Ga0500616_0190096 3300053153 Bacteria 917
205 Ga0500616_0210109 3300053153 Bacteria 856
206 Ga0501084_0160617 3300054114 Bacteria 1896
207 Ga0590071_137717 3300059421 Bacteria 629
208 Ga0501082_0025890 3300060353 Bacteria 5056
209 Ga0530510_0152958 3300061734 Bacteria 1704
210 2501944837 2501939600 Bacteria 6907073
211 2512032962 2511231221 Bacteria 6846400
212 2515721154 2515154129 Bacteria 5584369
213 2516084239 2515154202 Bacteria 5471270
214 2523107799 2522572158 Bacteria 6514390
215 2599101394 2597490356 Bacteria 7030811
216 2623585736 2622736626 Bacteria 7181580
217 2712470284 2711768156 Bacteria 4471618
218 2772642860 2772190715 Bacteria 6959372
219 2831938153 2831935698 Bacteria 5963223
220 2846542161 2846540461 Bacteria 5471451
221 2846953882 2846952575 Bacteria 6587527
222 2848859932 2848858292 Bacteria 7391279
223 2855674137 2855670206 Bacteria 7120389
224 2855679794 2855676851 Bacteria 7063653
225 2855689815 2855683550 Bacteria 7134265
226 2856859622 2856858025 Bacteria 7255264
227 2857290790 2857288857 Bacteria 7189066
228 2858870882 2858868258 Bacteria 7683772
229 2858885209 2858882152 Bacteria 7230291
230 2858891916 2858888857 Bacteria 7060307
231 2858901940 2858895516 Bacteria 7378898
232 2869053815 2869048445 Bacteria 6875584
233 2869063507 2869061728 Bacteria 7112407
234 2869071272 2869068681 Bacteria 7205615
235 2880494501 2880489317 Bacteria 7096270
236 2891673617 2891670763 Bacteria 4967099
237 2897805555 2897803580 Bacteria 7000062
238 2902588490 2902582711 Bacteria 6187705
239 2923527848 2923525760 Bacteria 4472324
240 2996222849 2996221748 Bacteria 6799777
241 649816330 649633069 Bacteria 6962533
242 8054005001 8054002106 Bacteria 7987183
243 8054729603 8054727385 Bacteria 7558670
244 8054740445 8054734606 Bacteria 6947278
245 Ga0451576_0966648
246 JGI25152J39213_1000744
247 JGI25406J46586_10018052
248 Ga0055536_1018249
249 Ga0058692_1000955
250 Ga0058692_1002632
251 Ga0065704_10177229
252 Ga0065712_10390296
253 Ga0070658_10722116
254 Ga0070676_10751659
255 Ga0070670_100138692
256 Ga0070680_100017505
257 Ga0070660_100029049
258 Ga0070668_100027806
259 Ga0070669_100033643
260 Ga0070674_100042190
261 Ga0070659_100131902
262 Ga0070708_101087408
263 Ga0070681_10001274
264 Ga0070681_10080521
265 Ga0070681_10118631
266 Ga0070685_10057975
267 Ga0070698_100463672
268 Ga0070679_100036100
269 Ga0070679_100198580
270 Ga0070679_100621099
271 Ga0068853_101676665
272 Ga0068855_100591081
273 Ga0068855_101447663
274 Ga0068866_10069947
275 Ga0068863_101973936
276 Ga0068862_100360148
277 Ga0081538_10015921
278 Ga0081539_10000070
279 Ga0070717_11234532
280 Ga0070716_100769193
281 Ga0075430_100154840
282 Ga0079104_1005246
283 Ga0105251_10000374
284 Ga0105251_10006664
285 Ga0105251_10108451
286 Ga0105244_10000006
287 Ga0105244_10001185
288 Ga0105244_10007370
289 Ga0105244_10021827
290 Ga0105244_10066222
291 Ga0105250_10019474
292 Ga0111539_11108735
293 Ga0105247_10392774
294 Ga0105248_10474553
295 Ga0105237_11038757
296 Ga0105237_11902282
297 Ga0105238_10395840
298 Ga0105249_10197737
299 Ga0157371_10156977
300 Ga0157370_10000567
301 Ga0157370_10033870
302 Ga0157370_10289353
303 Ga0157369_10009902
304 Ga0157369_10024023
305 Ga0157369_11470358
306 Ga0157372_10059046
307 Ga0157372_12254133
308 Ga0157375_10571411
309 Ga0163163_10221959
310 Ga0157379_10226354
311 Ga0154015_1294928
312 Ga0213876_10000166
313 Ga0209148_1001073
314 Ga0209129_1000015
315 Ga0209455_1003349
316 Ga0209676_1000159
317 Ga0209050_1013871
318 Ga0207696_1001947
319 Ga0207655_1000149
320 Ga0207655_1019463
321 Ga0207655_1034567
322 Ga0207655_1162617
323 Ga0207713_1036719
324 Ga0207713_1086685
325 Ga0207642_10057723
326 Ga0207705_10446181
327 Ga0207707_10027911
328 Ga0207707_10115410
329 Ga0207693_10542334
330 Ga0207660_10073699
331 Ga0207660_10182257
332 Ga0207660_10459604
333 Ga0207657_10070634
334 Ga0207652_10067672
335 Ga0207652_10145591
336 Ga0207652_10388329
337 Ga0207681_10013307
338 Ga0207690_10011807
339 Ga0207709_11017107
340 Ga0207669_10039317
341 Ga0207665_10454398
342 Ga0209281_1004537
343 Ga0209371_1000047
344 Ga0209371_1000056
345 Ga0209371_1002999
346 Ga0268256_1000003
347 Ga0268256_1000071
348 Ga0268256_1030732
349 Ga0265763_1003723
350 Ga0265331_10007170
351 Ga0265327_10000163
352 Ga0265327_10000242
353 Ga0265316_10168410
354 Ga0307513_10191011
355 Ga0265313_10003331
356 Ga0307410_10518450
357 Ga0307406_10844477
358 Ga0307406_11028565
359 Ga0307407_10102180
360 Ga0307407_10118518
361 Ga0307416_100134324
362 Ga0307416_101885807
363 Ga0307414_10258502
364 Ga0307411_11023294
365 Ga0307415_101324262
366 Ga0373938_0002040
367 Ga0373935_0006496
368 Ga0316584_0040508
369 Ga0316584_0250459
370 Ga0395900_0581668
371 Ga0395898_0001625
372 Ga0395901_0011778
373 Ga0436365_0105401
374 Ga0436360_0475164
375 Ga0436360_1185953
376 Ga0436361_0282341
377 Ga0436361_0954393
378 Ga0439438_032469
379 Ga0439438_048992
380 Ga0451853_2363731
381 Ga0451853_3738132
382 Ga0439452_000029
383 Ga0453684_0000006
384 Ga0453684_0011270
385 Ga0453684_0030952
386 Ga0453684_0045205
387 Ga0451576_0091070
388 Ga0495603_0384230
389 Ga0495591_004081
390 Ga0495638_0004017
391 Ga0495616_0083215
392 Ga0495620_0013817
393 Ga0495654_0003824
394 Ga0495654_0011345
395 Ga0495597_0001596
396 Ga0495625_0011116
397 Ga0495588_0029153
398 Ga0495649_0000984
399 Ga0495672_0000070
400 Ga0495679_000021
401 Ga0495679_000893
402 Ga0496117_0001907
403 Ga0496117_0018339
404 Ga0496118_0002095
405 Ga0496118_0302856
406 Ga0496119_0001020
407 Ga0496120_0014421
408 Ga0496122_0019192
409 Ga0496122_0076837
410 Ga0496122_0293307
411 Ga0496123_0000808
412 Ga0496123_0012809
413 Ga0496124_0076325
414 Ga0496125_0218446
415 Ga0496126_0118295
416 Ga0501034_0435073
417 Ga0501038_0158413
418 Ga0501039_0247530
419 Ga0501040_0275023
420 Ga0501041_0214601
421 Ga0501043_0341122
422 Ga0501046_0851860
423 Ga0501047_0188956
424 Ga0501047_0421158
425 Ga0501047_0541320
426 Ga0501048_0202932
427 Ga0501048_0221754
428 Ga0501067_0215838
429 Ga0501068_0988510
430 Ga0501069_0261806
431 Ga0501070_0129164
432 Ga0501071_0114764
433 Ga0501072_0153309
434 Ga0501073_0225054
435 Ga0501076_0089548
436 Ga0501077_0029597
437 Ga0501079_0306120
438 Ga0501080_0125606
439 Ga0501081_0211984
440 Ga0501081_0622866
441 Ga0501083_0014992
442 Ga0501035_1331027
443 Ga0501044_0237225
444 Ga0501045_0278499
445 nmdc:mga08y16_370805_c1
446 Ga0500628_000938
447 Ga0500559_0031421
448 Ga0500616_0190096
449 Ga0500616_0210109
450 Ga0501084_0160617
451 Ga0590071_137717
452 Ga0501082_0025890
453 Ga0530510_0152958
454 2501944837
455 2512032962
456 2515721154
457 2516084239
458 2523107799
459 2599101394
460 2623585736
461 2712470284
462 2772642860
463 2831938153
464 2846542161
465 2846953882
466 2848859932
467 2855674137
468 2855679794
469 2855689815
470 2856859622
471 2857290790
472 2858870882
473 2858885209
474 2858891916
475 2858901940
476 2869053815
477 2869063507
478 2869071272
479 2880494501
480 2891673617
481 2897805555
482 2902588490
483 2923527848
484 2996222849
485 649816330
486 8054005001
487 8054729603
488 8054740445

