F357310
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 245 | 133 | 244 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_11400774|Ga0114129_114007741 |
| Length | 185 |
| Sequence | VLHGQHLSSIVLRTNKRNELTFSKKLSQVNTLITIEHYVNREIIINAPRQKVFDFLKLLKNQDQFNKWATADKKNRKEEFKGTDGTVGFIYSWSGDKSAGRGEKEIKNIIEGKRIETEIRFVKPMRVAASVIFETESLSDDQTKVNLINTGTLKYPLNIMIPMAEKRFPKDMDESLSTLKNILEK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 53 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 76 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 110 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 113 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 114 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 115 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 116 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 120 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 121 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 122 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 123 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 124 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 127 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 132 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 133 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0 |
| Isolates | 0.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.22 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 95.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10003380 | 3300002459 | Bacteria | 3218 |
| 2 | rootH2_10072655 | 3300003320 | Bacteria | 2182 |
| 3 | rootL2_10008241 | 3300003322 | Unclassified | 2156 |
| 4 | Ga0065712_10347044 | 3300005290 | Bacteria | 792 |
| 5 | Ga0065707_10784166 | 3300005295 | Bacteria | 605 |
| 6 | Ga0070658_10435428 | 3300005327 | Bacteria | 1129 |
| 7 | Ga0070676_10226370 | 3300005328 | Unclassified | 1238 |
| 8 | Ga0070690_100355047 | 3300005330 | Bacteria | 1065 |
| 9 | Ga0070670_100095972 | 3300005331 | Bacteria | 2550 |
| 10 | Ga0070670_100291970 | 3300005331 | Bacteria | 1425 |
| 11 | Ga0070670_100397088 | 3300005331 | Bacteria | 1217 |
| 12 | Ga0070670_101198741 | 3300005331 | Bacteria | 694 |
| 13 | Ga0068869_100140476 | 3300005334 | Unclassified | 1864 |
| 14 | Ga0068869_100457021 | 3300005334 | Bacteria | 1059 |
| 15 | Ga0070666_10000041 | 3300005335 | Bacteria | 112410 |
| 16 | Ga0070666_10272213 | 3300005335 | Bacteria | 1202 |
| 17 | Ga0068868_100009572 | 3300005338 | Bacteria | 6986 |
| 18 | Ga0068868_100285586 | 3300005338 | Bacteria | 1398 |
| 19 | Ga0068868_100709112 | 3300005338 | Bacteria | 901 |
| 20 | Ga0070689_100509764 | 3300005340 | Bacteria | 1032 |
| 21 | Ga0070689_101077177 | 3300005340 | Bacteria | 718 |
| 22 | Ga0070687_100094057 | 3300005343 | Bacteria | 1664 |
| 23 | Ga0070687_100143483 | 3300005343 | Bacteria | 1393 |
| 24 | Ga0070687_100153031 | 3300005343 | Bacteria | 1356 |
| 25 | Ga0070661_100816472 | 3300005344 | Bacteria | 766 |
| 26 | Ga0070692_10833650 | 3300005345 | Bacteria | 632 |
| 27 | Ga0070668_100749270 | 3300005347 | Unclassified | 864 |
| 28 | Ga0070668_100799096 | 3300005347 | Bacteria | 838 |
| 29 | Ga0070669_100250788 | 3300005353 | Bacteria | 1409 |
| 30 | Ga0070669_100432632 | 3300005353 | Bacteria | 1082 |
| 31 | Ga0070675_100014588 | 3300005354 | Bacteria | 6196 |
| 32 | Ga0070675_100589610 | 3300005354 | Bacteria | 1007 |
| 33 | Ga0070671_100024447 | 3300005355 | Bacteria | 4945 |
| 34 | Ga0070673_100680900 | 3300005364 | Bacteria | 943 |
| 35 | Ga0070673_100686063 | 3300005364 | Bacteria | 940 |
| 36 | Ga0070688_100011452 | 3300005365 | Bacteria | 4927 |
| 37 | Ga0070688_100064478 | 3300005365 | Bacteria | 2325 |
| 38 | Ga0070688_100228534 | 3300005365 | Bacteria | 1315 |
| 39 | Ga0070667_100109441 | 3300005367 | Bacteria | 2394 |
| 40 | Ga0070667_100549517 | 3300005367 | Unclassified | 1061 |
| 41 | Ga0070701_10062120 | 3300005438 | Bacteria | 1972 |
| 42 | Ga0068867_101492787 | 3300005459 | Unclassified | 629 |
| 43 | Ga0070685_10034136 | 3300005466 | Bacteria | 2863 |
| 44 | Ga0070685_10059889 | 3300005466 | Bacteria | 2224 |
| 45 | Ga0070698_100007455 | 3300005471 | Bacteria | 11839 |
| 46 | Ga0070698_100341924 | 3300005471 | Bacteria | 1428 |
| 47 | Ga0070672_100140189 | 3300005543 | Bacteria | 1994 |
| 48 | Ga0070686_100349874 | 3300005544 | Bacteria | 1110 |
| 49 | Ga0070693_100908801 | 3300005547 | Unclassified | 660 |
