F357210

General Info

Members Datasets Scaffolds Average Seq Length
245 161 244 238

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100171151|Ga0068861_1001711513
Length 265
Sequence VSDSDQHDPLPAATVSRVELGLSGRRAAVAAASGGLGFASAKALAAEGARVVICGRDRARIEAAAEEIGNGCIGLVQDVADAAGGEAFVRAATEALGALDIVVANGGGPPAGTFASTPLDAYPTGIDMSLLSVVGMAKTSIPAMQSAGWGRFVAITSVSVRQPIPTLILSNTARAGATGFLKTVAREVAKDGVTVNSVQPGLHSTNRLLSLYGGDTADAVAAIPAGRLGEPADFGAVVAFLCSEQASFVTGLQLHVDGGAYGGLQ

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
92 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
93 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
107 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
115 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
116 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.41
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.82
Nodule 0
Rhizoplane 3.67
Rhizosphere 92.65
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10000776 3300003373 Bacteria 6735
2 Ga0070676_10099117 3300005328 Bacteria 1797
3 Ga0068869_100139386 3300005334 Bacteria 1871
4 Ga0070682_100124017 3300005337 Bacteria 1738
5 Ga0070668_100083401 3300005347 Bacteria 2509
6 Ga0070668_100130651 3300005347 Bacteria 2015
7 Ga0070673_100459846 3300005364 Unclassified 1146
8 Ga0070659_100202495 3300005366 Bacteria 1634
9 Ga0070713_100112888 3300005436 Bacteria 2371
10 Ga0070700_100010967 3300005441 Bacteria 5011
11 Ga0070663_100105618 3300005455 Bacteria 2108
12 Ga0070678_100323104 3300005456 Bacteria 1318
13 Ga0070685_10080977 3300005466 Bacteria 1946
14 Ga0070679_100567204 3300005530 Bacteria 1079
15 Ga0070672_100284491 3300005543 Bacteria 1399
16 Ga0070686_100190196 3300005544 Bacteria 1464
17 Ga0070665_100091374 3300005548 Bacteria 3049
18 Ga0070665_100864710 3300005548 Bacteria 917
19 Ga0070664_100083768 3300005564 Bacteria 2751
20 Ga0068854_100256488 3300005578 Bacteria 1398
21 Ga0068856_100202904 3300005614 Bacteria 1997
22 Ga0068859_100549432 3300005617 Bacteria 1249
23 Ga0068859_100591069 3300005617 Bacteria 1203
24 Ga0068864_100382296 3300005618 Bacteria 1334
25 Ga0068861_100171151 3300005719 Bacteria 1800
26 Ga0068861_100348308 3300005719 Bacteria 1298
27 Ga0068851_10066304 3300005834 Bacteria 1859
28 Ga0068860_100018765 3300005843 Bacteria 6721
29 Ga0068862_100137423 3300005844 Bacteria 2167
30 Ga0081455_10001987 3300005937 Bacteria 24441
31 Ga0081455_10013266 3300005937 Bacteria 8162
32 Ga0081538_10000414 3300005981 Bacteria 48260
33 Ga0075363_100213448 3300006048 Bacteria 1105
34 Ga0075431_100118616 3300006847 Bacteria 2730
35 Ga0075429_100043770 3300006880 Bacteria 3895
36 Ga0075429_100050919 3300006880 Bacteria 3603
37 Ga0068865_100039044 3300006881 Bacteria 3218
38 Ga0097620_100549453 3300006931 Bacteria 1249
39 Ga0097620_100591056 3300006931 Bacteria 1203
40 Ga0111539_10053685 3300009094 Bacteria 4797
41 Ga0105245_10142909 3300009098 Bacteria 2256
42 Ga0105245_10215643 3300009098 Bacteria 1849
43 Ga0114129_10001128 3300009147 Bacteria 35305
44 Ga0114129_10290558 3300009147 Bacteria 2182
45 Ga0114129_10399627 3300009147 Bacteria 1811
46 Ga0105243_10059562 3300009148 Bacteria 3048
47 Ga0105243_10111998 3300009148 Bacteria 2285
48 Ga0105241_10573421 3300009174 Bacteria 1016
49 Ga0105242_10101551 3300009176 Bacteria 2438
50 Ga0105237_10521705 3300009545 Unclassified 1195
51 Ga0105249_10060103 3300009553 Bacteria 3486
52 Ga0105249_10119708 3300009553 Bacteria 2501
53 Ga0105249_10494673 3300009553 Unclassified 1267
54 Ga0105239_10073410 3300010375 Bacteria 3761
55 Ga0157374_10372552 3300013296 Bacteria 1421
56 Ga0157378_10081066 3300013297 Bacteria 2932
57 Ga0157375_10475999 3300013308 Bacteria 1414