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01967

MoaC

MoaC family

36

171

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9836 13 157
4pyd-assembly1.cif.gz_A moac in complex with cpmp crystallized in space group p212121 0.9768 13 157
4fdf-assembly1.cif.gz_B structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9716 12 147
4fdf-assembly1.cif.gz_A structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv 0.9706 11 147
4pya-assembly1.cif.gz_A moac k51a in complex with 3',8-ch2gtp 0.9691 23 146
ID Description Score Start End Superfamily
4fdfA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9706 11 147 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.967 11 156 3.30.70.640
2ohdB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9657 15 145 3.30.70.640
af_B4FJH5_64_220_3.30.70.640 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9653 4 158 3.30.70.640
1ekrA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Molybdopterin cofactor biosynthesis C (MoaC) domain 0.9604 11 156 3.30.70.640
ID Description Score Start End GO Terms
AF-A0A848P3A3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 1.002 22 156 GO:0006777
GO:0061798
GO:0061799
AF-A0A7C2SMW5-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9975 31 158 GO:0006777
GO:0061798
GO:0061799
AF-X0TEN6-F1-model_v4 Molybdopterin cofactor biosynthesis C (MoaC) domain-containing protein 0.9959 15 112 GO:0006777
AF-A0A4Q2XSH4-F1-model_v4 deleted 0.9957 27 157
AF-A0A848P3A3-F1-model_v4 cyclic pyranopterin monophosphate synthase (EC 4.6.1.17) 0.9951 22 156 GO:0006777
GO:0061798
GO:0061799

Map