| 50 | Ga0070665_100374730 | 3300005548 | Unclassified | 1430 |
| 51 | Ga0070704_100191040 | 3300005549 | Bacteria | 1646 |
| 52 | Ga0068855_100770235 | 3300005563 | Bacteria | 1025 |
| 53 | Ga0070664_100142531 | 3300005564 | Bacteria | 2111 |
| 54 | Ga0068857_100147927 | 3300005577 | Bacteria | 2126 |
| 55 | Ga0068857_100226525 | 3300005577 | Bacteria | 1708 |
| 56 | Ga0068857_100745474 | 3300005577 | Bacteria | 933 |
| 57 | Ga0068854_100110010 | 3300005578 | Bacteria | 2077 |
| 58 | Ga0068852_100557173 | 3300005616 | Bacteria | 1147 |
| 59 | Ga0068859_100000139 | 3300005617 | Bacteria | 68691 |
| 60 | Ga0068859_100208893 | 3300005617 | Bacteria | 2038 |
| 61 | Ga0068864_100021861 | 3300005618 | Bacteria | 5362 |
| 62 | Ga0068864_100197046 | 3300005618 | Bacteria | 1849 |
| 63 | Ga0068861_100945440 | 3300005719 | Bacteria | 819 |
| 64 | Ga0068851_10000094 | 3300005834 | Bacteria | 49249 |
| 65 | Ga0068870_10039516 | 3300005840 | Bacteria | 2442 |
| 66 | Ga0068863_100005882 | 3300005841 | Bacteria | 12020 |
| 67 | Ga0068863_100479551 | 3300005841 | Bacteria | 1223 |
| 68 | Ga0068863_100721902 | 3300005841 | Bacteria | 991 |
| 69 | Ga0068858_100015680 | 3300005842 | Bacteria | 7129 |
| 70 | Ga0068860_100008378 | 3300005843 | Bacteria | 10296 |
| 71 | Ga0068860_100186129 | 3300005843 | Bacteria | 2008 |
| 72 | Ga0068860_100411500 | 3300005843 | Bacteria | 1339 |
| 73 | Ga0068862_100011449 | 3300005844 | Bacteria | 7321 |
| 74 | Ga0068862_100394136 | 3300005844 | Bacteria | 1294 |
| 75 | Ga0081539_10311526 | 3300005985 | Bacteria | 672 |
| 76 | Ga0097621_100030652 | 3300006237 | Unclassified | 4260 |
| 77 | Ga0097621_101857309 | 3300006237 | Bacteria | 575 |
| 78 | Ga0068871_100067023 | 3300006358 | Bacteria | 2943 |
| 79 | Ga0068871_100100696 | 3300006358 | Bacteria | 2421 |
| 80 | Ga0068871_100957174 | 3300006358 | Bacteria | 796 |
| 81 | Ga0075428_100249467 | 3300006844 | Unclassified | 1913 |
| 82 | Ga0075428_100453323 | 3300006844 | Bacteria | 1374 |
| 83 | Ga0068865_100429292 | 3300006881 | Bacteria | 1088 |
| 84 | Ga0068865_100437709 | 3300006881 | Bacteria | 1078 |
| 85 | Ga0068865_100754486 | 3300006881 | Bacteria | 836 |
| 86 | Ga0097620_100000139 | 3300006931 | Bacteria | 68691 |
| 87 | Ga0097620_100208909 | 3300006931 | Bacteria | 2038 |
| 88 | Ga0111539_10124034 | 3300009094 | Bacteria | 3027 |
| 89 | Ga0111539_10125368 | 3300009094 | Bacteria | 3009 |
| 90 | Ga0111539_10179579 | 3300009094 | Bacteria | 2473 |
| 91 | Ga0105247_10001499 | 3300009101 | Bacteria | 16717 |
| 92 | Ga0105247_10197914 | 3300009101 | Unclassified | 1348 |
| 93 | Ga0114129_10938162 | 3300009147 | Unclassified | 1094 |
| 94 | Ga0114129_11400774 | 3300009147 | Bacteria | 863 |
| 95 | Ga0105241_10001041 | 3300009174 | Bacteria | 21106 |
| 96 | Ga0105241_11296751 | 3300009174 | Bacteria | 693 |
| 97 | Ga0105242_10128238 | 3300009176 | Bacteria | 2186 |
| 98 | Ga0105242_10134535 | 3300009176 | Bacteria | 2138 |
| 99 | Ga0105242_10740901 | 3300009176 | Bacteria | 966 |
| 100 | Ga0105237_10145523 | 3300009545 | Bacteria | 2365 |
| 101 | Ga0105249_10041400 | 3300009553 | Unclassified | 4188 |
| 102 | Ga0105249_10043223 | 3300009553 | Bacteria | 4099 |
| 103 | Ga0105249_10081029 | 3300009553 | Bacteria | 3016 |
| 104 | Ga0105249_10233767 | 3300009553 | Bacteria | 1814 |
| 105 | Ga0105249_11972931 | 3300009553 | Bacteria | 656 |
| 106 | Ga0105246_10016857 | 3300011119 | Bacteria | 4635 |
| 107 | Ga0157371_10202731 | 3300013102 | Bacteria | 1422 |
| 108 | Ga0157370_11113290 | 3300013104 | Bacteria | 713 |
| 109 | Ga0157374_10122942 | 3300013296 | Unclassified | 2507 |
| 110 | Ga0157374_10240875 | 3300013296 | Bacteria | 1779 |
| 111 | Ga0157374_11006751 | 3300013296 | Unclassified | 852 |
| 112 | Ga0157378_10012625 | 3300013297 | Bacteria | 7394 |
| 113 | Ga0157378_10111420 | 3300013297 | Unclassified | 2509 |
| 114 | Ga0157378_10112286 | 3300013297 | Bacteria | 2500 |
| 115 | Ga0157378_10553240 | 3300013297 | Bacteria | 1156 |
| 116 | Ga0163162_10007246 | 3300013306 | Bacteria | 10765 |
| 117 | Ga0163162_10275480 | 3300013306 | Unclassified | 1814 |
| 118 | Ga0163162_10857452 | 3300013306 | Bacteria | 1023 |
| 119 | Ga0163162_10907969 | 3300013306 | Bacteria | 994 |
| 120 | Ga0163162_10939405 | 3300013306 | Bacteria | 976 |
| 121 | Ga0163162_11147211 | 3300013306 | Bacteria | 881 |
| 122 | Ga0163162_11163010 | 3300013306 | Bacteria | 875 |