58 Ga0157375_10501965 3300013308 Bacteria 1377
59 Ga0157375_10793023 3300013308 Bacteria 1096
60 Ga0163163_10487242 3300014325 Bacteria 1294
61 Ga0157380_10100960 3300014326 Bacteria 2403
62 Ga0157380_10512576 3300014326 Bacteria 1168
63 Ga0157377_10062004 3300014745 Bacteria 2138
64 Ga0157379_10259482 3300014968 Bacteria 1579
65 Ga0157379_10399024 3300014968 Bacteria 1264
66 Ga0157376_10729803 3300014969 Bacteria 998
67 Ga0157376_11083081 3300014969 Bacteria 827
68 Ga0163161_10116145 3300017792 Bacteria 2006
69 Ga0206353_11860205 3300020082 Unclassified 1122
70 Ga0213875_10012421 3300021388 Bacteria 4210
71 Ga0207656_10032218 3300025321 Bacteria 2176
72 Ga0207710_10048918 3300025900 Bacteria 1893
73 Ga0207688_10005926 3300025901 Bacteria 6654
74 Ga0207680_10175758 3300025903 Bacteria 1445
75 Ga0207643_10002709 3300025908 Bacteria 9578
76 Ga0207705_10109250 3300025909 Bacteria 2042
77 Ga0207671_10444994 3300025914 Unclassified 1032
78 Ga0207662_10048691 3300025918 Bacteria 2512
79 Ga0207657_10012721 3300025919 Bacteria 8289
80 Ga0207649_10186206 3300025920 Bacteria 1457
81 Ga0207652_10379715 3300025921 Bacteria 1275
82 Ga0207687_10002682 3300025927 Bacteria 12043
83 Ga0207687_10511782 3300025927 Unclassified 1003
84 Ga0207700_10196769 3300025928 Bacteria 1696
85 Ga0207700_10582900 3300025928 Bacteria 995
86 Ga0207686_10222167 3300025934 Bacteria 1365
87 Ga0207709_10035920 3300025935 Bacteria 2934
88 Ga0207670_10111018 3300025936 Bacteria 1976
89 Ga0207691_10270883 3300025940 Bacteria 1462
90 Ga0207661_10344082 3300025944 Bacteria 1344
91 Ga0207679_10659015 3300025945 Bacteria 947
92 Ga0207667_10281934 3300025949 Bacteria 1698
93 Ga0207651_10652984 3300025960 Unclassified 924
94 Ga0207712_10026285 3300025961 Bacteria 3876
95 Ga0207712_10080834 3300025961 Bacteria 2365
96 Ga0207668_10065785 3300025972 Bacteria 2567
97 Ga0207703_10275384 3300026035 Bacteria 1526
98 Ga0207678_10065321 3300026067 Bacteria 3125
99 Ga0207708_10007886 3300026075 Bacteria 7889
100 Ga0207648_10487646 3300026089 Bacteria 1126
101 Ga0207675_100006019 3300026118 Bacteria 11546
102 Ga0207675_100099664 3300026118 Bacteria 2736
103 Ga0207675_100223693 3300026118 Bacteria 1814
104 Ga0207698_10399469 3300026142 Bacteria 1313
105 Ga0207428_10007533 3300027907 Bacteria 9920
106 Ga0207428_10199029 3300027907 Bacteria 1508
107 Ga0268266_10114243 3300028379 Bacteria 2395
108 Ga0268266_10648483 3300028379 Bacteria 1016
109 Ga0268265_10028983 3300028380 Bacteria 3969
110 Ga0268264_10011356 3300028381 Bacteria 7357
111 Ga0307513_10005317 3300031456 Bacteria 17025
112 Ga0316575_10003805 3300031665 Bacteria 5253
113 Ga0316575_10079436 3300031665 Bacteria 1322
114 Ga0316576_10009407 3300031727 Bacteria 6303
115 Ga0316576_10204040 3300031727 Bacteria 1489
116 Ga0316576_10280325 3300031727 Bacteria 1248
117 Ga0316578_10017994 3300031728 Bacteria 3860
118 Ga0316578_10024490 3300031728 Bacteria 3386
119 Ga0316578_10175522 3300031728 Bacteria 1291
120 Ga0316577_10019509 3300031733 Bacteria 3753
121 Ga0316577_10044484 3300031733 Bacteria 2484
122 Ga0316577_10140959 3300031733 Bacteria 1358
123 Ga0316577_10148966 3300031733 Bacteria 1319
124 Ga0316583_10001723 3300032133 Bacteria 7436
125 Ga0316574_0003469 3300035398 Bacteria 8132
126 Ga0316574_0025941 3300035398 Bacteria 3522
127 Ga0316574_0279077 3300035398 Unclassified 1064
128 Ga0316582_0007374 3300036647 Bacteria 5850
129 Ga0316582_0019231 3300036647 Bacteria 3993
130 Ga0316584_0022673 3300036712 Bacteria 4582
131 Ga0316584_0081629 3300036712 Bacteria 2421
132 Ga0316584_0084959 3300036712 Bacteria 2369
133 Ga0316584_0149408 3300036712 Bacteria 1740
134 Ga0316584_0309091 3300036712 Bacteria 1143
