F356944

General Info

Members Datasets Scaffolds Average Seq Length
244 183 488 243

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842134933|2842137932
Length 256
Sequence DSGLVVIFGGRSEIGVEVATRLAPGATVVLAARGADRLDEQVSAVQSAGAAAVHTVEFDADDLGSHAPLVAKLVAEHGPIATAVLAFGILGDQARAERDPAHAAAIVHTDFVAQVSLLTVLATTMREAGRGPLVGERPARRSSIVVFSSVAGARVRRANYVYGSAKAGLDGFANGLADALHGSGVHLLLVRPGFVIGRMTAGMDPAPLSSTPAQVAEATVKALAKGRREVWIPRSLGAAVVVMRLMPRFVWRRMPR

Samples

Sample ID Description Type Environment
1 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
148 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
165 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
166 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
167 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
168 2547132424 Nocardia nova SH22a Isolate Unclassified
169 2582580736 Prauserella sp. Am3 Isolate Unclassified
170 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
171 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
172 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
173 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
174 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
175 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
176 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
177 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
178 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
179 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
180 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
181 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
182 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
183 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.62
Metatranscriptomes 0.41
Isolates 6.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 6.97
Nodule 0.41
Rhizoplane 6.97
Rhizosphere 72.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10020588 3300002075 Bacteria 1371
2 JGI24744J21845_10001316 3300002077 Bacteria 4899
3 JGI24742J22300_10001812 3300002244 Bacteria 3399
4 JGI24742J22300_10007327 3300002244 Bacteria 1820
5 Ga0070676_10012904 3300005328 Bacteria 4575
6 Ga0070690_100017362 3300005330 Bacteria 4325
7 Ga0070666_10162368 3300005335 Bacteria 1562
8 Ga0070682_100033252 3300005337 Bacteria 3132
9 Ga0068868_100000368 3300005338 Bacteria 30659
10 Ga0070689_100018409 3300005340 Bacteria 5145
11 Ga0070668_100004020 3300005347 Bacteria 10877
12 Ga0070668_100015508 3300005347 Bacteria 5696
13 Ga0070669_100000608 3300005353 Bacteria 26606
14 Ga0070669_100513818 3300005353 Bacteria 995
15 Ga0070675_100321709 3300005354 Bacteria 1366
16 Ga0070671_100094503 3300005355 Bacteria 2506
17 Ga0070674_100000546 3300005356 Bacteria 18863
18 Ga0070667_100001922 3300005367 Bacteria 18430
19 Ga0070709_10099945 3300005434 Bacteria 1931
20 Ga0070714_100003792 3300005435 Bacteria 11345
21 Ga0070714_100019130 3300005435 Bacteria 5575
22 Ga0070714_100130498 3300005435 Bacteria 2246
23 Ga0070713_100118233 3300005436 Bacteria 2320
24 Ga0070701_10000647 3300005438 Bacteria 12177
25 Ga0070701_10130194 3300005438 Bacteria 1429
26 Ga0070711_100001055 3300005439 Bacteria 14697
27 Ga0070705_100481281 3300005440 Bacteria 938
28 Ga0070700_100001198 3300005441 Bacteria 12851
29 Ga0070694_100028614 3300005444 Bacteria 3628
30 Ga0070678_100000037 3300005456 Bacteria 43961
31 Ga0070678_100136211 3300005456 Bacteria 1958
32 Ga0070678_100624820 3300005456 Bacteria 964
33 Ga0070662_100004547 3300005457 Bacteria 8786
34 Ga0068867_100000663 3300005459 Bacteria 22813
35 Ga0070685_10134867 3300005466 Bacteria 1547
36 Ga0068853_100001014 3300005539 Bacteria 19779
37 Ga0068853_100599349 3300005539 Bacteria 1046
38 Ga0070672_100197457 3300005543 Bacteria 1681
39 Ga0070696_100022076 3300005546 Bacteria 4322
40 Ga0070696_100435163 3300005546 Bacteria 1032