| 123 | Ga0157372_10000251 | 3300013307 | Bacteria | 59407 |
| 124 | Ga0157372_10084406 | 3300013307 | Bacteria | 3599 |
| 125 | Ga0157375_10064116 | 3300013308 | Unclassified | 3657 |
| 126 | Ga0157375_10098485 | 3300013308 | Bacteria | 3001 |
| 127 | Ga0157375_10109853 | 3300013308 | Bacteria | 2854 |
| 128 | Ga0157375_10227359 | 3300013308 | Bacteria | 2024 |
| 129 | Ga0157375_10802487 | 3300013308 | Unclassified | 1090 |
| 130 | Ga0157375_12314250 | 3300013308 | Bacteria | 641 |
| 131 | Ga0163163_10231784 | 3300014325 | Bacteria | 1896 |
| 132 | Ga0157380_10000013 | 3300014326 | Bacteria | 131248 |
| 133 | Ga0157380_10001341 | 3300014326 | Bacteria | 16027 |
| 134 | Ga0157380_10297786 | 3300014326 | Bacteria | 1484 |
| 135 | Ga0157380_10913049 | 3300014326 | Bacteria | 905 |
| 136 | Ga0157380_11918440 | 3300014326 | Bacteria | 653 |
| 137 | Ga0157377_10456442 | 3300014745 | Bacteria | 883 |
| 138 | Ga0157379_10518115 | 3300014968 | Bacteria | 1107 |
| 139 | Ga0157376_10134966 | 3300014969 | Bacteria | 2207 |
| 140 | Ga0163161_10108624 | 3300017792 | Bacteria | 2071 |
| 141 | Ga0213876_10007588 | 3300021384 | Bacteria | 5888 |
| 142 | Ga0207656_10000061 | 3300025321 | Bacteria | 42734 |
| 143 | Ga0207710_10055859 | 3300025900 | Bacteria | 1780 |
| 144 | Ga0207680_10020624 | 3300025903 | Bacteria | 3552 |
| 145 | Ga0207680_10335821 | 3300025903 | Bacteria | 1059 |
| 146 | Ga0207645_10008025 | 3300025907 | Bacteria | 7404 |
| 147 | Ga0207645_10167956 | 3300025907 | Unclassified | 1437 |
| 148 | Ga0207643_10035742 | 3300025908 | Bacteria | 2787 |
| 149 | Ga0207643_10367216 | 3300025908 | Unclassified | 905 |
| 150 | Ga0207654_10004289 | 3300025911 | Bacteria | 7193 |
| 151 | Ga0207671_10113477 | 3300025914 | Bacteria | 2064 |
| 152 | Ga0207662_10032371 | 3300025918 | Bacteria | 3043 |
| 153 | Ga0207662_10173748 | 3300025918 | Bacteria | 1383 |
| 154 | Ga0207662_10371748 | 3300025918 | Bacteria | 964 |
| 155 | Ga0207662_10513098 | 3300025918 | Bacteria | 827 |
| 156 | Ga0207662_10620850 | 3300025918 | Bacteria | 753 |
| 157 | Ga0207681_10237841 | 3300025923 | Bacteria | 1416 |
| 158 | Ga0207650_10056219 | 3300025925 | Unclassified | 2923 |
| 159 | Ga0207650_10185912 | 3300025925 | Bacteria | 1658 |
| 160 | Ga0207650_10801926 | 3300025925 | Bacteria | 798 |
| 161 | Ga0207659_10244904 | 3300025926 | Bacteria | 1452 |
| 162 | Ga0207644_11200137 | 3300025931 | Bacteria | 638 |
| 163 | Ga0207670_10626475 | 3300025936 | Bacteria | 885 |
| 164 | Ga0207669_10323149 | 3300025937 | Bacteria | 1182 |
| 165 | Ga0207704_10177076 | 3300025938 | Bacteria | 1537 |
| 166 | Ga0207704_10445649 | 3300025938 | Bacteria | 1032 |
| 167 | Ga0207704_10979313 | 3300025938 | Bacteria | 714 |
| 168 | Ga0207691_10021564 | 3300025940 | Bacteria | 6081 |
| 169 | Ga0207691_10039832 | 3300025940 | Bacteria | 4346 |
| 170 | Ga0207691_10093647 | 3300025940 | Unclassified | 2689 |
| 171 | Ga0207689_10488016 | 3300025942 | Bacteria | 1032 |
| 172 | Ga0207689_11037209 | 3300025942 | Bacteria | 692 |
| 173 | Ga0207679_10323161 | 3300025945 | Unclassified | 1337 |
| 174 | Ga0207667_10286021 | 3300025949 | Unclassified | 1685 |
| 175 | Ga0207651_10030579 | 3300025960 | Bacteria | 3431 |
| 176 | Ga0207651_10386442 | 3300025960 | Bacteria | 1187 |
| 177 | Ga0207651_11311603 | 3300025960 | Bacteria | 651 |
| 178 | Ga0207712_10025942 | 3300025961 | Bacteria | 3899 |
| 179 | Ga0207712_10053926 | 3300025961 | Bacteria | 2823 |
| 180 | Ga0207712_10262453 | 3300025961 | Bacteria | 1401 |
| 181 | Ga0207712_10771221 | 3300025961 | Bacteria | 844 |
| 182 | Ga0207668_10460454 | 3300025972 | Bacteria | 1087 |
| 183 | Ga0207668_10721879 | 3300025972 | Bacteria | 877 |
| 184 | Ga0207640_10042114 | 3300025981 | Bacteria | 2910 |
| 185 | Ga0207658_10472293 | 3300025986 | Bacteria | 1113 |
| 186 | Ga0207658_10872080 | 3300025986 | Unclassified | 819 |
| 187 | Ga0207658_11040333 | 3300025986 | Bacteria | 747 |
| 188 | Ga0207677_10028549 | 3300026023 | Bacteria | 3531 |
| 189 | Ga0207703_10011582 | 3300026035 | Bacteria | 6857 |
| 190 | Ga0207703_10063158 | 3300026035 | Bacteria | 3036 |
| 191 | Ga0207703_11258135 | 3300026035 | Bacteria | 712 |
| 192 | Ga0207708_10041721 | 3300026075 | Bacteria | 3498 |
| 193 | Ga0207708_10317217 | 3300026075 | Bacteria | 1271 |
| 194 | Ga0207641_10001301 | 3300026088 | Bacteria | 24754 |
| 195 | Ga0207641_10054164 | 3300026088 | Bacteria | 3403 |