135 Ga0373925_0499306 3300037068 Unclassified 999
136 Ga0436364_0904867 3300037853 Bacteria 6254
137 Ga0400483_048213 3300039062 Bacteria 49637
138 Ga0400483_137356 3300039062 Bacteria 21328
139 Ga0400483_200780 3300039062 Bacteria 45688
140 Ga0451800_1089653 3300041459 Unclassified 854
141 Ga0451853_0662928 3300041512 Bacteria 1118
142 Ga0466963_0384549 3300044694 Bacteria 989
143 Ga0466957_0064022 3300044842 Bacteria 2262
144 Ga0466967_0273232 3300045976 Bacteria 1620
145 Ga0495629_0127752 3300046459 Bacteria 1771
146 Ga0495629_0271290 3300046459 Bacteria 1165
147 Ga0495630_0182272 3300046517 Bacteria 1601
148 Ga0495630_0332433 3300046517 Unclassified 1162
149 Ga0495640_0180582 3300046533 Bacteria 1345
150 Ga0495586_0017167 3300046535 Bacteria 3847
151 Ga0495587_0090956 3300046536 Bacteria 1763
152 Ga0495622_0347661 3300046557 Bacteria 642
153 Ga0495634_0003110 3300046642 Bacteria 13492
154 Ga0495647_0026239 3300046681 Bacteria 2133
155 Ga0495613_0009871 3300046689 Bacteria 7099
156 Ga0495672_0002804 3300047320 Bacteria 15547
157 Ga0495614_0097161 3300048089 Bacteria 1285
158 Ga0496101_0047609 3300048904 Bacteria 3079
159 Ga0496102_0343402 3300048905 Bacteria 1406
160 Ga0496104_0154862 3300048907 Bacteria 2200
161 Ga0496104_0225141 3300048907 Bacteria 1788
162 Ga0496110_0377222 3300048913 Bacteria 1292
163 Ga0496111_0054893 3300048914 Bacteria 2881
164 Ga0496113_0339994 3300048916 Bacteria 1204
165 Ga0496114_0354937 3300048917 Unclassified 1297
166 Ga0501031_0087191 3300049568 Bacteria 2035
167 Ga0501032_0041503 3300049569 Bacteria 3124
168 Ga0501033_0112717 3300049570 Bacteria 1978
169 Ga0501034_0000121 3300049571 Bacteria 144340
170 Ga0501034_0004613 3300049571 Bacteria 15272
171 Ga0501034_0057775 3300049571 Bacteria 3900
172 Ga0501034_0184386 3300049571 Bacteria 2051
173 Ga0501034_0272984 3300049571 Bacteria 1632
174 Ga0501036_0027811 3300049572 Bacteria 4780
175 Ga0501037_0066140 3300049573 Bacteria 2634
176 Ga0501038_0111134 3300049574 Bacteria 2270
177 Ga0501038_0219916 3300049574 Bacteria 1516
178 Ga0501039_0121471 3300049575 Bacteria 2047
179 Ga0501039_0141580 3300049575 Bacteria 1889
180 Ga0501039_0550621 3300049575 Bacteria 905
181 Ga0501040_0003469 3300049576 Bacteria 10170
182 Ga0501040_0007380 3300049576 Bacteria 7117
183 Ga0501040_0496408 3300049576 Bacteria 880
184 Ga0501041_0040269 3300049577 Bacteria 2836
185 Ga0501041_0082950 3300049577 Bacteria 1975
186 Ga0501042_0004743 3300049578 Bacteria 8679
187 Ga0501042_0006679 3300049578 Bacteria 7517
188 Ga0501043_0051976 3300049579 Bacteria 3220
189 Ga0501046_0005524 3300049580 Bacteria 11292
190 Ga0501048_0020386 3300049582 Bacteria 4858
191 Ga0501048_0026501 3300049582 Bacteria 4221
192 Ga0501068_0002107 3300049584 Bacteria 10609
193 Ga0501068_0030572 3300049584 Bacteria 3195
194 Ga0501068_0265235 3300049584 Bacteria 1096
195 Ga0501068_0303576 3300049584 Bacteria 1022
196 Ga0501069_0000038 3300049585 Bacteria 82519
197 Ga0501069_0001319 3300049585 Bacteria 12153
198 Ga0501070_0000008 3300049586 Bacteria 199963
199 Ga0501070_0000447 3300049586 Bacteria 37526
200 Ga0501071_0009922 3300049587 Bacteria 6360
201 Ga0501071_0023101 3300049587 Bacteria 4340
202 Ga0501071_0072173 3300049587 Bacteria 2518
203 Ga0501071_0114298 3300049587 Bacteria 1997
204 Ga0501072_0009465 3300049588 Bacteria 7408
205 Ga0501072_0051820 3300049588 Bacteria 3231
206 Ga0501073_0014960 3300049589 Bacteria 5628
207 Ga0501074_0122158 3300049590 Bacteria 1863
208 Ga0501075_0009928 3300049591 Bacteria 6672
209 Ga0501075_0059601 3300049591 Bacteria 2875
210 Ga0501075_0088530 3300049591 Bacteria 2347
211 Ga0501075_0619159 3300049591 Bacteria 826
