F357057

General Info

Members Datasets Scaffolds Average Seq Length
245 123 244 163

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100033377|Ga0070683_1000333774
Length 166
Sequence MIQRISAAISPTVVLGLTILWLLLQQTVALDQVLLGVMLAVLLAWASSKLRPLRAHVRRIDLAAGLVLVVFWEIVRSNLAVARIVLGLVRDREVRSGFVKIPLALRDPHGLAVLAAIITATPGTVWAGLSPDGQRLTLHILDIGEEQQWIRYVKERFEGPLMRIFE

Samples

Sample ID Description Type Environment
1 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
71 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
74 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
75 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
76 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
77 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
78 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
82 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
109 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 3.27
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10302090 3300003322 Bacteria 1925
2 rootL2_10377764 3300003322 Bacteria 1125
3 Ga0070676_10244757 3300005328 Unclassified 1194
4 Ga0070683_100033377 3300005329 Bacteria 4693
5 Ga0070683_100121362 3300005329 Bacteria 2469
6 Ga0070670_100063864 3300005331 Bacteria 3159
7 Ga0070670_100960403 3300005331 Unclassified 776
8 Ga0070680_100001339 3300005336 Bacteria 17848
9 Ga0070680_100094953 3300005336 Bacteria 2472
10 Ga0070682_100380704 3300005337 Bacteria 1061
11 Ga0070660_100321988 3300005339 Bacteria 1270
12 Ga0070675_100047113 3300005354 Bacteria 3532
13 Ga0070659_100507872 3300005366 Bacteria 1028
14 Ga0070714_100016544 3300005435 Bacteria 5960
15 Ga0070700_100443545 3300005441 Unclassified 986
16 Ga0070662_101345891 3300005457 Bacteria 615
17 Ga0070681_10004469 3300005458 Bacteria 13326
18 Ga0070681_10027870 3300005458 Bacteria 5679
19 Ga0070681_10192209 3300005458 Unclassified 1961
20 Ga0070681_10493044 3300005458 Bacteria 1138
21 Ga0070679_100075044 3300005530 Bacteria 3372
22 Ga0070679_100079592 3300005530 Bacteria 3266
23 Ga0070684_100021859 3300005535 Bacteria 5330
24 Ga0070684_100140684 3300005535 Bacteria 2182
25 Ga0068853_100347580 3300005539 Bacteria 1379
26 Ga0068853_100797262 3300005539 Bacteria 904
27 Ga0070672_100076313 3300005543 Bacteria 2677
28 Ga0070672_100881603 3300005543 Unclassified 790
29 Ga0070696_100555680 3300005546 Bacteria 920
30 Ga0070665_100009025 3300005548 Bacteria 10100
31 Ga0070664_100058257 3300005564 Bacteria 3285
32 Ga0070664_100335503 3300005564 Bacteria 1372
33 Ga0068857_100778899 3300005577 Bacteria 912
34 Ga0068861_100262024 3300005719 Unclassified 1480
35 Ga0068870_10512448 3300005840 Bacteria 801
36 Ga0068862_100154923 3300005844 Bacteria 2042
37 Ga0081455_10207151 3300005937 Bacteria 1464
38 Ga0070712_100009380 3300006175 Bacteria 6165
39 Ga0068865_101670708 3300006881 Bacteria 574
40 Ga0105240_10030179 3300009093 Bacteria 7051
41 Ga0105240_10496667 3300009093 Bacteria 1357
42 Ga0111539_10413493 3300009094 Bacteria 1571
43 Ga0105245_11725803 3300009098 Bacteria 678
44 Ga0105237_10363390 3300009545 Bacteria 1452
45 Ga0105238_10806899 3300009551 Bacteria 954
46 Ga0105249_10004576 3300009553 Bacteria 11952
47 Ga0105249_10656386 3300009553 Unclassified 1107
48 Ga0105246_10018171 3300011119 Bacteria 4479
49 Ga0157373_10081430 3300013100 Bacteria 2282
50 Ga0157370_10008535 3300013104 Bacteria 11043
51 Ga0157380_10003340 3300014326 Bacteria 11014
52 Ga0157380_10394395 3300014326 Unclassified 1311
53 Ga0157376_10708060 3300014969 Bacteria 1013
54 Ga0207707_10011739 3300025912 Bacteria 7623
55 Ga0207707_10049122 3300025912 Bacteria 3675
56 Ga0207707_10132299 3300025912 Bacteria 2181
57 Ga0207707_10452446 3300025912 Bacteria 1099