| 196 | Ga0207641_10230856 | 3300026088 | Unclassified | 1720 |
| 197 | Ga0207648_10037869 | 3300026089 | Unclassified | 4245 |
| 198 | Ga0207648_10047735 | 3300026089 | Unclassified | 3751 |
| 199 | Ga0207648_10079074 | 3300026089 | Bacteria | 2869 |
| 200 | Ga0207648_10531358 | 3300026089 | Bacteria | 1079 |
| 201 | Ga0207648_11240633 | 3300026089 | Unclassified | 700 |
| 202 | Ga0207676_10076936 | 3300026095 | Bacteria | 2698 |
| 203 | Ga0207676_10412583 | 3300026095 | Bacteria | 1265 |
| 204 | Ga0207674_10028784 | 3300026116 | Bacteria | 5858 |
| 205 | Ga0207674_10089245 | 3300026116 | Bacteria | 3075 |
| 206 | Ga0207674_10285297 | 3300026116 | Bacteria | 1599 |
| 207 | Ga0207674_10370726 | 3300026116 | Bacteria | 1384 |
| 208 | Ga0207674_10782766 | 3300026116 | Unclassified | 921 |
| 209 | Ga0207675_100181426 | 3300026118 | Bacteria | 2016 |
| 210 | Ga0207675_100406172 | 3300026118 | Bacteria | 1343 |
| 211 | Ga0207675_100839000 | 3300026118 | Bacteria | 933 |
| 212 | Ga0207683_10499662 | 3300026121 | Bacteria | 1123 |
| 213 | Ga0207428_10413307 | 3300027907 | Bacteria | 987 |
| 214 | Ga0268265_10025384 | 3300028380 | Bacteria | 4205 |
| 215 | Ga0268264_10005049 | 3300028381 | Bacteria | 11171 |
| 216 | Ga0268264_10163225 | 3300028381 | Bacteria | 2009 |
| 217 | Ga0268264_10427499 | 3300028381 | Unclassified | 1278 |
| 218 | Ga0307515_10000092 | 3300028794 | Bacteria | 212425 |
| 219 | Ga0265327_10000533 | 3300031251 | Bacteria | 65500 |
| 220 | Ga0265327_10001555 | 3300031251 | Bacteria | 28194 |
| 221 | Ga0265327_10069925 | 3300031251 | Bacteria | 1760 |
| 222 | Ga0265327_10247166 | 3300031251 | Bacteria | 795 |
| 223 | Ga0307513_10413241 | 3300031456 | Bacteria | 1081 |
| 224 | Ga0307509_10318907 | 3300031507 | Unclassified | 1292 |
| 225 | Ga0265314_10056118 | 3300031711 | Bacteria | 2713 |
| 226 | Ga0373947_0402605 | 3300035725 | Bacteria | 923 |
| 227 | Ga0395900_0089985 | 3300037418 | Bacteria | 3155 |
| 228 | Ga0395905_0001159 | 3300037471 | Bacteria | 32949 |
| 229 | Ga0395905_0622910 | 3300037471 | Unclassified | 981 |
| 230 | Ga0395901_0001563 | 3300038443 | Bacteria | 23722 |
| 231 | Ga0436365_1855296 | 3300039437 | Bacteria | 37922 |
| 232 | Ga0436363_1178106 | 3300039450 | Bacteria | 867 |
| 233 | Ga0451577_0147593 | 3300042876 | Bacteria | 2115 |
| 234 | Ga0453683_0715754 | 3300044673 | Bacteria | 656 |
| 235 | Ga0453684_0027727 | 3300044712 | Bacteria | 8108 |
| 236 | Ga0453684_0063618 | 3300044712 | Bacteria | 4718 |
| 237 | Ga0451576_0046320 | 3300045051 | Bacteria | 4580 |
| 238 | Ga0495668_0000115 | 3300046616 | Bacteria | 125423 |
| 239 | Ga0495672_0028363 | 3300047320 | Bacteria | 3544 |
| 240 | nmdc:mga05p37_155638_c1 | 3300050507 | Bacteria | 2793 |
| 241 | nmdc:mga08y16_153766_c1 | 3300050511 | Bacteria | 2391 |
| 242 | Ga0500578_0001279 | 3300053086 | Bacteria | 26009 |
| 243 | Ga0500583_0171293 | 3300053092 | Bacteria | 1081 |
| 244 | Ga0500652_297196 | 3300053131 | Bacteria | 626 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0001563 | Ga0395901_0001563_1051_1584 | 135 |
| 2 | 3300009174 | Ga0105241_11296751 | Ga0105241_112967512 | 136 |
| 3 | 3300025938 | Ga0207704_10445649 | Ga0207704_104456491 | 137 |
| 4 | 3300025961 | Ga0207712_10262453 | Ga0207712_102624532 | 137 |
| 5 | 3300025986 | Ga0207658_10872080 | Ga0207658_108720801 | 137 |
| 6 | 3300026121 | Ga0207683_10499662 | Ga0207683_104996621 | 137 |
| 7 | 3300013306 | Ga0163162_10857452 | Ga0163162_108574522 | 138 |
| 8 | 3300026089 | Ga0207648_10531358 | Ga0207648_105313581 | 138 |
| 9 | 3300013306 | Ga0163162_11147211 | Ga0163162_111472112 | 139 |
| 10 | 3300005331 | Ga0070670_100291970 | Ga0070670_1002919701 | 140 |
| 11 | 3300005343 | Ga0070687_100094057 | Ga0070687_1000940572 | 140 |
| 12 | 3300005459 | Ga0068867_101492787 | Ga0068867_1014927871 | 140 |
| 13 | 3300005618 | Ga0068864_100197046 | Ga0068864_1001970462 | 140 |
| 14 | 3300013307 | Ga0157372_10000251 | Ga0157372_1000025143 | 140 |
| 15 | 3300025936 | Ga0207670_10626475 | Ga0207670_106264751 | 140 |
| 16 | 3300025960 | Ga0207651_11311603 | Ga0207651_113116031 | 140 |
| 17 | 3300026089 | Ga0207648_11240633 | Ga0207648_112406331 | 140 |
| 18 | 3300026116 | Ga0207674_10370726 | Ga0207674_103707261 | 140 |
| 19 | 3300026118 | Ga0207675_100181426 | Ga0207675_1001814262 | 140 |
| 20 | 3300031456 | Ga0307513_10413241 | Ga0307513_104132412 | 140 |
| 21 | 3300005344 | Ga0070661_100816472 | Ga0070661_1008164721 | 141 |
