F356771

General Info

Members Datasets Scaffolds Average Seq Length
244 122 488 200

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0026750|Ga0495605_0026750_1997_2674
Length 225
Sequence MCIQHGGRDAARRFIFFFSRPMPTLRRLSLFVLAAALAGCATTATQMPGAAPGVAQAVAPYRDTIELTGRLQVTYQKDGQPGSTNGGFEWSQRPGQIDVAFLSPLKQTVATISVTPQQATLTEAGRAPRTAQDIDTLSAQALGWSLPVSGLRDWLQGYATGADGKRFAASPANNSVFTQDGWRLRFVSWQAGKDGAQMPRNIVAERGAGAAGGELAIQIILDPAA

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
22 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
23 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
24 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
25 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
37 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
42 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
43 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
44 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
45 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
46 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
49 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
50 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
51 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
52 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
53 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
54 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
55 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
56 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
57 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
58 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
59 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
60 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
61 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
62 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
63 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
64 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
65 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
68 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
69 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
72 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
77 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
78 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
79 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
89 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
90 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
91 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
92 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
103 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
104 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
106 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
107 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
108 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
109 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
110 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
111 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
112 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
113 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
114 2643221638 Duganella sp. Root336D2 Isolate Unclassified
115 2643221645 Massilia sp. Root351 Isolate Unclassified
116 2643221664 Massilia sp. Root418 Isolate Unclassified
117 2738541280 Massilia sp. GV090 Isolate Unclassified
118 2738541300 Massilia sp. GV016 Isolate Unclassified
119 2738543018 Massilia sp. GV045 Isolate Unclassified
120 2738543030 Massilia sp. GV097 Isolate Unclassified
121 2857558681 Duganella sp. R-74565 Isolate Unclassified
122 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.49
Metatranscriptomes 0.41
Isolates 4.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.77
Nodule 0
Rhizoplane 2.05
Rhizosphere 69.67
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0026750 3300046474 Bacteria 2996
2 JGI25158J39367_1002242 3300002739 Bacteria 3208
3 JGI25158J39367_1002327 3300002739 Bacteria 3116
4 JGI25152J39213_1000224 3300002773 Bacteria 38367
5 JGI25150J39212_1003199 3300002774 Bacteria 3879
6 JGI25150J39212_1003200 3300002774 Bacteria 3879
7 JGI25159J45721_1011592 3300002987 Bacteria 2150
8 JGI25153J46596_10004513 3300003215 Bacteria 7491
9 JGI25160J50197_1001176 3300003354 Bacteria 13335
10 JGI25161J50226_1003233 3300003374 Bacteria 3815
11 JGI25161J50226_1003882 3300003374 Bacteria 3264
12 Ga0055526_1007594 3300003771 Bacteria 5596
13 Ga0055526_1011618 3300003771 Bacteria 3944
14 Ga0055537_1005266 3300003773 Bacteria 3506
15 Ga0055537_1008757 3300003773 Bacteria 2298
16 Ga0055537_1020363 3300003773 Bacteria 1008
17 Ga0055524_1001031 3300003775 Bacteria 17211
18 Ga0055524_1001453 3300003775 Bacteria 13555
19 Ga0055524_1001929 3300003775 Bacteria 11171
20 Ga0055534_1003242 3300003784 Bacteria 5206
21 Ga0055528_1004830 3300003790 Bacteria 6407
22 Ga0055530_10001965 3300003791 Bacteria 13987
23 Ga0055530_10007154 3300003791 Bacteria 4776
24 Ga0055530_10008778 3300003791 Bacteria 3992
25 Ga0055531_10038696 3300003794 Bacteria 1427
26 Ga0055531_10062887 3300003794 Bacteria 896
27 Ga0055543_1000924 3300004625 Bacteria 13678
28 Ga0065165_1002806 3300005262 Bacteria 13678
29 Ga0070717_10149922 3300006028 Bacteria 2017
30 Ga0075362_10021404 3300006177 Bacteria 2713
31 Ga0105244_10000158 3300009036 Bacteria 70253
32 Ga0209436_100797 3300025208 Bacteria 12952
33 Ga0209436_101578 3300025208 Bacteria 7687
34 Ga0207425_1000021 3300025245 Bacteria 367537
35 Ga0207425_1000223 3300025245 Bacteria 44555
36 Ga0209129_1000020 3300025258 Bacteria 457053
37 Ga0209129_1010060 3300025258 Bacteria 2406
38 Ga0209565_1003210 3300025263 Bacteria 5411
39 Ga0209565_1004805 3300025263 Bacteria 4042
40 Ga0209565_1012624 3300025263 Bacteria 2008
41 Ga0209565_1013045 3300025263 Bacteria 1958
42 Ga0209673_1007934 3300025273 Bacteria 4796
43 Ga0209130_1001646 3300025284 Bacteria 13692
44 Ga0209130_1002777 3300025284 Bacteria 8234
45 Ga0209130_1011412 3300025284 Bacteria 2380
46 Ga0209675_1001690 3300025291 Bacteria 12237
47 Ga0209564_1000780 3300025295 Bacteria 44199
48 Ga0209564_1001271 3300025295 Bacteria 27762
49 Ga0209564_1016913 3300025295 Bacteria 2875
50 Ga0209758_1000077 3300025297 Bacteria 268195
51 Ga0209050_1000050 3300025298 Bacteria 362578
52 Ga0209050_1000795 3300025298 Bacteria 44648
53 Ga0209256_1000674 3300025299 Bacteria 46225