212 Ga0501076_0005428 3300049592 Bacteria 9167
213 Ga0501076_0467272 3300049592 Bacteria 1039
214 Ga0501077_0141433 3300049593 Bacteria 1526
215 Ga0501079_0005883 3300049741 Bacteria 9177
216 Ga0501079_0010792 3300049741 Bacteria 6956
217 Ga0501079_0047632 3300049741 Bacteria 3307
218 Ga0501080_0002698 3300049742 Bacteria 15552
219 Ga0501080_0019300 3300049742 Bacteria 6315
220 Ga0501080_0111963 3300049742 Bacteria 2530
221 Ga0501081_0003038 3300049743 Bacteria 10650
222 Ga0501081_0008951 3300049743 Bacteria 6506
223 Ga0501081_0117476 3300049743 Bacteria 1892
224 Ga0501083_0004391 3300049744 Bacteria 9946
225 Ga0501035_0179771 3300049822 Bacteria 1823
226 Ga0501045_0007884 3300049824 Bacteria 7413
227 Ga0501045_0030745 3300049824 Bacteria 3887
228 Ga0501045_0100655 3300049824 Bacteria 2139
229 nmdc:mga0k408_170685_c1 3300050493 Bacteria 1296
230 nmdc:mga05p37_851106_c1 3300050507 Bacteria 990
231 nmdc:mga09592_38413_c1 3300050508 Bacteria 4019
232 nmdc:mga09592_596396_c1 3300050508 Bacteria 947
233 nmdc:mga0qj67_133104_c1 3300050509 Bacteria 2014
234 nmdc:mga0qj67_144651_c1 3300050509 Bacteria 1928
235 nmdc:mga06r32_4466_c1 3300050510 Bacteria 12530
236 nmdc:mga06r32_79863_c1 3300050510 Bacteria 3183
237 nmdc:mga08y16_30462_c1 3300050511 Bacteria 5679
238 nmdc:mga08y16_4862_c1 3300050511 Bacteria 14028
239 Ga0495619_0087748 3300053085 Bacteria 2104
240 Ga0501084_0001216 3300054114 Bacteria 20230
241 Ga0501084_0003951 3300054114 Bacteria 12076
242 Ga0501084_0112242 3300054114 Bacteria 2290
243 Ga0501082_0008784 3300060353 Bacteria 8712
244 Ga0530510_0015162 3300061734 Bacteria 5442

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0347661 Ga0495622_0347661_34_618 188
2 3300039062 Ga0400483_048213 Ga0400483_048213_4474_5223 192
3 3300039062 Ga0400483_200780 Ga0400483_200780_23106_23855 192
4 3300031665 Ga0316575_10003805 Ga0316575_100038053 193
5 3300031728 Ga0316578_10024490 Ga0316578_100244902 193
6 3300031733 Ga0316577_10148966 Ga0316577_101489662 193
7 3300032133 Ga0316583_10001723 Ga0316583_100017235 193
8 3300035398 Ga0316574_0003469 Ga0316574_0003469_251_1039 193
9 3300036647 Ga0316582_0019231 Ga0316582_0019231_2707_3495 193
10 3300036712 Ga0316584_0081629 Ga0316584_0081629_1168_1956 193
11 3300031733 Ga0316577_10044484 Ga0316577_100444843 194
12 3300031728 Ga0316578_10175522 Ga0316578_101755222 195
13 3300036647 Ga0316582_0007374 Ga0316582_0007374_2010_2738 195
14 3300049574 Ga0501038_0111134 Ga0501038_0111134_1089_1844 196
15 3300049578 Ga0501042_0006679 Ga0501042_0006679_4624_5379 196
16 3300049580 Ga0501046_0005524 Ga0501046_0005524_4444_5199 196
17 3300049582 Ga0501048_0020386 Ga0501048_0020386_654_1409 196
18 3300049587 Ga0501071_0114298 Ga0501071_0114298_788_1510 196
19 3300049588 Ga0501072_0009465 Ga0501072_0009465_3934_4689 196
20 3300049593 Ga0501077_0141433 Ga0501077_0141433_239_994 196
21 3300049741 Ga0501079_0010792 Ga0501079_0010792_2195_2950 196
22 3300060353 Ga0501082_0008784 Ga0501082_0008784_3985_4740 196
23 3300061734 Ga0530510_0015162 Ga0530510_0015162_1753_2508 196
24 3300036712 Ga0316584_0084959 Ga0316584_0084959_207_935 197
25 3300006048 Ga0075363_100213448 Ga0075363_1002134482 198
26 3300049571 Ga0501034_0057775 Ga0501034_0057775_1817_2545 200
27 3300049571 Ga0501034_0000121 Ga0501034_0000121_51195_51953 201
28 3300049592 Ga0501076_0467272 Ga0501076_0467272_206_928 202
29 3300009094 Ga0111539_10053685 Ga0111539_100536853 203
30 3300027907 Ga0207428_10007533 Ga0207428_100075339 203
31 3300050511 nmdc:mga08y16_4862_c1 nmdc:mga08y16_4862_c1_3580_4332 203
32 3300005548 Ga0070665_100864710 Ga0070665_1008647101 204
33 3300014968 Ga0157379_10259482 Ga0157379_102594822 204