58 Ga0207695_10012750 3300025913 Bacteria 10063
59 Ga0207695_10313995 3300025913 Bacteria 1457
60 Ga0207695_10337215 3300025913 Unclassified 1396
61 Ga0207671_10964737 3300025914 Unclassified 673
62 Ga0207660_10040550 3300025917 Bacteria 3260
63 Ga0207660_10551266 3300025917 Bacteria 938
64 Ga0207660_10616186 3300025917 Unclassified 884
65 Ga0207652_10065350 3300025921 Bacteria 3150
66 Ga0207652_10446890 3300025921 Bacteria 1165
67 Ga0207694_10092706 3300025924 Bacteria 2385
68 Ga0207659_10050449 3300025926 Bacteria 2956
69 Ga0207664_10057107 3300025929 Bacteria 3102
70 Ga0207690_10849345 3300025932 Bacteria 756
71 Ga0207706_10041364 3300025933 Bacteria 4085
72 Ga0207706_10159907 3300025933 Bacteria 1980
73 Ga0207691_10064566 3300025940 Bacteria 3316
74 Ga0207689_10583731 3300025942 Bacteria 940
75 Ga0207661_10882110 3300025944 Bacteria 824
76 Ga0207679_10002362 3300025945 Bacteria 11613
77 Ga0207679_10545594 3300025945 Bacteria 1040
78 Ga0207667_10062855 3300025949 Bacteria 3881
79 Ga0207639_10563742 3300026041 Bacteria 1047
80 Ga0207678_10393968 3300026067 Bacteria 1198
81 Ga0207708_10312592 3300026075 Bacteria 1280
82 Ga0207702_11068036 3300026078 Unclassified 801
83 Ga0207648_11147073 3300026089 Bacteria 729
84 Ga0268266_10100910 3300028379 Bacteria 2543
85 Ga0268266_10866784 3300028379 Bacteria 873
86 Ga0268265_10441009 3300028380 Bacteria 1214
87 Ga0268264_11153850 3300028381 Unclassified 784
88 Ga0307515_10463592 3300028794 Bacteria 881
89 Ga0307406_10109772 3300031901 Bacteria 1897
90 Ga0307407_10172697 3300031903 Bacteria 1425
91 Ga0307409_100004288 3300031995 Bacteria 7976
92 Ga0307416_100019477 3300032002 Bacteria 4812
93 Ga0307414_11221523 3300032004 Bacteria 696
94 Ga0307414_11355910 3300032004 Unclassified 660
95 Ga0307411_10066928 3300032005 Bacteria 2415
96 Ga0307415_100011367 3300032126 Bacteria 5091
97 Ga0451797_0821516 3300041453 Bacteria 1469
98 Ga0451797_1326113 3300041453 Bacteria 1089
99 Ga0451807_1048375 3300041486 Bacteria 1753
100 Ga0451807_1525741 3300041486 Bacteria 1690
101 Ga0439431_0039919 3300041997 Bacteria 1192
102 Ga0450921_008931 3300042123 Bacteria 821
103 Ga0439446_0049131 3300042156 Bacteria 1257
104 Ga0450909_003705 3300042185 Bacteria 2171
105 Ga0439434_0023571 3300042435 Bacteria 1854
106 Ga0450918_005999 3300042531 Bacteria 2173
107 Ga0466972_0153208 3300044658 Unclassified 1083
108 Ga0466960_0344517 3300044901 Viruses 849
109 Ga0495625_0595575 3300046660 Unclassified 664
110 Ga0496108_0008526 3300048911 Bacteria 8314
111 Ga0496109_0014411 3300048912 Bacteria 6879
112 Ga0496114_0004305 3300048917 Bacteria 11016
113 Ga0496114_0333944 3300048917 Bacteria 1340
114 Ga0496126_0190807 3300048929 Bacteria 1736
115 Ga0501031_0004640 3300049568 Bacteria 8920
116 Ga0501031_0030256 3300049568 Bacteria 3531
117 Ga0501031_0108306 3300049568 Bacteria 1814
118 Ga0501032_0004554 3300049569 Bacteria 10430
119 Ga0501032_0006488 3300049569 Bacteria 8603
120 Ga0501032_0018058 3300049569 Bacteria 4948
121 Ga0501032_0161020 3300049569 Bacteria 1474
122 Ga0501032_0546550 3300049569 Bacteria 739
123 Ga0501033_0003294 3300049570 Bacteria 13346
124 Ga0501033_0030312 3300049570 Bacteria 4065
125 Ga0501033_0138714 3300049570 Bacteria 1759
126 Ga0501034_0104328 3300049571 Bacteria 2828
127 Ga0501034_0154832 3300049571 Bacteria 2267
128 Ga0501036_0008738 3300049572 Bacteria 8310
129 Ga0501036_0152732 3300049572 Bacteria 1947
130 Ga0501036_0159798 3300049572 Bacteria 1900
131 Ga0501036_0252653 3300049572 Bacteria 1477
132 Ga0501037_0009308 3300049573 Bacteria 7205
133 Ga0501037_0018337 3300049573 Bacteria 5158
134 Ga0501037_0128028 3300049573 Bacteria 1822