41 Ga0070665_100040798 3300005548 Bacteria 4665
42 Ga0070665_100415314 3300005548 Bacteria 1354
43 Ga0070704_100000167 3300005549 Bacteria 26061
44 Ga0068855_100042604 3300005563 Bacteria 5378
45 Ga0068855_100279604 3300005563 Bacteria 1854
46 Ga0070664_100147101 3300005564 Bacteria 2078
47 Ga0068854_100000837 3300005578 Bacteria 18405
48 Ga0068854_100258345 3300005578 Bacteria 1394
49 Ga0068854_100503975 3300005578 Bacteria 1020
50 Ga0068856_100133732 3300005614 Bacteria 2485
51 Ga0070702_100002813 3300005615 Bacteria 7629
52 Ga0068852_100686155 3300005616 Bacteria 1034
53 Ga0068859_100029589 3300005617 Bacteria 5496
54 Ga0068866_10000433 3300005718 Bacteria 19396
55 Ga0068861_100000054 3300005719 Bacteria 53529
56 Ga0068858_100000611 3300005842 Bacteria 37350
57 Ga0068860_100000518 3300005843 Bacteria 47295
58 Ga0068860_100243764 3300005843 Bacteria 1748
59 Ga0068862_100001262 3300005844 Bacteria 23799
60 Ga0070717_10314246 3300006028 Bacteria 1395
61 Ga0075363_100012520 3300006048 Bacteria 4093
62 Ga0075363_100055337 3300006048 Bacteria 2125
63 Ga0075364_10034189 3300006051 Bacteria 3278
64 Ga0075364_10155553 3300006051 Bacteria 1542
65 Ga0070715_10001714 3300006163 Bacteria 6518
66 Ga0070716_100016140 3300006173 Bacteria 3850
67 Ga0070712_100000149 3300006175 Bacteria 37058
68 Ga0075369_10015158 3300006186 Bacteria 3089
69 Ga0075369_10145735 3300006186 Bacteria 1081
70 Ga0097621_100068856 3300006237 Bacteria 2920
71 Ga0075370_10023554 3300006353 Bacteria 3392
72 Ga0075370_10097036 3300006353 Bacteria 1704
73 Ga0068871_100205544 3300006358 Bacteria 1702
74 Ga0068865_100000280 3300006881 Bacteria 28132
75 Ga0068865_100015526 3300006881 Bacteria 4859
76 Ga0097620_100029591 3300006931 Bacteria 5496
77 Ga0105240_10374340 3300009093 Bacteria 1609
78 Ga0105245_10000377 3300009098 Bacteria 41447
79 Ga0105247_10000939 3300009101 Bacteria 21975
80 Ga0105243_10012199 3300009148 Bacteria 6496
81 Ga0105241_10006236 3300009174 Bacteria 8789
82 Ga0105241_10071614 3300009174 Bacteria 2691
83 Ga0105242_10000366 3300009176 Bacteria 36059
84 Ga0105248_10005684 3300009177 Bacteria 13701
85 Ga0105248_10344823 3300009177 Bacteria 1677
86 Ga0105237_10127421 3300009545 Bacteria 2540
87 Ga0105237_10195126 3300009545 Bacteria 2024
88 Ga0105249_10000641 3300009553 Bacteria 31931
89 Ga0105239_10028620 3300010375 Bacteria 6126
90 Ga0105239_10102348 3300010375 Bacteria 3170
91 Ga0105239_10191247 3300010375 Bacteria 2291
92 Ga0157369_10058576 3300013105 Bacteria 4155
93 Ga0157374_10056178 3300013296 Bacteria 3675
94 Ga0157378_10012041 3300013297 Bacteria 7571
95 Ga0163162_10018398 3300013306 Bacteria 6846
96 Ga0163162_11183165 3300013306 Bacteria 867
97 Ga0157372_10132190 3300013307 Bacteria 2872
98 Ga0157375_10002135 3300013308 Bacteria 17079
99 Ga0163163_10168082 3300014325 Bacteria 2239
100 Ga0157380_10000116 3300014326 Bacteria 44047
101 Ga0157380_10078519 3300014326 Bacteria 2693
102 Ga0157379_10014362 3300014968 Bacteria 6948
103 Ga0157379_10265657 3300014968 Bacteria 1560
104 Ga0163161_10081401 3300017792 Bacteria 2384
105 Ga0206353_10733996 3300020082 Bacteria 1549
106 Ga0213876_10036918 3300021384 Bacteria 2578
107 Ga0213876_10041169 3300021384 Bacteria 2441
108 Ga0207645_10013111 3300025907 Bacteria 5599
109 Ga0207695_10102936 3300025913 Bacteria 2848
110 Ga0207671_10006074 3300025914 Bacteria 10881
111 Ga0207649_10347994 3300025920 Bacteria 1096
112 Ga0207694_10030156 3300025924 Bacteria 4141
113 Ga0207659_10109700 3300025926 Bacteria 2095
114 Ga0207664_10013471 3300025929 Bacteria 5870
115 Ga0207664_10046228 3300025929 Bacteria 3416
116 Ga0207664_10060416 3300025929 Bacteria 3020
117 Ga0207686_10179132 3300025934 Bacteria 1502
118 Ga0207661_10167530 3300025944 Bacteria 1910
119 Ga0207667_10441342 3300025949 Bacteria 1323
120 Ga0207668_10001342 3300025972 Bacteria 14587
121 Ga0207668_10095351 3300025972 Bacteria 2196
122 Ga0207640_10200445 3300025981 Bacteria 1512
123 Ga0207640_10477812 3300025981 Bacteria 1033
124 Ga0207703_10085594 3300026035 Bacteria 2638
125 Ga0207702_10104798 3300026078 Bacteria 2503
126 Ga0207641_10419960 3300026088 Bacteria 1287
127 Ga0207674_10159682 3300026116 Bacteria 2209
128 Ga0207683_10200434 3300026121 Bacteria 1814
129 Ga0207698_10036288 3300026142 Bacteria 3617
130 Ga0268266_10062580 3300028379 Bacteria 3212
131 Ga0268265_10186592 3300028380 Bacteria 1787
132 Ga0268264_10110926 3300028381 Bacteria 2402
133 Ga0265327_10000825 3300031251 Bacteria 46672
134 Ga0307413_10015589 3300031824 Bacteria 3901
135 Ga0307413_10260808 3300031824 Bacteria 1292
136 Ga0307411_10065720 3300032005 Bacteria 2434
137 Ga0307507_10098933 3300033179 Bacteria 2453
138 Ga0307507_10102566 3300033179 Bacteria 2386
139 Ga0436364_0185516 3300037853 Bacteria 19672
140 Ga0436364_1015791 3300037853 Bacteria 6155
141 Ga0436365_0129897 3300039437 Bacteria 6094
142 Ga0436365_0324358 3300039437 Bacteria 3230
143 Ga0436365_0345381 3300039437 Bacteria 3205
144 Ga0436365_0813916 3300039437 Bacteria 7986
145 Ga0436365_1329591 3300039437 Bacteria 10319
146 Ga0436365_1707801 3300039437 Bacteria 13214
147 Ga0436361_0933844 3300039447 Bacteria 1183
148 Ga0436363_0353312 3300039450 Bacteria 954
149 Ga0466972_0003780 3300044658 Bacteria 7528
150 Ga0466972_0027317 3300044658 Bacteria 2823
151 Ga0466965_0176930 3300044683 Bacteria 1124
152 Ga0466966_0006764 3300044684 Bacteria 7590
153 Ga0466966_0108288 3300044684 Bacteria 1714
154 Ga0466963_0086312 3300044694 Bacteria 2132
155 Ga0466971_0005093 3300044719 Bacteria 5694
156 Ga0466968_0006042 3300044735 Bacteria 4545
157 Ga0466970_0007628 3300044765 Bacteria 5423
158 Ga0466970_0015863 3300044765 Bacteria 3878
159 Ga0466970_0024982 3300044765 Bacteria 3126
160 Ga0466957_0005802 3300044842 Bacteria 6945
161 Ga0466957_0209176 3300044842 Bacteria 1284
162 Ga0466960_0005533 3300044901 Bacteria 5008
163 Ga0466959_0082875 3300045049 Bacteria 2310
164 Ga0466959_0099640 3300045049 Bacteria 2080
165 Ga0466958_0164249 3300045836 Bacteria 1404
166 Ga0466967_0001116 3300045976 Bacteria 14902
167 Ga0466967_0013128 3300045976 Bacteria 6383
168 Ga0466967_0097362 3300045976 Bacteria 2685
169 Ga0466967_0142280 3300045976 Bacteria 2235
170 Ga0495592_0139356 3300046454 Bacteria 1689
171 Ga0495651_0000424 3300046462 Bacteria 32646
172 Ga0495628_0033351 3300046516 Bacteria 4151
173 Ga0495652_0000573 3300046529 Bacteria 42990
174 Ga0495645_0128078 3300046543 Bacteria 1782
175 Ga0495622_0112327 3300046557 Bacteria 1247
176 Ga0495604_0070158 3300047317 Bacteria 2654
177 Ga0496100_0000761 3300048903 Bacteria 15293
178 Ga0496100_0080288 3300048903 Bacteria 2201
179 Ga0496101_0005287 3300048904 Bacteria 8221
180 Ga0496101_0306391 3300048904 Bacteria 1245
181 Ga0496102_0000282 3300048905 Bacteria 64788
182 Ga0496102_0099028 3300048905 Bacteria 2706
183 Ga0496103_0000498 3300048906 Bacteria 32388
184 Ga0496103_0301809 3300048906 Bacteria 1030
185 Ga0496104_0035444 3300048907 Bacteria 4659
186 Ga0496104_0459524 3300048907 Bacteria 1185
187 Ga0496105_0134703 3300048908 Bacteria 2035
188 Ga0496106_0051926 3300048909 Bacteria 3092
189 Ga0496107_0101654 3300048910 Bacteria 2108
190 Ga0496108_0055072 3300048911 Bacteria 3339
191 Ga0496109_0266422 3300048912 Bacteria 1614
192 Ga0496110_0414544 3300048913 Bacteria 1228
193 Ga0496112_0012816 3300048915 Bacteria 7717
194 Ga0496116_0000490 3300048919 Bacteria 54489
195 Ga0496117_0001568 3300048920 Bacteria 32443
196 Ga0496117_0026171 3300048920 Bacteria 4570
197 Ga0496118_0000502 3300048921 Bacteria 64792
198 Ga0496118_0001792 3300048921 Bacteria 31016
199 Ga0496119_0001014 3300048922 Bacteria 35952