34 3300028379 Ga0268266_10648483 Ga0268266_106484831 204
35 3300048904 Ga0496101_0047609 Ga0496101_0047609_1962_2714 204
36 3300048907 Ga0496104_0154862 Ga0496104_0154862_26_772 204
37 3300049570 Ga0501033_0112717 Ga0501033_0112717_239_994 204
38 3300049575 Ga0501039_0121471 Ga0501039_0121471_471_1226 204
39 3300049576 Ga0501040_0007380 Ga0501040_0007380_2727_3482 204
40 3300049577 Ga0501041_0082950 Ga0501041_0082950_57_812 204
41 3300049579 Ga0501043_0051976 Ga0501043_0051976_1234_1989 204
42 3300049584 Ga0501068_0002107 Ga0501068_0002107_2620_3339 204
43 3300049591 Ga0501075_0009928 Ga0501075_0009928_5409_6164 204
44 3300049592 Ga0501076_0005428 Ga0501076_0005428_8244_8999 204
45 3300049743 Ga0501081_0003038 Ga0501081_0003038_8338_9093 204
46 3300049824 Ga0501045_0007884 Ga0501045_0007884_2727_3482 204
47 3300054114 Ga0501084_0112242 Ga0501084_0112242_852_1607 204
48 3300005328 Ga0070676_10099117 Ga0070676_100991172 205
49 3300005366 Ga0070659_100202495 Ga0070659_1002024951 205
50 3300005617 Ga0068859_100549432 Ga0068859_1005494321 205
51 3300005834 Ga0068851_10066304 Ga0068851_100663041 205
52 3300006931 Ga0097620_100549453 Ga0097620_1005494531 205
53 3300025321 Ga0207656_10032218 Ga0207656_100322182 205
54 3300026142 Ga0207698_10399469 Ga0207698_103994691 205
55 3300031727 Ga0316576_10204040 Ga0316576_102040402 205
56 3300031727 Ga0316576_10280325 Ga0316576_102803252 205
57 3300048913 Ga0496110_0377222 Ga0496110_0377222_275_1009 205
58 3300048917 Ga0496114_0354937 Ga0496114_0354937_218_952 205
59 3300009147 Ga0114129_10290558 Ga0114129_102905583 206
60 3300009553 Ga0105249_10494673 Ga0105249_104946732 206
61 3300050509 nmdc:mga0qj67_144651_c1 nmdc:mga0qj67_144651_c1_83_826 206
62 3300049591 Ga0501075_0619159 Ga0501075_0619159_61_789 207
63 3300049573 Ga0501037_0066140 Ga0501037_0066140_1473_2198 208
64 3300049574 Ga0501038_0219916 Ga0501038_0219916_693_1418 208
65 3300049575 Ga0501039_0141580 Ga0501039_0141580_978_1703 208
66 3300049577 Ga0501041_0040269 Ga0501041_0040269_1491_2216 208
67 3300049587 Ga0501071_0072173 Ga0501071_0072173_150_875 208
68 3300049591 Ga0501075_0088530 Ga0501075_0088530_145_870 208
69 3300049824 Ga0501045_0100655 Ga0501045_0100655_1134_1859 208
70 3300005364 Ga0070673_100459846 Ga0070673_1004598462 209
71 3300009148 Ga0105243_10111998 Ga0105243_101119982 209
72 3300013308 Ga0157375_10793023 Ga0157375_107930232 209
73 3300014326 Ga0157380_10512576 Ga0157380_105125761 209
74 3300014969 Ga0157376_11083081 Ga0157376_110830811 209
75 3300017792 Ga0163161_10116145 Ga0163161_101161452 209
76 3300025960 Ga0207651_10652984 Ga0207651_106529842 209
77 3300026118 Ga0207675_100099664 Ga0207675_1000996643 209
78 3300031727 Ga0316576_10009407 Ga0316576_100094072 209
79 3300031728 Ga0316578_10017994 Ga0316578_100179942 209
80 3300031733 Ga0316577_10140959 Ga0316577_101409592 209
81 3300035398 Ga0316574_0279077 Ga0316574_0279077_248_976 209
82 3300036712 Ga0316584_0022673 Ga0316584_0022673_3199_3927 209
83 3300041459 Ga0451800_1089653 Ga0451800_1089653_94_822 209
84 3300041512 Ga0451853_0662928 Ga0451853_0662928_224_952 209
85 3300009098 Ga0105245_10215643 Ga0105245_102156432 210
86 3300049568 Ga0501031_0087191 Ga0501031_0087191_1263_2012 210
87 3300049569 Ga0501032_0041503 Ga0501032_0041503_483_1232 210
88 3300049571 Ga0501034_0272984 Ga0501034_0272984_259_1008 210
89 3300049572 Ga0501036_0027811 Ga0501036_0027811_2784_3533 210
90 3300049576 Ga0501040_0003469 Ga0501040_0003469_6708_7457 210
91 3300049582 Ga0501048_0026501 Ga0501048_0026501_3215_3964 210
92 3300049584 Ga0501068_0303576 Ga0501068_0303576_108_857 210
93 3300049587 Ga0501071_0009922 Ga0501071_0009922_4317_5066 210
94 3300049588 Ga0501072_0051820 Ga0501072_0051820_1479_2228 210
95 3300049590 Ga0501074_0122158 Ga0501074_0122158_370_1119 210
96 3300049591 Ga0501075_0059601 Ga0501075_0059601_1500_2249 210
97 3300049741 Ga0501079_0047632 Ga0501079_0047632_1595_2344 210
98 3300049742 Ga0501080_0111963 Ga0501080_0111963_1093_1842 210
99 3300049743 Ga0501081_0008951 Ga0501081_0008951_5438_6187 210
100 3300049822 Ga0501035_0179771 Ga0501035_0179771_156_905 210
101 3300049824 Ga0501045_0030745 Ga0501045_0030745_117_866 210
102 3300054114 Ga0501084_0003951 Ga0501084_0003951_5968_6717 210
103 3300005334 Ga0068869_100139386 Ga0068869_1001393861 211
104 3300005337 Ga0070682_100124017 Ga0070682_1001240171 211
105 3300005347 Ga0070668_100130651 Ga0070668_1001306512 211
106 3300005436 Ga0070713_100112888 Ga0070713_1001128881 211
107 3300005441 Ga0070700_100010967 Ga0070700_1000109676 211
108 3300005455 Ga0070663_100105618 Ga0070663_1001056182 211
109 3300005456 Ga0070678_100323104 Ga0070678_1003231041 211
110 3300005466 Ga0070685_10080977 Ga0070685_100809772 211
111 3300005543 Ga0070672_100284491 Ga0070672_1002844912 211
112 3300005544 Ga0070686_100190196 Ga0070686_1001901961 211
113 3300005548 Ga0070665_100091374 Ga0070665_1000913743 211
114 3300005564 Ga0070664_100083768 Ga0070664_1000837682 211
115 3300005578 Ga0068854_100256488 Ga0068854_1002564882 211
116 3300005614 Ga0068856_100202904 Ga0068856_1002029042 211
117 3300005617 Ga0068859_100591069 Ga0068859_1005910691 211
118 3300005618 Ga0068864_100382296 Ga0068864_1003822962 211
119 3300005719 Ga0068861_100348308 Ga0068861_1003483081 211
120 3300006881 Ga0068865_100039044 Ga0068865_1000390442 211
121 3300006931 Ga0097620_100591056 Ga0097620_1005910561 211
122 3300009148 Ga0105243_10059562 Ga0105243_100595623 211
123 3300009174 Ga0105241_10573421 Ga0105241_105734211 211
124 3300009176 Ga0105242_10101551 Ga0105242_101015512 211
125 3300009545 Ga0105237_10521705 Ga0105237_105217052 211
126 3300009553 Ga0105249_10060103 Ga0105249_100601032 211
127 3300010375 Ga0105239_10073410 Ga0105239_100734102 211
128 3300013296 Ga0157374_10372552 Ga0157374_103725522 211
129 3300013308 Ga0157375_10501965 Ga0157375_105019652 211
130 3300014325 Ga0163163_10487242 Ga0163163_104872421 211
131 3300014326 Ga0157380_10100960 Ga0157380_101009602 211
132 3300014745 Ga0157377_10062004 Ga0157377_100620042 211
133 3300014968 Ga0157379_10399024 Ga0157379_103990242 211
134 3300014969 Ga0157376_10729803 Ga0157376_107298032 211
135 3300020082 Ga0206353_11860205 Ga0206353_118602052 211
136 3300025900 Ga0207710_10048918 Ga0207710_100489182 211
137 3300025901 Ga0207688_10005926 Ga0207688_100059267 211
138 3300025903 Ga0207680_10175758 Ga0207680_101757582 211
139 3300025908 Ga0207643_10002709 Ga0207643_100027094 211
140 3300025909 Ga0207705_10109250 Ga0207705_101092502 211
141 3300025914 Ga0207671_10444994 Ga0207671_104449941 211
142 3300025918 Ga0207662_10048691 Ga0207662_100486912 211
143 3300025919 Ga0207657_10012721 Ga0207657_100127212 211
144 3300025920 Ga0207649_10186206 Ga0207649_101862061 211
145 3300025927 Ga0207687_10511782 Ga0207687_105117821 211
146 3300025928 Ga0207700_10196769 Ga0207700_101967692 211
147 3300025928 Ga0207700_10582900 Ga0207700_105829001 211
148 3300025934 Ga0207686_10222167 Ga0207686_102221671 211
149 3300025935 Ga0207709_10035920 Ga0207709_100359202 211
150 3300025936 Ga0207670_10111018 Ga0207670_101110182 211
151 3300025940 Ga0207691_10270883 Ga0207691_102708832 211
152 3300025944 Ga0207661_10344082 Ga0207661_103440821 211
153 3300025945 Ga0207679_10659015 Ga0207679_106590152 211
154 3300025949 Ga0207667_10281934 Ga0207667_102819342 211