54 Ga0209256_1003939 3300025299 Bacteria 9768
55 Ga0209256_1009037 3300025299 Bacteria 4459
56 Ga0207426_1001270 3300025302 Bacteria 22014
57 Ga0207426_1034905 3300025302 Bacteria 1610
58 Ga0209257_1000075 3300025304 Bacteria 324855
59 Ga0209257_1007416 3300025304 Bacteria 6628
60 Ga0207655_1000710 3300025728 Bacteria 38274
61 Ga0307515_10076511 3300028794 Bacteria 4438
62 Ga0316181_1133521 3300030744 Bacteria 1184
63 Ga0316182_1165756 3300030745 Bacteria 1340
64 Ga0316182_1326139 3300030745 Bacteria 1503
65 Ga0307408_100000531 3300031548 Bacteria 32967
66 Ga0307408_100002011 3300031548 Bacteria 14673
67 Ga0307408_100004170 3300031548 Bacteria 9847
68 Ga0307408_100005814 3300031548 Bacteria 8206
69 Ga0307408_100188878 3300031548 Bacteria 1658
70 Ga0307416_100009231 3300032002 Bacteria 6438
71 Ga0395898_0891512 3300037466 Bacteria 828
72 Ga0395905_0434785 3300037471 Bacteria 1209
73 Ga0450904_000434 3300042139 Bacteria 8372
74 Ga0466965_0010758 3300044683 Bacteria 4279
75 Ga0495617_001655 3300046452 Bacteria 9583
76 Ga0495617_074942 3300046452 Bacteria 1110
77 Ga0495617_097013 3300046452 Bacteria 959
78 Ga0495603_0428973 3300046455 Unclassified 757
79 Ga0495590_0003253 3300046457 Bacteria 6641
80 Ga0495638_0001049 3300046460 Bacteria 27280
81 Ga0495650_0001065 3300046471 Bacteria 30418
82 Ga0495605_0000667 3300046474 Bacteria 26082
83 Ga0495639_0104156 3300046475 Bacteria 1342
84 Ga0495584_0000887 3300046491 Bacteria 19216
85 Ga0495584_0020591 3300046491 Bacteria 3349
86 Ga0495584_0105932 3300046491 Bacteria 1421
87 Ga0495585_0015064 3300046492 Bacteria 4494
88 Ga0495585_0021316 3300046492 Bacteria 3721
89 Ga0495585_0087585 3300046492 Bacteria 1680
90 Ga0495594_0037981 3300046499 Bacteria 2628
91 Ga0495607_0014940 3300046501 Bacteria 5047
92 Ga0495607_0030963 3300046501 Bacteria 3278
93 Ga0495607_0041332 3300046501 Bacteria 2740
94 Ga0495607_0122167 3300046501 Bacteria 1365
95 Ga0495583_0000214 3300046506 Bacteria 97639
96 Ga0495583_0000317 3300046506 Bacteria 76193
97 Ga0495583_0004572 3300046506 Bacteria 9824
98 Ga0495583_0034912 3300046506 Bacteria 2405
99 Ga0495583_0035240 3300046506 Bacteria 2390
100 Ga0495583_0039593 3300046506 Bacteria 2219
101 Ga0495606_0000433 3300046507 Bacteria 69506
102 Ga0495606_0009741 3300046507 Bacteria 8083
103 Ga0495606_0013970 3300046507 Bacteria 6297
104 Ga0495606_0033422 3300046507 Bacteria 3547
105 Ga0495606_0055327 3300046507 Bacteria 2566
106 Ga0495610_0036284 3300046512 Bacteria 2521
107 Ga0495610_0050255 3300046512 Bacteria 2036
108 Ga0495616_0000234 3300046513 Bacteria 45006
109 Ga0495616_0007800 3300046513 Bacteria 6387
110 Ga0495616_0080829 3300046513 Bacteria 1555
111 Ga0495616_0210302 3300046513 Bacteria 851
112 Ga0495631_0019798 3300046518 Bacteria 3152
113 Ga0495631_0031779 3300046518 Bacteria 2383
114 Ga0495631_0033162 3300046518 Bacteria 2321
115 Ga0495631_0134171 3300046518 Bacteria 1063
116 Ga0495637_0002381 3300046520 Bacteria 10416
117 Ga0495643_0001515 3300046522 Bacteria 20976
118 Ga0495643_0297895 3300046522 Bacteria 736
119 Ga0495644_0001273 3300046523 Bacteria 10323
120 Ga0495644_0073221 3300046523 Bacteria 1288
121 Ga0495648_0006792 3300046524 Bacteria 9253