200 Ga0496120_0036955 3300048923 Bacteria 2902
201 Ga0496121_0005303 3300048924 Bacteria 16594
202 Ga0496124_0019645 3300048927 Bacteria 6277
203 Ga0496125_0019947 3300048928 Bacteria 6303
204 Ga0496126_0000799 3300048929 Bacteria 56430
205 Ga0501032_0132680 3300049569 Bacteria 1642
206 Ga0501034_0008164 3300049571 Bacteria 11100
207 Ga0501034_0220164 3300049571 Bacteria 1851
208 Ga0501037_0070500 3300049573 Bacteria 2543
209 Ga0501043_0169941 3300049579 Bacteria 1701
210 Ga0501046_0088259 3300049580 Bacteria 2388
211 Ga0501047_0011047 3300049581 Bacteria 8545
212 Ga0501047_0296772 3300049581 Bacteria 1459
213 Ga0501048_0190752 3300049582 Bacteria 1452
214 Ga0501070_0534332 3300049586 Bacteria 940
215 Ga0501035_0000417 3300049822 Bacteria 48134
216 Ga0501044_0003805 3300049823 Bacteria 16948
217 nmdc:mga03n38_49453_c1 3300050490 Bacteria 1870
218 nmdc:mga00v17_99017_c1 3300050491 Bacteria 1839
219 nmdc:mga07m45_13268_c1 3300050496 Bacteria 4368
220 nmdc:mga07m45_70937_c1 3300050496 Bacteria 1982
221 nmdc:mga0sz30_28746_c1 3300050516 Bacteria 1688
222 Ga0495601_0041530 3300053077 Bacteria 2884
223 Ga0495601_0328598 3300053077 Bacteria 995
224 Ga0500635_0005514 3300053080 Bacteria 3325
225 Ga0500556_0004757 3300053104 Bacteria 3851
226 Ga0500652_000442 3300053131 Bacteria 14712
227 Ga0500573_0126144 3300053140 Bacteria 1421
228 2842137932 2842134933 Bacteria 5847019
229 2548695681 2547132424 Bacteria 8348532
230 2583149793 2582580736 Bacteria 5325865
231 2739205032 2738543005 Bacteria 5278128
232 2776373088 2775506925 Bacteria 7237746
233 2795783965 2795385470 Bacteria 8317180
234 2795793266 2795385472 Bacteria 6627535
235 2863069253 2863067949 Bacteria 8541735
236 2870784959 2870782633 Bacteria 9624083
237 2899361499 2899359706 Bacteria 10940472
238 2915770096 2915768154 Bacteria 8424322
239 2917744830 2917736166 Bacteria 9690793
240 2919714259 2919713450 Bacteria 7431245
241 2974317663 2974315732 Bacteria 4602776
242 2984525874 2984523437 Bacteria 4508481
243 8054475467 8054472261 Bacteria 7464355
244 8056212613 8056207758 Bacteria 8639239
245 JGI24738J21930_10020588
246 JGI24744J21845_10001316
247 JGI24742J22300_10001812
248 JGI24742J22300_10007327
249 Ga0070676_10012904
250 Ga0070690_100017362
251 Ga0070666_10162368
252 Ga0070682_100033252
253 Ga0068868_100000368
254 Ga0070689_100018409
255 Ga0070668_100004020
256 Ga0070668_100015508
257 Ga0070669_100000608
258 Ga0070669_100513818
259 Ga0070675_100321709
260 Ga0070671_100094503
261 Ga0070674_100000546
262 Ga0070667_100001922
263 Ga0070709_10099945
264 Ga0070714_100003792
265 Ga0070714_100019130
266 Ga0070714_100130498
267 Ga0070713_100118233
268 Ga0070701_10000647
269 Ga0070701_10130194
270 Ga0070711_100001055
271 Ga0070705_100481281
272 Ga0070700_100001198
273 Ga0070694_100028614
274 Ga0070678_100000037
275 Ga0070678_100136211
276 Ga0070678_100624820
277 Ga0070662_100004547
278 Ga0068867_100000663
279 Ga0070685_10134867
280 Ga0068853_100001014
281 Ga0068853_100599349
282 Ga0070672_100197457
283 Ga0070696_100022076
284 Ga0070696_100435163
285 Ga0070665_100040798
286 Ga0070665_100415314
287 Ga0070704_100000167
288 Ga0068855_100042604
289 Ga0068855_100279604
290 Ga0070664_100147101
291 Ga0068854_100000837
292 Ga0068854_100258345
293 Ga0068854_100503975
294 Ga0068856_100133732
295 Ga0070702_100002813
296 Ga0068852_100686155
297 Ga0068859_100029589
298 Ga0068866_10000433
299 Ga0068861_100000054
300 Ga0068858_100000611
301 Ga0068860_100000518
302 Ga0068860_100243764
303 Ga0068862_100001262
304 Ga0070717_10314246
305 Ga0075363_100012520
306 Ga0075363_100055337
307 Ga0075364_10034189
308 Ga0075364_10155553
309 Ga0070715_10001714
310 Ga0070716_100016140
311 Ga0070712_100000149
312 Ga0075369_10015158
313 Ga0075369_10145735
314 Ga0097621_100068856
315 Ga0075370_10023554