155 3300025961 Ga0207712_10080834 Ga0207712_100808342 211
156 3300026035 Ga0207703_10275384 Ga0207703_102753841 211
157 3300026067 Ga0207678_10065321 Ga0207678_100653212 211
158 3300026075 Ga0207708_10007886 Ga0207708_100078865 211
159 3300026089 Ga0207648_10487646 Ga0207648_104876461 211
160 3300026118 Ga0207675_100006019 Ga0207675_1000060199 211
161 3300027907 Ga0207428_10199029 Ga0207428_101990291 211
162 3300028379 Ga0268266_10114243 Ga0268266_101142431 211
163 3300048905 Ga0496102_0343402 Ga0496102_0343402_483_1217 211
164 3300048907 Ga0496104_0225141 Ga0496104_0225141_879_1613 211
165 3300048914 Ga0496111_0054893 Ga0496111_0054893_750_1484 211
166 3300048916 Ga0496113_0339994 Ga0496113_0339994_61_795 211
167 3300050511 nmdc:mga08y16_30462_c1 nmdc:mga08y16_30462_c1_792_1526 211
168 3300031456 Ga0307513_10005317 Ga0307513_100053172 212
169 3300031665 Ga0316575_10079436 Ga0316575_100794362 213
170 3300035398 Ga0316574_0025941 Ga0316574_0025941_2654_3445 213
171 3300039062 Ga0400483_137356 Ga0400483_137356_12529_13287 213
172 3300047320 Ga0495672_0002804 Ga0495672_0002804_6369_7115 213
173 3300049576 Ga0501040_0496408 Ga0501040_0496408_58_801 213
174 3300006847 Ga0075431_100118616 Ga0075431_1001186163 214
175 3300006880 Ga0075429_100043770 Ga0075429_1000437705 214
176 3300006880 Ga0075429_100050919 Ga0075429_1000509193 214
177 3300009147 Ga0114129_10399627 Ga0114129_103996272 214
178 3300049578 Ga0501042_0004743 Ga0501042_0004743_6785_7534 214
179 3300049584 Ga0501068_0265235 Ga0501068_0265235_180_935 214
180 3300049585 Ga0501069_0000038 Ga0501069_0000038_72180_72935 214
181 3300049586 Ga0501070_0000008 Ga0501070_0000008_90890_91645 214
182 3300049587 Ga0501071_0023101 Ga0501071_0023101_468_1223 214
183 3300049742 Ga0501080_0002698 Ga0501080_0002698_5421_6176 214
184 3300050507 nmdc:mga05p37_851106_c1 nmdc:mga05p37_851106_c1_198_941 214
185 3300050508 nmdc:mga09592_38413_c1 nmdc:mga09592_38413_c1_1590_2333 214
186 3300050508 nmdc:mga09592_596396_c1 nmdc:mga09592_596396_c1_192_935 214
187 3300050509 nmdc:mga0qj67_133104_c1 nmdc:mga0qj67_133104_c1_391_1134 214
188 3300050510 nmdc:mga06r32_4466_c1 nmdc:mga06r32_4466_c1_2334_3077 214
189 3300005347 Ga0070668_100083401 Ga0070668_1000834013 215
190 3300005530 Ga0070679_100567204 Ga0070679_1005672042 215
191 3300005719 Ga0068861_100171151 Ga0068861_1001711513 215
192 3300005843 Ga0068860_100018765 Ga0068860_1000187652 215
193 3300005844 Ga0068862_100137423 Ga0068862_1001374232 215
194 3300009098 Ga0105245_10142909 Ga0105245_101429092 215
195 3300009553 Ga0105249_10119708 Ga0105249_101197083 215
196 3300013297 Ga0157378_10081066 Ga0157378_100810662 215
197 3300013308 Ga0157375_10475999 Ga0157375_104759992 215
198 3300021388 Ga0213875_10012421 Ga0213875_100124213 215
199 3300025921 Ga0207652_10379715 Ga0207652_103797152 215
200 3300025927 Ga0207687_10002682 Ga0207687_100026829 215
201 3300025961 Ga0207712_10026285 Ga0207712_100262853 215
202 3300025972 Ga0207668_10065785 Ga0207668_100657853 215
203 3300026118 Ga0207675_100223693 Ga0207675_1002236933 215
204 3300028380 Ga0268265_10028983 Ga0268265_100289832 215
205 3300028381 Ga0268264_10011356 Ga0268264_100113562 215
206 3300037068 Ga0373925_0499306 Ga0373925_0499306_13_759 215
207 3300037853 Ga0436364_0904867 Ga0436364_0904867_4455_5207 215
208 3300045976 Ga0466967_0273232 Ga0466967_0273232_20_733 215
209 3300046459 Ga0495629_0127752 Ga0495629_0127752_307_1053 215
210 3300046459 Ga0495629_0271290 Ga0495629_0271290_97_843 215
211 3300046517 Ga0495630_0182272 Ga0495630_0182272_628_1374 215
212 3300046517 Ga0495630_0332433 Ga0495630_0332433_251_997 215
213 3300046533 Ga0495640_0180582 Ga0495640_0180582_416_1162 215
214 3300046535 Ga0495586_0017167 Ga0495586_0017167_955_1701 215
215 3300046536 Ga0495587_0090956 Ga0495587_0090956_536_1282 215
216 3300046642 Ga0495634_0003110 Ga0495634_0003110_10361_11107 215
217 3300046681 Ga0495647_0026239 Ga0495647_0026239_564_1313 215
218 3300046689 Ga0495613_0009871 Ga0495613_0009871_5957_6703 215
219 3300048089 Ga0495614_0097161 Ga0495614_0097161_38_787 215
220 3300049584 Ga0501068_0030572 Ga0501068_0030572_320_1066 215
221 3300049585 Ga0501069_0001319 Ga0501069_0001319_677_1423 215
222 3300049586 Ga0501070_0000447 Ga0501070_0000447_32760_33506 215
223 3300049589 Ga0501073_0014960 Ga0501073_0014960_3470_4216 215
224 3300049741 Ga0501079_0005883 Ga0501079_0005883_7247_7993 215
225 3300049742 Ga0501080_0019300 Ga0501080_0019300_1168_1914 215
226 3300049744 Ga0501083_0004391 Ga0501083_0004391_4193_4939 215
227 3300050493 nmdc:mga0k408_170685_c1 nmdc:mga0k408_170685_c1_310_1056 215
228 3300053085 Ga0495619_0087748 Ga0495619_0087748_1243_1989 215
229 3300054114 Ga0501084_0001216 Ga0501084_0001216_15899_16645 215
230 iso_pu_bacteria 2622736605 2623500927 215
231 3300036712 Ga0316584_0309091 Ga0316584_0309091_10_699 217
232 3300003373 JGI25407J50210_10000776 JGI25407J50210_100007763 218
233 3300005937 Ga0081455_10001987 Ga0081455_100019877 218
234 3300005937 Ga0081455_10013266 Ga0081455_1001326610 218
235 3300005981 Ga0081538_10000414 Ga0081538_1000041443 218
236 3300009147 Ga0114129_10001128 Ga0114129_1000112830 218
237 3300031733 Ga0316577_10019509 Ga0316577_100195093 218
238 3300036712 Ga0316584_0149408 Ga0316584_0149408_787_1578 218
239 3300044694 Ga0466963_0384549 Ga0466963_0384549_165_941 218
240 3300044842 Ga0466957_0064022 Ga0466957_0064022_1340_2116 218
241 3300049571 Ga0501034_0004613 Ga0501034_0004613_4393_5151 218
242 3300049571 Ga0501034_0184386 Ga0501034_0184386_528_1286 218
243 3300049575 Ga0501039_0550621 Ga0501039_0550621_24_686 218
244 3300049743 Ga0501081_0117476 Ga0501081_0117476_505_1260 218
245 3300050510 nmdc:mga06r32_79863_c1 nmdc:mga06r32_79863_c1_397_1158 218

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

25

212

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

30

261

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u4c-assembly1.cif.gz_A-2 crystal structure of ywfh, nadph dependent reductase involved in bacilysin biosynthesis 0.9124 2 215
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9111 12 210
3enn-assembly1.cif.gz_D 2.1a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis (p43212) 0.9104 1 212
7djs-assembly1.cif.gz_D crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9093 1 211
3emk-assembly1.cif.gz_B 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9082 1 212
ID Description Score Start End Superfamily
af_P9WGQ5_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9066 1 210 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9061 1 150 3.40.50.720
5jy1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9041 1 211 3.40.50.720
5k9zA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9024 1 210 3.40.50.720
4imrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8989 1 209 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A127P729-F1-model_v4 3-oxoacyl-(Acyl carrier protein) reductase 0.9412 28 215
AF-A0A127P729-F1-model_v4 3-oxoacyl-(Acyl carrier protein) reductase 0.9364 28 215
AF-U1ZQC4-F1-model_v4 3-oxoacyl-ACP reductase 0.926 2 216
AF-A0A7Y3LHQ8-F1-model_v4 SDR family oxidoreductase 0.9242 1 216
AF-A0A496R2D8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9236 1 216

Feature Viewer

pLDDT pTM Quality
94.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map