| 22 | 3300005471 | Ga0070698_100341924 | Ga0070698_1003419242 | 141 |
| 23 | 3300005618 | Ga0068864_100021861 | Ga0068864_1000218612 | 141 |
| 24 | 3300006237 | Ga0097621_101857309 | Ga0097621_1018573091 | 141 |
| 25 | 3300025903 | Ga0207680_10020624 | Ga0207680_100206242 | 141 |
| 26 | 3300026095 | Ga0207676_10076936 | Ga0207676_100769363 | 141 |
| 27 | 3300026116 | Ga0207674_10782766 | Ga0207674_107827662 | 141 |
| 28 | 3300046616 | Ga0495668_0000115 | Ga0495668_0000115_107881_108414 | 141 |
| 29 | 3300005290 | Ga0065712_10347044 | Ga0065712_103470441 | 142 |
| 30 | 3300005334 | Ga0068869_100140476 | Ga0068869_1001404762 | 142 |
| 31 | 3300005340 | Ga0070689_101077177 | Ga0070689_1010771772 | 142 |
| 32 | 3300005577 | Ga0068857_100745474 | Ga0068857_1007454742 | 142 |
| 33 | 3300009094 | Ga0111539_10124034 | Ga0111539_101240344 | 142 |
| 34 | 3300009094 | Ga0111539_10125368 | Ga0111539_101253681 | 142 |
| 35 | 3300013296 | Ga0157374_11006751 | Ga0157374_110067511 | 142 |
| 36 | 3300025908 | Ga0207643_10367216 | Ga0207643_103672161 | 142 |
| 37 | 3300025918 | Ga0207662_10371748 | Ga0207662_103717482 | 142 |
| 38 | 3300025937 | Ga0207669_10323149 | Ga0207669_103231491 | 142 |
| 39 | 3300025942 | Ga0207689_11037209 | Ga0207689_110372091 | 142 |
| 40 | 3300026116 | Ga0207674_10028784 | Ga0207674_100287845 | 142 |
| 41 | 3300047320 | Ga0495672_0028363 | Ga0495672_0028363_1345_1845 | 142 |
| 42 | 3300003320 | rootH2_10072655 | rootH2_100726551 | 143 |
| 43 | 3300005335 | Ga0070666_10000041 | Ga0070666_1000004197 | 143 |
| 44 | 3300005547 | Ga0070693_100908801 | Ga0070693_1009088011 | 143 |
| 45 | 3300009147 | Ga0114129_10938162 | Ga0114129_109381622 | 143 |
| 46 | 3300009553 | Ga0105249_11972931 | Ga0105249_119729312 | 143 |
| 47 | 3300013308 | Ga0157375_12314250 | Ga0157375_123142501 | 143 |
| 48 | 3300031251 | Ga0265327_10001555 | Ga0265327_100015556 | 143 |
| 49 | 3300031711 | Ga0265314_10056118 | Ga0265314_100561182 | 143 |
| 50 | 3300050507 | nmdc:mga05p37_155638_c1 | nmdc:mga05p37_155638_c1_2129_2662 | 143 |
| 51 | 3300053086 | Ga0500578_0001279 | Ga0500578_0001279_6091_6549 | 143 |
| 52 | 3300005367 | Ga0070667_100549517 | Ga0070667_1005495172 | 144 |
| 53 | 3300025986 | Ga0207658_10472293 | Ga0207658_104722932 | 144 |
| 54 | 3300005543 | Ga0070672_100140189 | Ga0070672_1001401893 | 145 |
| 55 | 3300005834 | Ga0068851_10000094 | Ga0068851_1000009430 | 145 |
| 56 | 3300006358 | Ga0068871_100067023 | Ga0068871_1000670236 | 145 |
| 57 | 3300013306 | Ga0163162_11163010 | Ga0163162_111630102 | 145 |
| 58 | 3300013307 | Ga0157372_10084406 | Ga0157372_100844063 | 145 |
| 59 | 3300025321 | Ga0207656_10000061 | Ga0207656_1000006126 | 145 |
| 60 | 3300025940 | Ga0207691_10039832 | Ga0207691_100398323 | 145 |
| 61 | 3300005340 | Ga0070689_100509764 | Ga0070689_1005097641 | 146 |
| 62 | 3300005353 | Ga0070669_100250788 | Ga0070669_1002507882 | 146 |
| 63 | 3300025923 | Ga0207681_10237841 | Ga0207681_102378412 | 146 |
| 64 | 3300031507 | Ga0307509_10318907 | Ga0307509_103189072 | 146 |
| 65 | 3300035725 | Ga0373947_0402605 | Ga0373947_0402605_17_517 | 146 |
| 66 | 3300037471 | Ga0395905_0001159 | Ga0395905_0001159_17511_18038 | 146 |
| 67 | 3300009147 | Ga0114129_11400774 | Ga0114129_114007741 | 147 |
| 68 | 3300005544 | Ga0070686_100349874 | Ga0070686_1003498741 | 148 |
| 69 | 3300005985 | Ga0081539_10311526 | Ga0081539_103115261 | 148 |
| 70 | 3300026075 | Ga0207708_10317217 | Ga0207708_103172173 | 149 |
| 71 | 3300005331 | Ga0070670_100397088 | Ga0070670_1003970881 | 150 |
| 72 | 3300005577 | Ga0068857_100147927 | Ga0068857_1001479272 | 150 |
| 73 | 3300005577 | Ga0068857_100226525 | Ga0068857_1002265253 | 150 |
| 74 | 3300005841 | Ga0068863_100479551 | Ga0068863_1004795512 | 150 |
| 75 | 3300006844 | Ga0075428_100453323 | Ga0075428_1004533233 | 150 |
| 76 | 3300025925 | Ga0207650_10056219 | Ga0207650_100562194 | 150 |
| 77 | 3300026088 | Ga0207641_10230856 | Ga0207641_102308562 | 150 |
| 78 | 3300026116 | Ga0207674_10089245 | Ga0207674_100892455 | 150 |
| 79 | 3300026116 | Ga0207674_10285297 | Ga0207674_102852972 | 150 |
| 80 | 3300005327 | Ga0070658_10435428 | Ga0070658_104354281 | 151 |
| 81 | 3300005328 | Ga0070676_10226370 | Ga0070676_102263701 | 151 |
| 82 | 3300005338 | Ga0068868_100709112 | Ga0068868_1007091121 | 151 |
| 83 | 3300005345 | Ga0070692_10833650 | Ga0070692_108336501 | 151 |