122 Ga0495648_0021374 3300046524 Bacteria 4481
123 Ga0495648_0053716 3300046524 Bacteria 2439
124 Ga0495663_0009792 3300046525 Bacteria 2660
125 Ga0495663_0029087 3300046525 Bacteria 1629
126 Ga0495663_0241765 3300046525 Bacteria 639
127 Ga0495666_0036649 3300046526 Bacteria 2388
128 Ga0495666_0045897 3300046526 Bacteria 2107
129 Ga0495642_0004615 3300046528 Bacteria 5337
130 Ga0495642_0014808 3300046528 Bacteria 3025
131 Ga0495642_0113342 3300046528 Bacteria 1160
132 Ga0495654_0005774 3300046530 Bacteria 7133
133 Ga0495654_0084375 3300046530 Bacteria 1484
134 Ga0495598_0034171 3300046537 Bacteria 1448
135 Ga0495609_0001512 3300046538 Bacteria 15329
136 Ga0495609_0064987 3300046538 Bacteria 1609
137 Ga0495609_0073519 3300046538 Bacteria 1500
138 Ga0495597_0001027 3300046542 Bacteria 21345
139 Ga0495597_0002718 3300046542 Bacteria 10912
140 Ga0495597_0080945 3300046542 Bacteria 1389
141 Ga0495597_0114357 3300046542 Bacteria 1129
142 Ga0495622_0270754 3300046557 Bacteria 744
143 Ga0495633_0004606 3300046558 Bacteria 8688
144 Ga0495633_0040687 3300046558 Bacteria 2213
145 Ga0495633_0084029 3300046558 Bacteria 1480
146 Ga0495633_0147993 3300046558 Bacteria 1085
147 Ga0495656_0019215 3300046615 Bacteria 2636
148 Ga0495656_0037511 3300046615 Bacteria 2002
149 Ga0495656_0097894 3300046615 Bacteria 1352
150 Ga0495656_0148057 3300046615 Bacteria 1132
151 Ga0495656_0156675 3300046615 Bacteria 1104
152 Ga0495668_0148073 3300046616 Bacteria 1285
153 Ga0495668_0228345 3300046616 Bacteria 1019
154 Ga0495611_0005391 3300046648 Bacteria 5474
155 Ga0495611_0009582 3300046648 Bacteria 4091
156 Ga0495611_0014490 3300046648 Bacteria 3368
157 Ga0495611_0020041 3300046648 Bacteria 2876
158 Ga0495625_0017495 3300046660 Bacteria 5612
159 Ga0495625_0055817 3300046660 Bacteria 2815
160 Ga0495625_0129961 3300046660 Bacteria 1707
161 Ga0495625_0141482 3300046660 Bacteria 1623
162 Ga0495625_0164333 3300046660 Bacteria 1485
163 Ga0495625_0383061 3300046660 Bacteria 882
164 Ga0495659_0000127 3300046664 Bacteria 33507
165 Ga0495659_0211925 3300046664 Unclassified 797
166 Ga0495661_0041357 3300046665 Bacteria 2852
167 Ga0495588_0005801 3300046674 Bacteria 5522
168 Ga0495588_0121000 3300046674 Bacteria 1380
169 Ga0495588_0173705 3300046674 Bacteria 1139
170 Ga0495588_0228578 3300046674 Bacteria 981
171 Ga0495588_0282593 3300046674 Bacteria 874
172 Ga0495670_0000952 3300046691 Bacteria 14003
173 Ga0495670_0003933 3300046691 Bacteria 7298
174 Ga0495670_0176541 3300046691 Bacteria 1126
175 Ga0495670_0192752 3300046691 Bacteria 1078
176 Ga0495671_0000266 3300046692 Bacteria 44137
177 Ga0495671_0104623 3300046692 Bacteria 1382
178 Ga0495671_0201009 3300046692 Bacteria 966
179 Ga0495649_0354268 3300046694 Bacteria 741
180 Ga0495589_0344957 3300046794 Bacteria 686
181 Ga0495660_0002471 3300046810 Bacteria 11786
182 Ga0495660_0010534 3300046810 Bacteria 5379
183 Ga0495581_0135354 3300047315 Bacteria 1436
184 Ga0495636_0052998 3300047318 Bacteria 1702
185 Ga0495672_0000013 3300047320 Bacteria 511827
186 Ga0495672_0000297 3300047320 Bacteria 68017
187 Ga0495672_0014412 3300047320 Bacteria 5414
188 Ga0495672_0014860 3300047320 Bacteria 5310
189 Ga0495672_0016997 3300047320 Bacteria 4874