135 Ga0501037_0249221 3300049573 Bacteria 1243
136 Ga0501038_0002137 3300049574 Bacteria 18353
137 Ga0501038_0005554 3300049574 Bacteria 11707
138 Ga0501038_0012069 3300049574 Bacteria 7889
139 Ga0501038_0566829 3300049574 Bacteria 862
140 Ga0501039_0012080 3300049575 Bacteria 6585
141 Ga0501039_0042737 3300049575 Bacteria 3501
142 Ga0501039_0080677 3300049575 Bacteria 2532
143 Ga0501039_0094466 3300049575 Bacteria 2331
144 Ga0501039_0164778 3300049575 Bacteria 1743
145 Ga0501040_0008948 3300049576 Bacteria 6511
146 Ga0501040_0017326 3300049576 Bacteria 4779
147 Ga0501040_0061826 3300049576 Bacteria 2576
148 Ga0501040_0521491 3300049576 Bacteria 857
149 Ga0501041_0031753 3300049577 Bacteria 3192
150 Ga0501041_0420578 3300049577 Bacteria 847
151 Ga0501042_0051238 3300049578 Bacteria 2944
152 Ga0501042_0139514 3300049578 Bacteria 1747
153 Ga0501042_0281902 3300049578 Bacteria 1200
154 Ga0501042_0467241 3300049578 Bacteria 915
155 Ga0501042_0507181 3300049578 Bacteria 876
156 Ga0501043_0007395 3300049579 Bacteria 8710
157 Ga0501043_0095052 3300049579 Bacteria 2342
158 Ga0501043_0101564 3300049579 Bacteria 2260
159 Ga0501043_0103620 3300049579 Bacteria 2235
160 Ga0501043_0228337 3300049579 Bacteria 1438
161 Ga0501046_0010051 3300049580 Bacteria 8149
162 Ga0501046_0037109 3300049580 Bacteria 3917
163 Ga0501046_0180967 3300049580 Bacteria 1576
164 Ga0501046_0473396 3300049580 Bacteria 899
165 Ga0501047_0006471 3300049581 Bacteria 11021
166 Ga0501047_0525180 3300049581 Unclassified 1009
167 Ga0501048_0024711 3300049582 Bacteria 4383
168 Ga0501048_0095718 3300049582 Bacteria 2094
169 Ga0501048_0303409 3300049582 Bacteria 1136
170 Ga0501067_0076733 3300049583 Bacteria 1851
171 Ga0501067_0163187 3300049583 Bacteria 1241
172 Ga0501068_0000993 3300049584 Bacteria 14920
173 Ga0501070_0142241 3300049586 Bacteria 1981
174 Ga0501070_0825119 3300049586 Bacteria 727
175 Ga0501071_0002031 3300049587 Bacteria 12108
176 Ga0501071_0036108 3300049587 Bacteria 3524
177 Ga0501071_0078394 3300049587 Bacteria 2414
178 Ga0501071_0369319 3300049587 Bacteria 1093
179 Ga0501071_0905984 3300049587 Unclassified 680
180 Ga0501071_0972531 3300049587 Unclassified 655
181 Ga0501071_0985773 3300049587 Bacteria 651
182 Ga0501072_0013542 3300049588 Bacteria 6241
183 Ga0501072_0123926 3300049588 Bacteria 2059
184 Ga0501072_0170221 3300049588 Bacteria 1738
185 Ga0501072_0358665 3300049588 Bacteria 1157
186 Ga0501073_0004348 3300049589 Bacteria 10638
187 Ga0501073_0011413 3300049589 Bacteria 6501
188 Ga0501073_0089566 3300049589 Bacteria 2139
189 Ga0501073_0658772 3300049589 Bacteria 723
190 Ga0501074_0001258 3300049590 Bacteria 16753
191 Ga0501074_0041711 3300049590 Bacteria 3322
192 Ga0501074_0062835 3300049590 Bacteria 2675
193 Ga0501074_0094592 3300049590 Bacteria 2140
194 Ga0501075_0036056 3300049591 Bacteria 3690
195 Ga0501075_0092871 3300049591 Bacteria 2291
196 Ga0501075_0110476 3300049591 Bacteria 2090
197 Ga0501075_0362606 3300049591 Bacteria 1105
198 Ga0501076_0003440 3300049592 Bacteria 11105
199 Ga0501076_0012397 3300049592 Bacteria 6371
200 Ga0501076_0176200 3300049592 Bacteria 1743
201 Ga0501076_0388455 3300049592 Bacteria 1147
202 Ga0501076_1189413 3300049592 Bacteria 627
203 Ga0501077_0000709 3300049593 Bacteria 20134
204 Ga0501077_0003316 3300049593 Bacteria 9686
205 Ga0501077_0169015 3300049593 Bacteria 1389
206 Ga0501077_0886601 3300049593 Bacteria 574
207 Ga0501079_0001194 3300049741 Bacteria 18200
208 Ga0501079_0031863 3300049741 Bacteria 4052
209 Ga0501079_0049378 3300049741 Bacteria 3247
210 Ga0501079_0233768 3300049741 Bacteria 1436
211 Ga0501080_0002187 3300049742 Bacteria 16987
212 Ga0501080_0003968 3300049742 Bacteria 13104