| 84 | 3300005347 | Ga0070668_100749270 | Ga0070668_1007492702 | 151 |
| 85 | 3300005364 | Ga0070673_100686063 | Ga0070673_1006860632 | 151 |
| 86 | 3300005548 | Ga0070665_100374730 | Ga0070665_1003747302 | 151 |
| 87 | 3300005563 | Ga0068855_100770235 | Ga0068855_1007702351 | 151 |
| 88 | 3300005564 | Ga0070664_100142531 | Ga0070664_1001425312 | 151 |
| 89 | 3300005616 | Ga0068852_100557173 | Ga0068852_1005571731 | 151 |
| 90 | 3300005841 | Ga0068863_100005882 | Ga0068863_10000588212 | 151 |
| 91 | 3300005843 | Ga0068860_100008378 | Ga0068860_1000083784 | 151 |
| 92 | 3300006358 | Ga0068871_100957174 | Ga0068871_1009571742 | 151 |
| 93 | 3300009101 | Ga0105247_10197914 | Ga0105247_101979142 | 151 |
| 94 | 3300009176 | Ga0105242_10740901 | Ga0105242_107409012 | 151 |
| 95 | 3300009553 | Ga0105249_10233767 | Ga0105249_102337672 | 151 |
| 96 | 3300013104 | Ga0157370_11113290 | Ga0157370_111132901 | 151 |
| 97 | 3300013296 | Ga0157374_10122942 | Ga0157374_101229423 | 151 |
| 98 | 3300013297 | Ga0157378_10553240 | Ga0157378_105532402 | 151 |
| 99 | 3300013306 | Ga0163162_10275480 | Ga0163162_102754802 | 151 |
| 100 | 3300014325 | Ga0163163_10231784 | Ga0163163_102317842 | 151 |
| 101 | 3300014969 | Ga0157376_10134966 | Ga0157376_101349663 | 151 |
| 102 | 3300017792 | Ga0163161_10108624 | Ga0163161_101086242 | 151 |
| 103 | 3300025903 | Ga0207680_10335821 | Ga0207680_103358211 | 151 |
| 104 | 3300025907 | Ga0207645_10167956 | Ga0207645_101679561 | 151 |
| 105 | 3300025918 | Ga0207662_10620850 | Ga0207662_106208502 | 151 |
| 106 | 3300025931 | Ga0207644_11200137 | Ga0207644_112001371 | 151 |
| 107 | 3300025940 | Ga0207691_10093647 | Ga0207691_100936473 | 151 |
| 108 | 3300025945 | Ga0207679_10323161 | Ga0207679_103231612 | 151 |
| 109 | 3300025949 | Ga0207667_10286021 | Ga0207667_102860212 | 151 |
| 110 | 3300026035 | Ga0207703_11258135 | Ga0207703_112581351 | 151 |
| 111 | 3300026088 | Ga0207641_10001301 | Ga0207641_1000130117 | 151 |
| 112 | 3300026089 | Ga0207648_10047735 | Ga0207648_100477353 | 151 |
| 113 | 3300026095 | Ga0207676_10412583 | Ga0207676_104125831 | 151 |
| 114 | 3300026118 | Ga0207675_100839000 | Ga0207675_1008390001 | 151 |
| 115 | 3300028381 | Ga0268264_10005049 | Ga0268264_1000504916 | 151 |
| 116 | 3300028381 | Ga0268264_10427499 | Ga0268264_104274992 | 151 |
| 117 | 3300028794 | Ga0307515_10000092 | Ga0307515_1000009221 | 151 |
| 118 | 3300031251 | Ga0265327_10247166 | Ga0265327_102471662 | 151 |
| 119 | 3300039450 | Ga0436363_1178106 | Ga0436363_1178106_282_830 | 151 |
| 120 | 3300042876 | Ga0451577_0147593 | Ga0451577_0147593_239_772 | 151 |
| 121 | 3300044712 | Ga0453684_0027727 | Ga0453684_0027727_5436_5969 | 151 |
| 122 | 3300045051 | Ga0451576_0046320 | Ga0451576_0046320_2939_3472 | 151 |
| 123 | 3300053131 | Ga0500652_297196 | Ga0500652_297196_34_564 | 151 |
| 124 | 3300006844 | Ga0075428_100249467 | Ga0075428_1002494672 | 152 |
| 125 | 3300021384 | Ga0213876_10007588 | Ga0213876_100075885 | 152 |
| 126 | 3300039437 | Ga0436365_1855296 | Ga0436365_1855296_3769_4299 | 152 |
| 127 | 3300044712 | Ga0453684_0063618 | Ga0453684_0063618_3628_4161 | 152 |
| 128 | 3300005330 | Ga0070690_100355047 | Ga0070690_1003550472 | 153 |
| 129 | 3300005335 | Ga0070666_10272213 | Ga0070666_102722131 | 153 |
| 130 | 3300005343 | Ga0070687_100153031 | Ga0070687_1001530312 | 153 |
| 131 | 3300005355 | Ga0070671_100024447 | Ga0070671_1000244472 | 153 |
| 132 | 3300013297 | Ga0157378_10012625 | Ga0157378_1001262512 | 153 |
| 133 | 3300013308 | Ga0157375_10098485 | Ga0157375_100984855 | 153 |
| 134 | 3300025918 | Ga0207662_10173748 | Ga0207662_101737482 | 153 |
| 135 | 3300025940 | Ga0207691_10021564 | Ga0207691_1002156410 | 153 |
| 136 | 3300025961 | Ga0207712_10025942 | Ga0207712_100259422 | 153 |
| 137 | 3300025986 | Ga0207658_11040333 | Ga0207658_110403331 | 153 |
| 138 | 3300026035 | Ga0207703_10063158 | Ga0207703_100631582 | 153 |
| 139 | 3300026089 | Ga0207648_10079074 | Ga0207648_100790743 | 153 |
| 140 | 3300026118 | Ga0207675_100406172 | Ga0207675_1004061722 | 153 |
| 141 | 3300005338 | Ga0068868_100009572 | Ga0068868_1000095722 | 154 |
| 142 | 3300005347 | Ga0070668_100799096 | Ga0070668_1007990961 | 154 |
| 143 | 3300005364 | Ga0070673_100680900 | Ga0070673_1006809002 | 154 |
| 144 | 3300006881 | Ga0068865_100437709 | Ga0068865_1004377091 | 154 |
| 145 | 3300009176 | Ga0105242_10134535 | Ga0105242_101345354 | 154 |