190 Ga0495672_0053061 3300047320 Bacteria 2378
191 Ga0495672_0063954 3300047320 Bacteria 2109
192 Ga0495676_0028749 3300047321 Bacteria 4743
193 Ga0495683_0000773 3300047323 Bacteria 22984
194 Ga0495687_000342 3300047443 Bacteria 59692
195 Ga0495677_0006287 3300047445 Bacteria 4487
196 Ga0495677_0014677 3300047445 Bacteria 2849
197 Ga0495685_000088 3300047447 Bacteria 33952
198 Ga0495685_014202 3300047447 Bacteria 2706
199 Ga0495685_065597 3300047447 Bacteria 1220
200 Ga0495685_088505 3300047447 Bacteria 1028
201 Ga0495673_0000201 3300047469 Bacteria 92885
202 Ga0495673_0002265 3300047469 Bacteria 13803
203 Ga0495681_0019418 3300047470 Bacteria 3712
204 Ga0495686_0001635 3300047472 Bacteria 23409
205 Ga0495686_0005717 3300047472 Bacteria 9714
206 Ga0495686_0007524 3300047472 Bacteria 8155
207 Ga0495686_0129456 3300047472 Bacteria 1497
208 Ga0495686_0294324 3300047472 Bacteria 898
209 Ga0495602_0145442 3300048088 Bacteria 1871
210 Ga0495615_0010910 3300048090 Bacteria 1831
211 Ga0495626_0003195 3300048091 Bacteria 10652
212 Ga0495626_0003892 3300048091 Bacteria 9357
213 Ga0495626_0020876 3300048091 Bacteria 3259
214 Ga0495626_0027102 3300048091 Bacteria 2787
215 Ga0496102_0000074 3300048905 Bacteria 148938
216 Ga0496103_0009168 3300048906 Bacteria 5860
217 Ga0496103_0011578 3300048906 Bacteria 5230
218 Ga0496115_0096268 3300048918 Bacteria 2423
219 Ga0496115_0802584 3300048918 Bacteria 732
220 Ga0496124_0091538 3300048927 Bacteria 2478
221 Ga0495678_002976 3300049459 Bacteria 10802
222 Ga0495678_009096 3300049459 Bacteria 4954
223 Ga0495682_0001031 3300049460 Bacteria 16453
224 Ga0495682_0001462 3300049460 Bacteria 12666
225 Ga0501323_042151 3300049539 Unclassified 672
226 Ga0501211_006482 3300049658 Bacteria 1157
227 Ga0501227_010218 3300049665 Bacteria 2032
228 Ga0501227_053887 3300049665 Bacteria 1020
229 Ga0501230_011999 3300049667 Bacteria 1381
230 Ga0501249_018362 3300049679 Bacteria 1513
231 Ga0501269_000528 3300049766 Bacteria 7632
232 Ga0501279_003275 3300049775 Bacteria 2108
233 Ga0500618_013570 3300053125 Bacteria 2100
234 Ga0500586_017316 3300053145 Bacteria 2202
235 2643792031 2643221554 Bacteria 6603920
236 2644216487 2643221638 Bacteria 6579467
237 2644254768 2643221645 Bacteria 7207331
238 2644360320 2643221664 Bacteria 7272945
239 2738738075 2738541280 Bacteria 6630198
240 2738843134 2738541300 Bacteria 6675882
241 2739273885 2738543018 Bacteria 6718814
242 2739342929 2738543030 Bacteria 6719714
243 2857560842 2857558681 Bacteria 6617694
244 2904428818 2904424332 Bacteria 7633521
245 Ga0495605_0026750
246 JGI25158J39367_1002242
247 JGI25158J39367_1002327
248 JGI25152J39213_1000224
249 JGI25150J39212_1003199
250 JGI25150J39212_1003200
251 JGI25159J45721_1011592
252 JGI25153J46596_10004513
253 JGI25160J50197_1001176
254 JGI25161J50226_1003233
255 JGI25161J50226_1003882
256 Ga0055526_1007594
257 Ga0055526_1011618
258 Ga0055537_1005266
259 Ga0055537_1008757
260 Ga0055537_1020363
261 Ga0055524_1001031
262 Ga0055524_1001453
263 Ga0055524_1001929
264 Ga0055534_1003242
265 Ga0055528_1004830
266 Ga0055530_10001965
267 Ga0055530_10007154
268 Ga0055530_10008778
269 Ga0055531_10038696
270 Ga0055531_10062887
271 Ga0055543_1000924
272 Ga0065165_1002806
273 Ga0070717_10149922
274 Ga0075362_10021404
275 Ga0105244_10000158
276 Ga0209436_100797
277 Ga0209436_101578
278 Ga0207425_1000021
279 Ga0207425_1000223
280 Ga0209129_1000020
281 Ga0209129_1010060
282 Ga0209565_1003210
283 Ga0209565_1004805
284 Ga0209565_1012624
285 Ga0209565_1013045
286 Ga0209673_1007934
287 Ga0209130_1001646
288 Ga0209130_1002777
289 Ga0209130_1011412
290 Ga0209675_1001690
291 Ga0209564_1000780
292 Ga0209564_1001271
293 Ga0209564_1016913
294 Ga0209758_1000077
295 Ga0209050_1000050
296 Ga0209050_1000795
297 Ga0209256_1000674
298 Ga0209256_1003939
299 Ga0209256_1009037
300 Ga0207426_1001270
301 Ga0207426_1034905
302 Ga0209257_1000075
303 Ga0209257_1007416
304 Ga0207655_1000710
305 Ga0307515_10076511
306 Ga0316181_1133521
307 Ga0316182_1165756
308 Ga0316182_1326139
309 Ga0307408_100000531
310 Ga0307408_100002011
311 Ga0307408_100004170
312 Ga0307408_100005814
313 Ga0307408_100188878
314 Ga0307416_100009231
315 Ga0395898_0891512
316 Ga0395905_0434785
317 Ga0450904_000434
318 Ga0466965_0010758
319 Ga0495617_001655
320 Ga0495617_074942
321 Ga0495617_097013
322 Ga0495603_0428973
323 Ga0495590_0003253
324 Ga0495638_0001049
325 Ga0495650_0001065
326 Ga0495605_0000667
327 Ga0495639_0104156
328 Ga0495584_0000887
329 Ga0495584_0020591
330 Ga0495584_0105932
331 Ga0495585_0015064
332 Ga0495585_0021316
333 Ga0495585_0087585
334 Ga0495594_0037981
335 Ga0495607_0014940
336 Ga0495607_0030963
337 Ga0495607_0041332
338 Ga0495607_0122167
339 Ga0495583_0000214
340 Ga0495583_0000317
341 Ga0495583_0004572
342 Ga0495583_0034912
343 Ga0495583_0035240
344 Ga0495583_0039593
345 Ga0495606_0000433
346 Ga0495606_0009741
347 Ga0495606_0013970
348 Ga0495606_0033422
349 Ga0495606_0055327
350 Ga0495610_0036284
351 Ga0495610_0050255
352 Ga0495616_0000234
353 Ga0495616_0007800
354 Ga0495616_0080829
355 Ga0495616_0210302
356 Ga0495631_0019798
357 Ga0495631_0031779
358 Ga0495631_0033162
359 Ga0495631_0134171
360 Ga0495637_0002381
361 Ga0495643_0001515
362 Ga0495643_0297895
363 Ga0495644_0001273
364 Ga0495644_0073221
365 Ga0495648_0006792
366 Ga0495648_0021374
367 Ga0495648_0053716
368 Ga0495663_0009792
369 Ga0495663_0029087
370 Ga0495663_0241765
371 Ga0495666_0036649
372 Ga0495666_0045897
373 Ga0495642_0004615
374 Ga0495642_0014808
375 Ga0495642_0113342
376 Ga0495654_0005774
377 Ga0495654_0084375
378 Ga0495598_0034171
379 Ga0495609_0001512
380 Ga0495609_0064987
381 Ga0495609_0073519
382 Ga0495597_0001027
383 Ga0495597_0002718
384 Ga0495597_0080945
385 Ga0495597_0114357
386 Ga0495622_0270754
387 Ga0495633_0004606
388 Ga0495633_0040687
389 Ga0495633_0084029
390 Ga0495633_0147993
391 Ga0495656_0019215
392 Ga0495656_0037511
393 Ga0495656_0097894
394 Ga0495656_0148057
395 Ga0495656_0156675
396 Ga0495668_0148073
397 Ga0495668_0228345
398 Ga0495611_0005391
399 Ga0495611_0009582
400 Ga0495611_0014490
401 Ga0495611_0020041
402 Ga0495625_0017495
403 Ga0495625_0055817
404 Ga0495625_0129961
405 Ga0495625_0141482
406 Ga0495625_0164333
407 Ga0495625_0383061
408 Ga0495659_0000127
409 Ga0495659_0211925
410 Ga0495661_0041357
411 Ga0495588_0005801
412 Ga0495588_0121000
413 Ga0495588_0173705
414 Ga0495588_0228578
415 Ga0495588_0282593
416 Ga0495670_0000952
417 Ga0495670_0003933
418 Ga0495670_0176541
419 Ga0495670_0192752
420 Ga0495671_0000266
421 Ga0495671_0104623
422 Ga0495671_0201009
423 Ga0495649_0354268
424 Ga0495589_0344957
425 Ga0495660_0002471
426 Ga0495660_0010534
427 Ga0495581_0135354
428 Ga0495636_0052998
429 Ga0495672_0000013
430 Ga0495672_0000297
431 Ga0495672_0014412
432 Ga0495672_0014860
433 Ga0495672_0016997
434 Ga0495672_0053061
435 Ga0495672_0063954
436 Ga0495676_0028749
437 Ga0495683_0000773
438 Ga0495687_000342
439 Ga0495677_0006287
440 Ga0495677_0014677
441 Ga0495685_000088
442 Ga0495685_014202
443 Ga0495685_065597
444 Ga0495685_088505
445 Ga0495673_0000201
446 Ga0495673_0002265
447 Ga0495681_0019418
448 Ga0495686_0001635
449 Ga0495686_0005717
450 Ga0495686_0007524
451 Ga0495686_0129456
452 Ga0495686_0294324
453 Ga0495602_0145442
454 Ga0495615_0010910
455 Ga0495626_0003195
456 Ga0495626_0003892
457 Ga0495626_0020876
458 Ga0495626_0027102
459 Ga0496102_0000074
460 Ga0496103_0009168
461 Ga0496103_0011578
462 Ga0496115_0096268
463 Ga0496115_0802584
464 Ga0496124_0091538
465 Ga0495678_002976
466 Ga0495678_009096
467 Ga0495682_0001031
468 Ga0495682_0001462
469 Ga0501323_042151
470 Ga0501211_006482
471 Ga0501227_010218
472 Ga0501227_053887
473 Ga0501230_011999
474 Ga0501249_018362
475 Ga0501269_000528
476 Ga0501279_003275
477 Ga0500618_013570
478 Ga0500586_017316
479 2643792031
480 2644216487
481 2644254768
482 2644360320
483 2738738075
484 2738843134
485 2739273885
486 2739342929
487 2857560842
488 2904428818

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03550

LolB

Outer membrane lipoprotein LolB

63

223

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qnm-assembly1.cif.gz_A apo state of chemotaxis sensor odp from t. denticola 0.7467 66 95
8cm1-assembly1.cif.gz_A lol b - localization of lipoprotein b from vibrio cholera 0.73 37 197
8orn-assembly2.cif.gz_D crystal structure of xanthomonas campestris pv. campestris lola-lolb complex 0.7238 36 197
1iwm-assembly1.cif.gz_A crystal structure of the outer membrane lipoprotein receptor, lolb 0.7193 35 197
3wju-assembly1.cif.gz_A crystal structure of the l68d variant of mlolb from escherichia coli 0.7084 40 197
ID Description Score Start End Superfamily
af_K7KQ43_71_310_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7484 54 89 3.60.21.10
af_Q2FWQ7_1_86_3.10.110.10 Alpha Beta;Roll;Ubiquitin Conjugating Enzyme;Ubiquitin Conjugating Enzyme 0.7355 59 89 3.10.110.10
af_O44869_1_194_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.728 68 106 3.80.10.10
af_Q9SCX8_41_336_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7228 54 91 3.60.21.10
af_O43021_115_295_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.7203 55 106 2.40.160.120
ID Description Score Start End GO Terms
AF-A0A0K1K6V9-F1-model_v4 Outer-membrane lipoprotein LolB 0.8748 7 197 GO:0009279
GO:0015031
AF-A0A839VQ69-F1-model_v4 Outer-membrane lipoprotein LolB 0.8735 22 197 GO:0009279
GO:0015031
AF-A0A0Q7VRK4-F1-model_v4 Outer-membrane lipoprotein LolB 0.8649 1 197 GO:0009279
GO:0015031
AF-A0A7X7AGA1-F1-model_v4 deleted 0.8602 15 197
AF-A0A0Q7ETP6-F1-model_v4 Outer-membrane lipoprotein LolB 0.8479 7 197 GO:0009279
GO:0015031

Map