213 Ga0501080_0115515 3300049742 Bacteria 2488
214 Ga0501081_0049897 3300049743 Bacteria 2883
215 Ga0501081_0200787 3300049743 Bacteria 1446
216 Ga0501081_0425746 3300049743 Bacteria 984
217 Ga0501083_0008623 3300049744 Bacteria 7194
218 Ga0501083_0008854 3300049744 Bacteria 7106
219 Ga0501035_0000375 3300049822 Bacteria 51358
220 Ga0501035_0003500 3300049822 Bacteria 15011
221 Ga0501035_0068903 3300049822 Bacteria 3136
222 Ga0501044_0002260 3300049823 Bacteria 21995
223 Ga0501044_0012737 3300049823 Bacteria 9106
224 Ga0501044_0208839 3300049823 Bacteria 1908
225 Ga0501044_0436710 3300049823 Bacteria 1217
226 Ga0501044_0508958 3300049823 Bacteria 1104
227 Ga0501044_0781437 3300049823 Bacteria 835
228 Ga0501045_0007676 3300049824 Bacteria 7502
229 Ga0501045_0045413 3300049824 Bacteria 3198
230 Ga0501045_0388853 3300049824 Bacteria 1038
231 Ga0501045_0414349 3300049824 Bacteria 1002
232 Ga0501045_0426224 3300049824 Bacteria 987
233 nmdc:mga08y16_262178_c1 3300050511 Bacteria 1785
234 Ga0500556_0294548 3300053104 Bacteria 635
235 Ga0500622_0005490 3300053156 Bacteria 7609
236 Ga0500622_0023382 3300053156 Bacteria 3273
237 Ga0501084_0005979 3300054114 Bacteria 10012
238 Ga0501084_0060028 3300054114 Bacteria 3184
239 Ga0501082_0090541 3300060353 Bacteria 2641
240 Ga0501082_0371641 3300060353 Bacteria 1247
241 Ga0501082_0568229 3300060353 Bacteria 992
242 Ga0530510_0034308 3300061734 Bacteria 3654
243 Ga0530510_0355090 3300061734 Bacteria 1101
244 Ga0530510_0652971 3300061734 Bacteria 801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_11147073 Ga0207648_111470732 142
2 3300041486 Ga0451807_1048375 Ga0451807_1048375_1266_1727 152
3 3300049577 Ga0501041_0420578 Ga0501041_0420578_358_819 152
4 3300028379 Ga0268266_10866784 Ga0268266_108667841 153
5 3300046660 Ga0495625_0595575 Ga0495625_0595575_134_631 153
6 3300042123 Ga0450921_008931 Ga0450921_008931_338_805 154
7 3300049575 Ga0501039_0080677 Ga0501039_0080677_1192_1659 154
8 3300049587 Ga0501071_0905984 Ga0501071_0905984_148_615 154
9 3300049593 Ga0501077_0886601 Ga0501077_0886601_46_513 154
10 3300049741 Ga0501079_0031863 Ga0501079_0031863_2736_3203 154
11 3300049743 Ga0501081_0200787 Ga0501081_0200787_501_968 154
12 3300061734 Ga0530510_0652971 Ga0530510_0652971_177_644 154
13 iso_pu_bacteria 2883577096 2883577844 155
14 3300003322 rootL2_10377764 rootL2_103777642 160
15 3300005336 Ga0070680_100094953 Ga0070680_1000949532 160
16 3300005339 Ga0070660_100321988 Ga0070660_1003219882 160
17 3300005458 Ga0070681_10027870 Ga0070681_100278705 160
18 3300005530 Ga0070679_100079592 Ga0070679_1000795922 160
19 3300009093 Ga0105240_10496667 Ga0105240_104966673 160
20 3300009545 Ga0105237_10363390 Ga0105237_103633902 160
21 3300025912 Ga0207707_10011739 Ga0207707_100117395 160
22 3300025913 Ga0207695_10012750 Ga0207695_100127505 160
23 3300025913 Ga0207695_10313995 Ga0207695_103139952 160
24 3300025914 Ga0207671_10964737 Ga0207671_109647371 160
25 3300025917 Ga0207660_10616186 Ga0207660_106161862 160
26 3300025921 Ga0207652_10065350 Ga0207652_100653504 160
27 3300025924 Ga0207694_10092706 Ga0207694_100927063 160
28 3300025949 Ga0207667_10062855 Ga0207667_100628554 160
29 3300026078 Ga0207702_11068036 Ga0207702_110680361 160
30 3300049568 Ga0501031_0030256 Ga0501031_0030256_2174_2659 160
31 3300049569 Ga0501032_0006488 Ga0501032_0006488_6281_6766 160
32 3300049569 Ga0501032_0018058 Ga0501032_0018058_785_1270 160
33 3300049570 Ga0501033_0030312 Ga0501033_0030312_909_1394 160
34 3300049571 Ga0501034_0154832 Ga0501034_0154832_341_826 160
35 3300049572 Ga0501036_0008738 Ga0501036_0008738_1951_2436 160
36 3300049573 Ga0501037_0009308 Ga0501037_0009308_2867_3352 160
37 3300049573 Ga0501037_0249221 Ga0501037_0249221_488_973 160
38 3300049574 Ga0501038_0012069 Ga0501038_0012069_3551_4036 160
39 3300049575 Ga0501039_0012080 Ga0501039_0012080_2597_3082 160
40 3300049576 Ga0501040_0008948 Ga0501040_0008948_4324_4809 160
41 3300049578 Ga0501042_0051238 Ga0501042_0051238_1514_1999 160
42 3300049579 Ga0501043_0007395 Ga0501043_0007395_3156_3641 160
43 3300049579 Ga0501043_0228337 Ga0501043_0228337_769_1254 160
44 3300049580 Ga0501046_0010051 Ga0501046_0010051_3221_3706 160
45 3300049580 Ga0501046_0473396 Ga0501046_0473396_51_536 160
46 3300049581 Ga0501047_0006471 Ga0501047_0006471_3032_3517 160
47 3300049581 Ga0501047_0525180 Ga0501047_0525180_494_979 160
48 3300049582 Ga0501048_0024711 Ga0501048_0024711_301_786 160
49 3300049583 Ga0501067_0163187 Ga0501067_0163187_391_876 160
50 3300049586 Ga0501070_0142241 Ga0501070_0142241_26_511 160
51 3300049589 Ga0501073_0658772 Ga0501073_0658772_205_690 160
52 3300049822 Ga0501035_0003500 Ga0501035_0003500_5453_5938 160
53 3300049822 Ga0501035_0068903 Ga0501035_0068903_964_1449 160
54 3300049823 Ga0501044_0012737 Ga0501044_0012737_5070_5555 160
55 3300049823 Ga0501044_0781437 Ga0501044_0781437_31_516 160
56 3300049824 Ga0501045_0007676 Ga0501045_0007676_2672_3157 160
57 3300053104 Ga0500556_0294548 Ga0500556_0294548_112_597 160
58 3300053156 Ga0500622_0005490 Ga0500622_0005490_5355_5840 160
59 3300053156 Ga0500622_0023382 Ga0500622_0023382_1091_1576 160
60 3300005328 Ga0070676_10244757 Ga0070676_102447572 161
61 3300005331 Ga0070670_100960403 Ga0070670_1009604031 161
62 3300005337 Ga0070682_100380704 Ga0070682_1003807043 161
63 3300005435 Ga0070714_100016544 Ga0070714_1000165445 161
64 3300005441 Ga0070700_100443545 Ga0070700_1004435452 161
65 3300005457 Ga0070662_101345891 Ga0070662_1013458911 161
66 3300005539 Ga0068853_100347580 Ga0068853_1003475802 161
67 3300005543 Ga0070672_100881603 Ga0070672_1008816031 161
68 3300006881 Ga0068865_101670708 Ga0068865_1016707081 161
69 3300009094 Ga0111539_10413493 Ga0111539_104134932 161
70 3300009098 Ga0105245_11725803 Ga0105245_117258032 161
71 3300009553 Ga0105249_10656386 Ga0105249_106563862 161
72 3300011119 Ga0105246_10018171 Ga0105246_100181713 161
73 3300013100 Ga0157373_10081430 Ga0157373_100814303 161
74 3300013104 Ga0157370_10008535 Ga0157370_100085356 161
75 3300014969 Ga0157376_10708060 Ga0157376_107080602 161
76 3300025929 Ga0207664_10057107 Ga0207664_100571071 161
77 3300025933 Ga0207706_10041364 Ga0207706_100413644 161
78 3300026067 Ga0207678_10393968 Ga0207678_103939682 161
79 3300026075 Ga0207708_10312592 Ga0207708_103125921 161
80 3300032004 Ga0307414_11221523 Ga0307414_112215231 161
81 3300041453 Ga0451797_1326113 Ga0451797_1326113_392_880 161
82 3300048911 Ga0496108_0008526 Ga0496108_0008526_1077_1565 161
83 3300048912 Ga0496109_0014411 Ga0496109_0014411_5244_5732 161
84 3300048917 Ga0496114_0004305 Ga0496114_0004305_10106_10594 161
85 3300048917 Ga0496114_0333944 Ga0496114_0333944_216_704 161
86 3300049568 Ga0501031_0004640 Ga0501031_0004640_4045_4533 161
87 3300049569 Ga0501032_0004554 Ga0501032_0004554_7142_7630 161
88 3300049569 Ga0501032_0546550 Ga0501032_0546550_221_709 161
89 3300049570 Ga0501033_0003294 Ga0501033_0003294_8208_8696 161
90 3300049571 Ga0501034_0104328 Ga0501034_0104328_2046_2534 161
91 3300049572 Ga0501036_0152732 Ga0501036_0152732_464_952 161
92 3300049572 Ga0501036_0252653 Ga0501036_0252653_468_956 161
93 3300049573 Ga0501037_0018337 Ga0501037_0018337_1772_2260 161
94 3300049574 Ga0501038_0002137 Ga0501038_0002137_7662_8150 161
95 3300049574 Ga0501038_0005554 Ga0501038_0005554_9919_10407 161
96 3300049574 Ga0501038_0566829 Ga0501038_0566829_314_802 161
97 3300049575 Ga0501039_0042737 Ga0501039_0042737_1822_2310 161
98 3300049579 Ga0501043_0095052 Ga0501043_0095052_554_1042 161
99 3300049579 Ga0501043_0101564 Ga0501043_0101564_1405_1893 161
100 3300049579 Ga0501043_0103620 Ga0501043_0103620_1298_1786 161
101 3300049580 Ga0501046_0037109 Ga0501046_0037109_1975_2463 161
102 3300049822 Ga0501035_0000375 Ga0501035_0000375_29715_30203 161
103 3300049823 Ga0501044_0002260 Ga0501044_0002260_10164_10652 161
104 3300049823 Ga0501044_0436710 Ga0501044_0436710_579_1067 161
105 3300049823 Ga0501044_0508958 Ga0501044_0508958_173_661 161
106 3300049824 Ga0501045_0426224 Ga0501045_0426224_328_816 161
107 3300050511 nmdc:mga08y16_262178_c1 nmdc:mga08y16_262178_c1_822_1310 161
108 3300006175 Ga0070712_100009380 Ga0070712_1000093808 162
109 3300041453 Ga0451797_0821516 Ga0451797_0821516_952_1443 163
110 3300049575 Ga0501039_0164778 Ga0501039_0164778_622_1116 163
111 3300049578 Ga0501042_0467241 Ga0501042_0467241_212_706 163
112 3300049587 Ga0501071_0985773 Ga0501071_0985773_94_588 163
113 3300049592 Ga0501076_1189413 Ga0501076_1189413_98_592 163
114 3300003322 rootL2_10302090 rootL2_103020902 164
115 3300005329 Ga0070683_100033377 Ga0070683_1000333774 164
116 3300005329 Ga0070683_100121362 Ga0070683_1001213622 164
117 3300005331 Ga0070670_100063864 Ga0070670_1000638644 164
118 3300005336 Ga0070680_100001339 Ga0070680_1000013392 164
119 3300005354 Ga0070675_100047113 Ga0070675_1000471134 164
120 3300005366 Ga0070659_100507872 Ga0070659_1005078722 164
121 3300005458 Ga0070681_10004469 Ga0070681_100044694 164
122 3300005458 Ga0070681_10192209 Ga0070681_101922092 164
123 3300005458 Ga0070681_10493044 Ga0070681_104930442 164
124 3300005530 Ga0070679_100075044 Ga0070679_1000750444 164
125 3300005535 Ga0070684_100021859 Ga0070684_1000218595 164
126 3300005535 Ga0070684_100140684 Ga0070684_1001406844 164
127 3300005539 Ga0068853_100797262 Ga0068853_1007972622 164
128 3300005543 Ga0070672_100076313 Ga0070672_1000763133 164
129 3300005546 Ga0070696_100555680 Ga0070696_1005556801 164
130 3300005548 Ga0070665_100009025 Ga0070665_1000090252 164
131 3300005564 Ga0070664_100058257 Ga0070664_1000582572 164
132 3300005564 Ga0070664_100335503 Ga0070664_1003355033 164
133 3300005577 Ga0068857_100778899 Ga0068857_1007788991 164
134 3300005719 Ga0068861_100262024 Ga0068861_1002620242 164
135 3300005840 Ga0068870_10512448 Ga0068870_105124482 164
136 3300005844 Ga0068862_100154923 Ga0068862_1001549234 164
137 3300005937 Ga0081455_10207151 Ga0081455_102071512 164
138 3300009093 Ga0105240_10030179 Ga0105240_100301795 164
139 3300009551 Ga0105238_10806899 Ga0105238_108068992 164
140 3300009553 Ga0105249_10004576 Ga0105249_100045767 164
141 3300014326 Ga0157380_10003340 Ga0157380_100033403 164
142 3300014326 Ga0157380_10394395 Ga0157380_103943952 164
143 3300025912 Ga0207707_10049122 Ga0207707_100491222 164
144 3300025912 Ga0207707_10132299 Ga0207707_101322993 164
145 3300025912 Ga0207707_10452446 Ga0207707_104524462 164
146 3300025913 Ga0207695_10337215 Ga0207695_103372152 164
147 3300025917 Ga0207660_10040550 Ga0207660_100405504 164
148 3300025917 Ga0207660_10551266 Ga0207660_105512662 164
149 3300025921 Ga0207652_10446890 Ga0207652_104468903 164
150 3300025926 Ga0207659_10050449 Ga0207659_100504493 164
151 3300025932 Ga0207690_10849345 Ga0207690_108493452 164
152 3300025933 Ga0207706_10159907 Ga0207706_101599072 164
153 3300025940 Ga0207691_10064566 Ga0207691_100645663 164
154 3300025942 Ga0207689_10583731 Ga0207689_105837311 164
155 3300025944 Ga0207661_10882110 Ga0207661_108821101 164
156 3300025945 Ga0207679_10002362 Ga0207679_100023629 164
157 3300025945 Ga0207679_10545594 Ga0207679_105455942 164
158 3300026041 Ga0207639_10563742 Ga0207639_105637422 164
159 3300028379 Ga0268266_10100910 Ga0268266_101009102 164
160 3300028380 Ga0268265_10441009 Ga0268265_104410091 164
161 3300028381 Ga0268264_11153850 Ga0268264_111538501 164
162 3300028794 Ga0307515_10463592 Ga0307515_104635922 164
163 3300031901 Ga0307406_10109772 Ga0307406_101097722 164
164 3300031903 Ga0307407_10172697 Ga0307407_101726974 164
165 3300031995 Ga0307409_100004288 Ga0307409_1000042881 164
166 3300032002 Ga0307416_100019477 Ga0307416_1000194774 164
167 3300032004 Ga0307414_11355910 Ga0307414_113559102 164
168 3300032005 Ga0307411_10066928 Ga0307411_100669284 164
169 3300032126 Ga0307415_100011367 Ga0307415_1000113674 164
170 3300041486 Ga0451807_1525741 Ga0451807_1525741_969_1466 164
171 3300041997 Ga0439431_0039919 Ga0439431_0039919_16_513 164
172 3300042156 Ga0439446_0049131 Ga0439446_0049131_301_798 164
173 3300042185 Ga0450909_003705 Ga0450909_003705_854_1351 164
174 3300042435 Ga0439434_0023571 Ga0439434_0023571_340_837 164
175 3300042531 Ga0450918_005999 Ga0450918_005999_115_612 164
176 3300044658 Ga0466972_0153208 Ga0466972_0153208_206_706 164
177 3300044901 Ga0466960_0344517 Ga0466960_0344517_175_675 164
178 3300048929 Ga0496126_0190807 Ga0496126_0190807_984_1481 164
179 3300049568 Ga0501031_0108306 Ga0501031_0108306_747_1244 164
180 3300049569 Ga0501032_0161020 Ga0501032_0161020_148_645 164
181 3300049570 Ga0501033_0138714 Ga0501033_0138714_850_1350 164
182 3300049572 Ga0501036_0159798 Ga0501036_0159798_931_1428 164
183 3300049573 Ga0501037_0128028 Ga0501037_0128028_642_1142 164
184 3300049575 Ga0501039_0094466 Ga0501039_0094466_837_1337 164
185 3300049576 Ga0501040_0017326 Ga0501040_0017326_3547_4047 164
186 3300049576 Ga0501040_0061826 Ga0501040_0061826_652_1149 164
187 3300049576 Ga0501040_0521491 Ga0501040_0521491_350_847 164
188 3300049577 Ga0501041_0031753 Ga0501041_0031753_1016_1516 164
189 3300049578 Ga0501042_0139514 Ga0501042_0139514_180_680 164
190 3300049578 Ga0501042_0281902 Ga0501042_0281902_56_553 164
191 3300049578 Ga0501042_0507181 Ga0501042_0507181_296_793 164
192 3300049580 Ga0501046_0180967 Ga0501046_0180967_18_518 164
193 3300049582 Ga0501048_0095718 Ga0501048_0095718_651_1151 164
194 3300049582 Ga0501048_0303409 Ga0501048_0303409_373_870 164
195 3300049583 Ga0501067_0076733 Ga0501067_0076733_889_1383 164
196 3300049584 Ga0501068_0000993 Ga0501068_0000993_2243_2743 164
197 3300049586 Ga0501070_0825119 Ga0501070_0825119_112_612 164
198 3300049587 Ga0501071_0002031 Ga0501071_0002031_10592_11092 164
199 3300049587 Ga0501071_0036108 Ga0501071_0036108_1757_2257 164
200 3300049587 Ga0501071_0078394 Ga0501071_0078394_322_819 164
201 3300049587 Ga0501071_0369319 Ga0501071_0369319_301_798 164
202 3300049587 Ga0501071_0972531 Ga0501071_0972531_31_528 164
203 3300049588 Ga0501072_0013542 Ga0501072_0013542_4372_4872 164
204 3300049588 Ga0501072_0123926 Ga0501072_0123926_338_835 164
205 3300049588 Ga0501072_0170221 Ga0501072_0170221_721_1221 164
206 3300049588 Ga0501072_0358665 Ga0501072_0358665_316_813 164
207 3300049589 Ga0501073_0004348 Ga0501073_0004348_4538_5032 164
208 3300049589 Ga0501073_0011413 Ga0501073_0011413_2820_3320 164
209 3300049589 Ga0501073_0089566 Ga0501073_0089566_1420_1917 164
210 3300049590 Ga0501074_0001258 Ga0501074_0001258_5018_5518 164
211 3300049590 Ga0501074_0041711 Ga0501074_0041711_2811_3305 164
212 3300049590 Ga0501074_0062835 Ga0501074_0062835_1458_1958 164
213 3300049590 Ga0501074_0094592 Ga0501074_0094592_1461_1958 164
214 3300049591 Ga0501075_0036056 Ga0501075_0036056_966_1466 164
215 3300049591 Ga0501075_0092871 Ga0501075_0092871_1230_1730 164
216 3300049591 Ga0501075_0110476 Ga0501075_0110476_891_1388 164
217 3300049591 Ga0501075_0362606 Ga0501075_0362606_295_792 164
218 3300049592 Ga0501076_0003440 Ga0501076_0003440_124_624 164
219 3300049592 Ga0501076_0012397 Ga0501076_0012397_2936_3433 164
220 3300049592 Ga0501076_0176200 Ga0501076_0176200_132_629 164
221 3300049592 Ga0501076_0388455 Ga0501076_0388455_538_1032 164
222 3300049593 Ga0501077_0000709 Ga0501077_0000709_5693_6187 164
223 3300049593 Ga0501077_0003316 Ga0501077_0003316_6755_7255 164
224 3300049593 Ga0501077_0169015 Ga0501077_0169015_667_1167 164
225 3300049741 Ga0501079_0001194 Ga0501079_0001194_12809_13309 164
226 3300049741 Ga0501079_0049378 Ga0501079_0049378_1384_1884 164
227 3300049741 Ga0501079_0233768 Ga0501079_0233768_250_747 164
228 3300049742 Ga0501080_0002187 Ga0501080_0002187_13668_14168 164
229 3300049742 Ga0501080_0003968 Ga0501080_0003968_7005_7499 164
230 3300049742 Ga0501080_0115515 Ga0501080_0115515_1256_1756 164
231 3300049743 Ga0501081_0049897 Ga0501081_0049897_829_1329 164
232 3300049743 Ga0501081_0425746 Ga0501081_0425746_211_708 164
233 3300049744 Ga0501083_0008623 Ga0501083_0008623_2698_3198 164
234 3300049744 Ga0501083_0008854 Ga0501083_0008854_1040_1534 164
235 3300049823 Ga0501044_0208839 Ga0501044_0208839_615_1112 164
236 3300049824 Ga0501045_0045413 Ga0501045_0045413_554_1054 164
237 3300049824 Ga0501045_0388853 Ga0501045_0388853_324_821 164
238 3300049824 Ga0501045_0414349 Ga0501045_0414349_448_945 164
239 3300054114 Ga0501084_0005979 Ga0501084_0005979_2526_3020 164
240 3300054114 Ga0501084_0060028 Ga0501084_0060028_2587_3087 164
241 3300060353 Ga0501082_0090541 Ga0501082_0090541_1922_2422 164
242 3300060353 Ga0501082_0371641 Ga0501082_0371641_701_1198 164
243 3300060353 Ga0501082_0568229 Ga0501082_0568229_18_515 164
244 3300061734 Ga0530510_0034308 Ga0530510_0034308_2710_3210 164
245 3300061734 Ga0530510_0355090 Ga0530510_0355090_229_729 164

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01899

MNHE

Na+/H+ ion antiporter subunit

14

164

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qru-assembly1.cif.gz_e structure of bacillus pseudofirmus mrp antiporter complex, monomer 0.8663 11 51
6fp6-assembly1.cif.gz_B complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7681 94 155
6fp6-assembly7.cif.gz_N complex of human cu,zn sod1 with the human copper chaperone for sod1 in a compact conformation 0.7613 94 156
6fon-assembly1.cif.gz_C elongated conformer of the human copper chaperone for sod1 complexed with human sod1 0.7608 96 151
7zc3-assembly1.cif.gz_A crystal structure of human copper chaperone atox1 bound to zinc ion by cxxc motif 0.7528 95 155
ID Description Score Start End Superfamily
af_B6SZL4_173_238_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7893 93 154 3.30.70.100
af_A0A1D6MTC1_251_315_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.775 93 153 3.30.70.100
af_O49613_13_88_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7739 88 155 3.30.70.100
af_A0A0R4IHZ8_1_78_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.773 93 154 3.30.70.100
af_I1JPP7_24_90_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7713 94 157 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A836NTJ5-F1-model_v4 deleted 0.967 93 164
AF-A0A327K3R7-F1-model_v4 Na+/H+ antiporter subunit E 0.9533 92 164 GO:0005886
GO:0008324
AF-A0A836NTJ5-F1-model_v4 deleted 0.9417 93 164
AF-A0A327K3R7-F1-model_v4 Na+/H+ antiporter subunit E 0.941 92 164 GO:0005886
GO:0008324
AF-A0A2E1U2M1-F1-model_v4 Na+/H+ antiporter subunit E 0.9205 61 159 GO:0005886
GO:0008324

Feature Viewer

pLDDT pTM Quality
81.3 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map