| 146 | 3300011119 | Ga0105246_10016857 | Ga0105246_100168572 | 154 |
| 147 | 3300013308 | Ga0157375_10227359 | Ga0157375_102273593 | 154 |
| 148 | 3300014326 | Ga0157380_10913049 | Ga0157380_109130492 | 154 |
| 149 | 3300025972 | Ga0207668_10721879 | Ga0207668_107218791 | 154 |
| 150 | 3300026023 | Ga0207677_10028549 | Ga0207677_100285494 | 154 |
| 151 | 3300037418 | Ga0395900_0089985 | Ga0395900_0089985_59_589 | 154 |
| 152 | 3300044673 | Ga0453683_0715754 | Ga0453683_0715754_45_575 | 154 |
| 153 | 3300013102 | Ga0157371_10202731 | Ga0157371_102027313 | 155 |
| 154 | 3300005471 | Ga0070698_100007455 | Ga0070698_1000074559 | 157 |
| 155 | 3300009553 | Ga0105249_10043223 | Ga0105249_100432232 | 157 |
| 156 | 3300013306 | Ga0163162_10007246 | Ga0163162_100072466 | 157 |
| 157 | 3300005338 | Ga0068868_100285586 | Ga0068868_1002855862 | 158 |
| 158 | 3300005354 | Ga0070675_100589610 | Ga0070675_1005896101 | 158 |
| 159 | 3300005719 | Ga0068861_100945440 | Ga0068861_1009454401 | 158 |
| 160 | 3300014326 | Ga0157380_10297786 | Ga0157380_102977863 | 158 |
| 161 | 3300025960 | Ga0207651_10030579 | Ga0207651_100305792 | 158 |
| 162 | 3300031251 | Ga0265327_10069925 | Ga0265327_100699251 | 158 |
| 163 | 3300013306 | Ga0163162_10907969 | Ga0163162_109079692 | 159 |
| 164 | 3300053092 | Ga0500583_0171293 | Ga0500583_0171293_482_1048 | 159 |
| 165 | iso_pu_bacteria | 2929239360 | 2929241081 | 159 |
| 166 | 3300005843 | Ga0068860_100186129 | Ga0068860_1001861292 | 160 |
| 167 | 3300028381 | Ga0268264_10163225 | Ga0268264_101632252 | 160 |
| 168 | 3300031251 | Ga0265327_10000533 | Ga0265327_1000053352 | 160 |
| 169 | 3300006237 | Ga0097621_100030652 | Ga0097621_1000306525 | 161 |
| 170 | 3300006358 | Ga0068871_100100696 | Ga0068871_1001006961 | 161 |
| 171 | 3300006881 | Ga0068865_100754486 | Ga0068865_1007544861 | 161 |
| 172 | 3300009553 | Ga0105249_10081029 | Ga0105249_100810294 | 161 |
| 173 | 3300013296 | Ga0157374_10240875 | Ga0157374_102408752 | 161 |
| 174 | 3300013297 | Ga0157378_10112286 | Ga0157378_101122862 | 161 |
| 175 | 3300013308 | Ga0157375_10109853 | Ga0157375_101098537 | 161 |
| 176 | 3300025938 | Ga0207704_10979313 | Ga0207704_109793131 | 161 |
| 177 | 3300025961 | Ga0207712_10771221 | Ga0207712_107712212 | 161 |
| 178 | 3300014326 | Ga0157380_10000013 | Ga0157380_1000001323 | 163 |
| 179 | 3300003322 | rootL2_10008241 | rootL2_100082413 | 164 |
| 180 | 3300005367 | Ga0070667_100109441 | Ga0070667_1001094413 | 165 |
| 181 | 3300014968 | Ga0157379_10518115 | Ga0157379_105181152 | 165 |
| 182 | 3300002459 | JGI24751J29686_10003380 | JGI24751J29686_100033802 | 167 |
| 183 | 3300005295 | Ga0065707_10784166 | Ga0065707_107841661 | 167 |
| 184 | 3300005331 | Ga0070670_100095972 | Ga0070670_1000959722 | 167 |
| 185 | 3300005331 | Ga0070670_101198741 | Ga0070670_1011987411 | 167 |
| 186 | 3300005334 | Ga0068869_100457021 | Ga0068869_1004570212 | 167 |
| 187 | 3300005343 | Ga0070687_100143483 | Ga0070687_1001434832 | 167 |
| 188 | 3300005353 | Ga0070669_100432632 | Ga0070669_1004326322 | 167 |
| 189 | 3300005354 | Ga0070675_100014588 | Ga0070675_1000145884 | 167 |
| 190 | 3300005365 | Ga0070688_100011452 | Ga0070688_1000114525 | 167 |
| 191 | 3300005365 | Ga0070688_100064478 | Ga0070688_1000644782 | 167 |
| 192 | 3300005365 | Ga0070688_100228534 | Ga0070688_1002285342 | 167 |
| 193 | 3300005438 | Ga0070701_10062120 | Ga0070701_100621203 | 167 |
| 194 | 3300005466 | Ga0070685_10034136 | Ga0070685_100341362 | 167 |
| 195 | 3300005466 | Ga0070685_10059889 | Ga0070685_100598894 | 167 |
| 196 | 3300005549 | Ga0070704_100191040 | Ga0070704_1001910403 | 167 |
| 197 | 3300005578 | Ga0068854_100110010 | Ga0068854_1001100103 | 167 |
| 198 | 3300005617 | Ga0068859_100000139 | Ga0068859_10000013912 | 167 |
| 199 | 3300005617 | Ga0068859_100208893 | Ga0068859_1002088933 | 167 |
| 200 | 3300005840 | Ga0068870_10039516 | Ga0068870_100395163 | 167 |
| 201 | 3300005841 | Ga0068863_100721902 | Ga0068863_1007219022 | 167 |
| 202 | 3300005842 | Ga0068858_100015680 | Ga0068858_1000156806 | 167 |
| 203 | 3300005843 | Ga0068860_100411500 | Ga0068860_1004115002 | 167 |
| 204 | 3300005844 | Ga0068862_100011449 | Ga0068862_1000114493 | 167 |
| 205 | 3300005844 | Ga0068862_100394136 | Ga0068862_1003941362 | 167 |
| 206 | 3300006881 | Ga0068865_100429292 | Ga0068865_1004292923 | 167 |
| 207 | 3300006931 | Ga0097620_100000139 | Ga0097620_10000013912 | 167 |