316 Ga0075370_10097036
317 Ga0068871_100205544
318 Ga0068865_100000280
319 Ga0068865_100015526
320 Ga0097620_100029591
321 Ga0105240_10374340
322 Ga0105245_10000377
323 Ga0105247_10000939
324 Ga0105243_10012199
325 Ga0105241_10006236
326 Ga0105241_10071614
327 Ga0105242_10000366
328 Ga0105248_10005684
329 Ga0105248_10344823
330 Ga0105237_10127421
331 Ga0105237_10195126
332 Ga0105249_10000641
333 Ga0105239_10028620
334 Ga0105239_10102348
335 Ga0105239_10191247
336 Ga0157369_10058576
337 Ga0157374_10056178
338 Ga0157378_10012041
339 Ga0163162_10018398
340 Ga0163162_11183165
341 Ga0157372_10132190
342 Ga0157375_10002135
343 Ga0163163_10168082
344 Ga0157380_10000116
345 Ga0157380_10078519
346 Ga0157379_10014362
347 Ga0157379_10265657
348 Ga0163161_10081401
349 Ga0206353_10733996
350 Ga0213876_10036918
351 Ga0213876_10041169
352 Ga0207645_10013111
353 Ga0207695_10102936
354 Ga0207671_10006074
355 Ga0207649_10347994
356 Ga0207694_10030156
357 Ga0207659_10109700
358 Ga0207664_10013471
359 Ga0207664_10046228
360 Ga0207664_10060416
361 Ga0207686_10179132
362 Ga0207661_10167530
363 Ga0207667_10441342
364 Ga0207668_10001342
365 Ga0207668_10095351
366 Ga0207640_10200445
367 Ga0207640_10477812
368 Ga0207703_10085594
369 Ga0207702_10104798
370 Ga0207641_10419960
371 Ga0207674_10159682
372 Ga0207683_10200434
373 Ga0207698_10036288
374 Ga0268266_10062580
375 Ga0268265_10186592
376 Ga0268264_10110926
377 Ga0265327_10000825
378 Ga0307413_10015589
379 Ga0307413_10260808
380 Ga0307411_10065720
381 Ga0307507_10098933
382 Ga0307507_10102566
383 Ga0436364_0185516
384 Ga0436364_1015791
385 Ga0436365_0129897
386 Ga0436365_0324358
387 Ga0436365_0345381
388 Ga0436365_0813916
389 Ga0436365_1329591
390 Ga0436365_1707801
391 Ga0436361_0933844
392 Ga0436363_0353312
393 Ga0466972_0003780
394 Ga0466972_0027317
395 Ga0466965_0176930
396 Ga0466966_0006764
397 Ga0466966_0108288
398 Ga0466963_0086312
399 Ga0466971_0005093
400 Ga0466968_0006042
401 Ga0466970_0007628
402 Ga0466970_0015863
403 Ga0466970_0024982
404 Ga0466957_0005802
405 Ga0466957_0209176
406 Ga0466960_0005533
407 Ga0466959_0082875
408 Ga0466959_0099640
409 Ga0466958_0164249
410 Ga0466967_0001116
411 Ga0466967_0013128
412 Ga0466967_0097362
413 Ga0466967_0142280
414 Ga0495592_0139356
415 Ga0495651_0000424
416 Ga0495628_0033351
417 Ga0495652_0000573
418 Ga0495645_0128078
419 Ga0495622_0112327
420 Ga0495604_0070158
421 Ga0496100_0000761
422 Ga0496100_0080288
423 Ga0496101_0005287
424 Ga0496101_0306391
425 Ga0496102_0000282
426 Ga0496102_0099028
427 Ga0496103_0000498
428 Ga0496103_0301809
429 Ga0496104_0035444
430 Ga0496104_0459524
431 Ga0496105_0134703
432 Ga0496106_0051926
433 Ga0496107_0101654
434 Ga0496108_0055072
435 Ga0496109_0266422
436 Ga0496110_0414544
437 Ga0496112_0012816
438 Ga0496116_0000490
439 Ga0496117_0001568
440 Ga0496117_0026171
441 Ga0496118_0000502
442 Ga0496118_0001792
443 Ga0496119_0001014
444 Ga0496120_0036955
445 Ga0496121_0005303
446 Ga0496124_0019645
447 Ga0496125_0019947
448 Ga0496126_0000799
449 Ga0501032_0132680
450 Ga0501034_0008164
451 Ga0501034_0220164
452 Ga0501037_0070500
453 Ga0501043_0169941
454 Ga0501046_0088259
455 Ga0501047_0011047
456 Ga0501047_0296772
457 Ga0501048_0190752
458 Ga0501070_0534332
459 Ga0501035_0000417
460 Ga0501044_0003805
461 nmdc:mga03n38_49453_c1
462 nmdc:mga00v17_99017_c1
463 nmdc:mga07m45_13268_c1
464 nmdc:mga07m45_70937_c1
465 nmdc:mga0sz30_28746_c1
466 Ga0495601_0041530
467 Ga0495601_0328598
468 Ga0500635_0005514
469 Ga0500556_0004757
470 Ga0500652_000442
471 Ga0500573_0126144
472 2842137932
473 2548695681
474 2583149793
475 2739205032
476 2776373088
477 2795783965
478 2795793266
479 2863069253
480 2870784959
481 2899361499
482 2915770096
483 2917744830
484 2919714259
485 2974317663
486 2984525874
487 8054475467
488 8056212613

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

3

207

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

9

229

0.88

PF08659

KR

KR domain

3

191

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e6o-assembly1.cif.gz_C crystal structure of polyol dehydrogenase from paracoccus denitrificans 0.899 7 180
4cql-assembly2.cif.gz_D crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.8933 1 211
3ftp-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from burkholderia pseudomallei at 2.05 a resolution 0.8862 4 211
4cql-assembly3.cif.gz_M crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.8859 7 211
3gvc-assembly2.cif.gz_D-3 crystal structure of probable short-chain dehydrogenase-reductase from mycobacterium tuberculosis 0.8851 2 213
ID Description Score Start End Superfamily
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9713 9 233 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9464 7 233 3.40.50.720
af_P9WGR3_8_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9262 9 233 3.40.50.720
af_P9WGS9_8_252_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9109 7 233 3.40.50.720
af_Q9VIG6_88_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8934 9 228 3.40.50.720
ID Description Score Start End GO Terms
AF-X8FC73-F1-model_v4 deleted 0.9917 43 235
AF-A0A1V3X334-F1-model_v4 Short chain dehydrogenase family protein 0.99 75 235 GO:0016491
AF-A0A1V3X334-F1-model_v4 Short chain dehydrogenase family protein 0.9779 75 235 GO:0016491
AF-A0A2S8BFM7-F1-model_v4 Putative oxidoreductase (EC 1.-.-.-) 0.9774 98 235 GO:0016020
GO:0016491
AF-A0A7V9CXY3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.976 89 235 GO:0016491

Map