| 208 | 3300006931 | Ga0097620_100208909 | Ga0097620_1002089093 | 167 |
| 209 | 3300009094 | Ga0111539_10179579 | Ga0111539_101795792 | 167 |
| 210 | 3300009101 | Ga0105247_10001499 | Ga0105247_1000149911 | 167 |
| 211 | 3300009174 | Ga0105241_10001041 | Ga0105241_100010413 | 167 |
| 212 | 3300009176 | Ga0105242_10128238 | Ga0105242_101282384 | 167 |
| 213 | 3300009545 | Ga0105237_10145523 | Ga0105237_101455234 | 167 |
| 214 | 3300009553 | Ga0105249_10041400 | Ga0105249_100414003 | 167 |
| 215 | 3300013297 | Ga0157378_10111420 | Ga0157378_101114203 | 167 |
| 216 | 3300013306 | Ga0163162_10939405 | Ga0163162_109394052 | 167 |
| 217 | 3300013308 | Ga0157375_10064116 | Ga0157375_100641163 | 167 |
| 218 | 3300013308 | Ga0157375_10802487 | Ga0157375_108024872 | 167 |
| 219 | 3300014326 | Ga0157380_10001341 | Ga0157380_1000134111 | 167 |
| 220 | 3300014326 | Ga0157380_11918440 | Ga0157380_119184401 | 167 |
| 221 | 3300014745 | Ga0157377_10456442 | Ga0157377_104564421 | 167 |
| 222 | 3300025900 | Ga0207710_10055859 | Ga0207710_100558593 | 167 |
| 223 | 3300025907 | Ga0207645_10008025 | Ga0207645_100080251 | 167 |
| 224 | 3300025908 | Ga0207643_10035742 | Ga0207643_100357423 | 167 |
| 225 | 3300025911 | Ga0207654_10004289 | Ga0207654_100042899 | 167 |
| 226 | 3300025914 | Ga0207671_10113477 | Ga0207671_101134772 | 167 |
| 227 | 3300025918 | Ga0207662_10032371 | Ga0207662_100323714 | 167 |
| 228 | 3300025918 | Ga0207662_10513098 | Ga0207662_105130982 | 167 |
| 229 | 3300025925 | Ga0207650_10185912 | Ga0207650_101859122 | 167 |
| 230 | 3300025925 | Ga0207650_10801926 | Ga0207650_108019261 | 167 |
| 231 | 3300025926 | Ga0207659_10244904 | Ga0207659_102449042 | 167 |
| 232 | 3300025938 | Ga0207704_10177076 | Ga0207704_101770762 | 167 |
| 233 | 3300025942 | Ga0207689_10488016 | Ga0207689_104880161 | 167 |
| 234 | 3300025960 | Ga0207651_10386442 | Ga0207651_103864421 | 167 |
| 235 | 3300025961 | Ga0207712_10053926 | Ga0207712_100539262 | 167 |
| 236 | 3300025972 | Ga0207668_10460454 | Ga0207668_104604542 | 167 |
| 237 | 3300025981 | Ga0207640_10042114 | Ga0207640_100421142 | 167 |
| 238 | 3300026035 | Ga0207703_10011582 | Ga0207703_100115826 | 167 |
| 239 | 3300026075 | Ga0207708_10041721 | Ga0207708_100417212 | 167 |
| 240 | 3300026088 | Ga0207641_10054164 | Ga0207641_100541642 | 167 |
| 241 | 3300026089 | Ga0207648_10037869 | Ga0207648_100378693 | 167 |
| 242 | 3300027907 | Ga0207428_10413307 | Ga0207428_104133072 | 167 |
| 243 | 3300028380 | Ga0268265_10025384 | Ga0268265_100253843 | 167 |
| 244 | 3300037471 | Ga0395905_0622910 | Ga0395905_0622910_79_609 | 167 |
| 245 | 3300050511 | nmdc:mga08y16_153766_c1 | nmdc:mga08y16_153766_c1_192_722 | 167 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wa9-assembly1.cif.gz_A | crystal structure of msmeg_5634 from mycobacterium smegmatis | 0.7983 | 29 | 163 |
| 3ijt-assembly1.cif.gz_A | structural characterization of smu.440, a hypothetical protein from streptococcus mutans | 0.7701 | 27 | 164 |
| 5non-assembly3.cif.gz_C | structure of truncated norcoclaurine synthase from thalictrum flavum with product mimic | 0.7586 | 28 | 163 |
| 8ho2-assembly1.cif.gz_B | crystal structure of norcoclaurine synthase from chinese lotus (nelumbo nucicera) | 0.749 | 28 | 163 |
| 2le1-assembly1.cif.gz_A | solution nmr structure of tfu_2981 from thermobifida fusca, northeast structural genomics consortium target tfr85a | 0.7469 | 30 | 163 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WJ05_1_142_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7856 | 29 | 163 | 3.30.530.20 |
| af_I6X666_8_157_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7673 | 29 | 163 | 3.30.530.20 |
| 3ijtB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7668 | 26 | 161 | 3.30.530.20 |
| 5nonC00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7586 | 28 | 163 | 3.30.530.20 |
| 2le1A00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.7469 | 30 | 163 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3CLK1-F1-model_v4 | Polyketide cyclase | 0.952 | 45 | 163 |
|
| AF-A0A534YPF1-F1-model_v4 | SRPBCC family protein | 0.9518 | 29 | 146 |
|
| AF-A0A519MTZ1-F1-model_v4 | Polyketide cyclase | 0.9361 | 31 | 162 |
|
| AF-A0A7Y3B323-F1-model_v4 | SRPBCC family protein | 0.9231 | 29 | 138 |
|
| AF-A0A1Q8L8D4-F1-model_v4 | Transcriptional regulator | 0.9148 | 28 | 162 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar