F357310

General Info

Members Datasets Scaffolds Average Seq Length
245 133 244 164

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_11400774|Ga0114129_114007741
Length 185
Sequence VLHGQHLSSIVLRTNKRNELTFSKKLSQVNTLITIEHYVNREIIINAPRQKVFDFLKLLKNQDQFNKWATADKKNRKEEFKGTDGTVGFIYSWSGDKSAGRGEKEIKNIIEGKRIETEIRFVKPMRVAASVIFETESLSDDQTKVNLINTGTLKYPLNIMIPMAEKRFPKDMDESLSTLKNILEK

Samples

Sample ID Description Type Environment
1 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
132 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
133 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0
Isolates 0.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 0
Rhizosphere 95.1
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10003380 3300002459 Bacteria 3218
2 rootH2_10072655 3300003320 Bacteria 2182
3 rootL2_10008241 3300003322 Unclassified 2156
4 Ga0065712_10347044 3300005290 Bacteria 792
5 Ga0065707_10784166 3300005295 Bacteria 605
6 Ga0070658_10435428 3300005327 Bacteria 1129
7 Ga0070676_10226370 3300005328 Unclassified 1238
8 Ga0070690_100355047 3300005330 Bacteria 1065
9 Ga0070670_100095972 3300005331 Bacteria 2550
10 Ga0070670_100291970 3300005331 Bacteria 1425
11 Ga0070670_100397088 3300005331 Bacteria 1217
12 Ga0070670_101198741 3300005331 Bacteria 694
13 Ga0068869_100140476 3300005334 Unclassified 1864
14 Ga0068869_100457021 3300005334 Bacteria 1059
15 Ga0070666_10000041 3300005335 Bacteria 112410
16 Ga0070666_10272213 3300005335 Bacteria 1202
17 Ga0068868_100009572 3300005338 Bacteria 6986
18 Ga0068868_100285586 3300005338 Bacteria 1398
19 Ga0068868_100709112 3300005338 Bacteria 901
20 Ga0070689_100509764 3300005340 Bacteria 1032
21 Ga0070689_101077177 3300005340 Bacteria 718
22 Ga0070687_100094057 3300005343 Bacteria 1664
23 Ga0070687_100143483 3300005343 Bacteria 1393
24 Ga0070687_100153031 3300005343 Bacteria 1356
25 Ga0070661_100816472 3300005344 Bacteria 766
26 Ga0070692_10833650 3300005345 Bacteria 632
27 Ga0070668_100749270 3300005347 Unclassified 864
28 Ga0070668_100799096 3300005347 Bacteria 838
29 Ga0070669_100250788 3300005353 Bacteria 1409
30 Ga0070669_100432632 3300005353 Bacteria 1082
31 Ga0070675_100014588 3300005354 Bacteria 6196
32 Ga0070675_100589610 3300005354 Bacteria 1007
33 Ga0070671_100024447 3300005355 Bacteria 4945
34 Ga0070673_100680900 3300005364 Bacteria 943
35 Ga0070673_100686063 3300005364 Bacteria 940
36 Ga0070688_100011452 3300005365 Bacteria 4927
37 Ga0070688_100064478 3300005365 Bacteria 2325
38 Ga0070688_100228534 3300005365 Bacteria 1315
39 Ga0070667_100109441 3300005367 Bacteria 2394
40 Ga0070667_100549517 3300005367 Unclassified 1061
41 Ga0070701_10062120 3300005438 Bacteria 1972
42 Ga0068867_101492787 3300005459 Unclassified 629
43 Ga0070685_10034136 3300005466 Bacteria 2863
44 Ga0070685_10059889 3300005466 Bacteria 2224
45 Ga0070698_100007455 3300005471 Bacteria 11839
46 Ga0070698_100341924 3300005471 Bacteria 1428
47 Ga0070672_100140189 3300005543 Bacteria 1994
48 Ga0070686_100349874 3300005544 Bacteria 1110
49 Ga0070693_100908801 3300005547 Unclassified 660
50 Ga0070665_100374730 3300005548 Unclassified 1430
51 Ga0070704_100191040 3300005549 Bacteria 1646
52 Ga0068855_100770235 3300005563 Bacteria 1025
53 Ga0070664_100142531 3300005564 Bacteria 2111
54 Ga0068857_100147927 3300005577 Bacteria 2126
55 Ga0068857_100226525 3300005577 Bacteria 1708
56 Ga0068857_100745474 3300005577 Bacteria 933
57 Ga0068854_100110010 3300005578 Bacteria 2077
58 Ga0068852_100557173 3300005616 Bacteria 1147
59 Ga0068859_100000139 3300005617 Bacteria 68691
60 Ga0068859_100208893 3300005617 Bacteria 2038
61 Ga0068864_100021861 3300005618 Bacteria 5362
62 Ga0068864_100197046 3300005618 Bacteria 1849
63 Ga0068861_100945440 3300005719 Bacteria 819
64 Ga0068851_10000094 3300005834 Bacteria 49249
65 Ga0068870_10039516 3300005840 Bacteria 2442
66 Ga0068863_100005882 3300005841 Bacteria 12020
67 Ga0068863_100479551 3300005841 Bacteria 1223
68 Ga0068863_100721902 3300005841 Bacteria 991
69 Ga0068858_100015680 3300005842 Bacteria 7129
70 Ga0068860_100008378 3300005843 Bacteria 10296
71 Ga0068860_100186129 3300005843 Bacteria 2008
72 Ga0068860_100411500 3300005843 Bacteria 1339
73 Ga0068862_100011449 3300005844 Bacteria 7321
74 Ga0068862_100394136 3300005844 Bacteria 1294
75 Ga0081539_10311526 3300005985 Bacteria 672
76 Ga0097621_100030652 3300006237 Unclassified 4260
77 Ga0097621_101857309 3300006237 Bacteria 575
78 Ga0068871_100067023 3300006358 Bacteria 2943
79 Ga0068871_100100696 3300006358 Bacteria 2421
80 Ga0068871_100957174 3300006358 Bacteria 796
81 Ga0075428_100249467 3300006844 Unclassified 1913
82 Ga0075428_100453323 3300006844 Bacteria 1374
83 Ga0068865_100429292 3300006881 Bacteria 1088
84 Ga0068865_100437709 3300006881 Bacteria 1078
85 Ga0068865_100754486 3300006881 Bacteria 836
86 Ga0097620_100000139 3300006931 Bacteria 68691
87 Ga0097620_100208909 3300006931 Bacteria 2038
88 Ga0111539_10124034 3300009094 Bacteria 3027
89 Ga0111539_10125368 3300009094 Bacteria 3009
90 Ga0111539_10179579 3300009094 Bacteria 2473
91 Ga0105247_10001499 3300009101 Bacteria 16717
92 Ga0105247_10197914 3300009101 Unclassified 1348
93 Ga0114129_10938162 3300009147 Unclassified 1094
94 Ga0114129_11400774 3300009147 Bacteria 863
95 Ga0105241_10001041 3300009174 Bacteria 21106
96 Ga0105241_11296751 3300009174 Bacteria 693
97 Ga0105242_10128238 3300009176 Bacteria 2186
98 Ga0105242_10134535 3300009176 Bacteria 2138
99 Ga0105242_10740901 3300009176 Bacteria 966
100 Ga0105237_10145523 3300009545 Bacteria 2365
101 Ga0105249_10041400 3300009553 Unclassified 4188
102 Ga0105249_10043223 3300009553 Bacteria 4099
103 Ga0105249_10081029 3300009553 Bacteria 3016
104 Ga0105249_10233767 3300009553 Bacteria 1814
105 Ga0105249_11972931 3300009553 Bacteria 656
106 Ga0105246_10016857 3300011119 Bacteria 4635
107 Ga0157371_10202731 3300013102 Bacteria 1422
108 Ga0157370_11113290 3300013104 Bacteria 713
109 Ga0157374_10122942 3300013296 Unclassified 2507
110 Ga0157374_10240875 3300013296 Bacteria 1779
111 Ga0157374_11006751 3300013296 Unclassified 852
112 Ga0157378_10012625 3300013297 Bacteria 7394
113 Ga0157378_10111420 3300013297 Unclassified 2509
114 Ga0157378_10112286 3300013297 Bacteria 2500
115 Ga0157378_10553240 3300013297 Bacteria 1156
116 Ga0163162_10007246 3300013306 Bacteria 10765
117 Ga0163162_10275480 3300013306 Unclassified 1814
118 Ga0163162_10857452 3300013306 Bacteria 1023
119 Ga0163162_10907969 3300013306 Bacteria 994
120 Ga0163162_10939405 3300013306 Bacteria 976
121 Ga0163162_11147211 3300013306 Bacteria 881
122 Ga0163162_11163010 3300013306 Bacteria 875
123 Ga0157372_10000251 3300013307 Bacteria 59407
124 Ga0157372_10084406 3300013307 Bacteria 3599
125 Ga0157375_10064116 3300013308 Unclassified 3657
126 Ga0157375_10098485 3300013308 Bacteria 3001
127 Ga0157375_10109853 3300013308 Bacteria 2854
128 Ga0157375_10227359 3300013308 Bacteria 2024
129 Ga0157375_10802487 3300013308 Unclassified 1090
130 Ga0157375_12314250 3300013308 Bacteria 641
131 Ga0163163_10231784 3300014325 Bacteria 1896
132 Ga0157380_10000013 3300014326 Bacteria 131248
133 Ga0157380_10001341 3300014326 Bacteria 16027
134 Ga0157380_10297786 3300014326 Bacteria 1484
135 Ga0157380_10913049 3300014326 Bacteria 905
136 Ga0157380_11918440 3300014326 Bacteria 653
137 Ga0157377_10456442 3300014745 Bacteria 883
138 Ga0157379_10518115 3300014968 Bacteria 1107
139 Ga0157376_10134966 3300014969 Bacteria 2207
140 Ga0163161_10108624 3300017792 Bacteria 2071
141 Ga0213876_10007588 3300021384 Bacteria 5888
142 Ga0207656_10000061 3300025321 Bacteria 42734
143 Ga0207710_10055859 3300025900 Bacteria 1780
144 Ga0207680_10020624 3300025903 Bacteria 3552
145 Ga0207680_10335821 3300025903 Bacteria 1059
146 Ga0207645_10008025 3300025907 Bacteria 7404
147 Ga0207645_10167956 3300025907 Unclassified 1437
148 Ga0207643_10035742 3300025908 Bacteria 2787
149 Ga0207643_10367216 3300025908 Unclassified 905
150 Ga0207654_10004289 3300025911 Bacteria 7193
151 Ga0207671_10113477 3300025914 Bacteria 2064
152 Ga0207662_10032371 3300025918 Bacteria 3043
153 Ga0207662_10173748 3300025918 Bacteria 1383
154 Ga0207662_10371748 3300025918 Bacteria 964
155 Ga0207662_10513098 3300025918 Bacteria 827
156 Ga0207662_10620850 3300025918 Bacteria 753
157 Ga0207681_10237841 3300025923 Bacteria 1416
158 Ga0207650_10056219 3300025925 Unclassified 2923
159 Ga0207650_10185912 3300025925 Bacteria 1658
160 Ga0207650_10801926 3300025925 Bacteria 798
161 Ga0207659_10244904 3300025926 Bacteria 1452
162 Ga0207644_11200137 3300025931 Bacteria 638
163 Ga0207670_10626475 3300025936 Bacteria 885
164 Ga0207669_10323149 3300025937 Bacteria 1182
165 Ga0207704_10177076 3300025938 Bacteria 1537
166 Ga0207704_10445649 3300025938 Bacteria 1032
167 Ga0207704_10979313 3300025938 Bacteria 714
168 Ga0207691_10021564 3300025940 Bacteria 6081
169 Ga0207691_10039832 3300025940 Bacteria 4346
170 Ga0207691_10093647 3300025940 Unclassified 2689
171 Ga0207689_10488016 3300025942 Bacteria 1032
172 Ga0207689_11037209 3300025942 Bacteria 692
173 Ga0207679_10323161 3300025945 Unclassified 1337
174 Ga0207667_10286021 3300025949 Unclassified 1685
175 Ga0207651_10030579 3300025960 Bacteria 3431
176 Ga0207651_10386442 3300025960 Bacteria 1187
177 Ga0207651_11311603 3300025960 Bacteria 651
178 Ga0207712_10025942 3300025961 Bacteria 3899
179 Ga0207712_10053926 3300025961 Bacteria 2823
180 Ga0207712_10262453 3300025961 Bacteria 1401
181 Ga0207712_10771221 3300025961 Bacteria 844
182 Ga0207668_10460454 3300025972 Bacteria 1087
183 Ga0207668_10721879 3300025972 Bacteria 877
184 Ga0207640_10042114 3300025981 Bacteria 2910
185 Ga0207658_10472293 3300025986 Bacteria 1113
186 Ga0207658_10872080 3300025986 Unclassified 819
187 Ga0207658_11040333 3300025986 Bacteria 747
188 Ga0207677_10028549 3300026023 Bacteria 3531
189 Ga0207703_10011582 3300026035 Bacteria 6857
190 Ga0207703_10063158 3300026035 Bacteria 3036
191 Ga0207703_11258135 3300026035 Bacteria 712
192 Ga0207708_10041721 3300026075 Bacteria 3498
193 Ga0207708_10317217 3300026075 Bacteria 1271
194 Ga0207641_10001301 3300026088 Bacteria 24754
195 Ga0207641_10054164 3300026088 Bacteria 3403
196 Ga0207641_10230856 3300026088 Unclassified 1720
197 Ga0207648_10037869 3300026089 Unclassified 4245
198 Ga0207648_10047735 3300026089 Unclassified 3751
199 Ga0207648_10079074 3300026089 Bacteria 2869
200 Ga0207648_10531358 3300026089 Bacteria 1079
201 Ga0207648_11240633 3300026089 Unclassified 700
202 Ga0207676_10076936 3300026095 Bacteria 2698
203 Ga0207676_10412583 3300026095 Bacteria 1265
204 Ga0207674_10028784 3300026116 Bacteria 5858
205 Ga0207674_10089245 3300026116 Bacteria 3075
206 Ga0207674_10285297 3300026116 Bacteria 1599
207 Ga0207674_10370726 3300026116 Bacteria 1384
208 Ga0207674_10782766 3300026116 Unclassified 921
209 Ga0207675_100181426 3300026118 Bacteria 2016
210 Ga0207675_100406172 3300026118 Bacteria 1343
211 Ga0207675_100839000 3300026118 Bacteria 933
212 Ga0207683_10499662 3300026121 Bacteria 1123
213 Ga0207428_10413307 3300027907 Bacteria 987
214 Ga0268265_10025384 3300028380 Bacteria 4205
215 Ga0268264_10005049 3300028381 Bacteria 11171
216 Ga0268264_10163225 3300028381 Bacteria 2009
217 Ga0268264_10427499 3300028381 Unclassified 1278
218 Ga0307515_10000092 3300028794 Bacteria 212425
219 Ga0265327_10000533 3300031251 Bacteria 65500
220 Ga0265327_10001555 3300031251 Bacteria 28194
221 Ga0265327_10069925 3300031251 Bacteria 1760
222 Ga0265327_10247166 3300031251 Bacteria 795
223 Ga0307513_10413241 3300031456 Bacteria 1081
224 Ga0307509_10318907 3300031507 Unclassified 1292
225 Ga0265314_10056118 3300031711 Bacteria 2713
226 Ga0373947_0402605 3300035725 Bacteria 923
227 Ga0395900_0089985 3300037418 Bacteria 3155
228 Ga0395905_0001159 3300037471 Bacteria 32949
229 Ga0395905_0622910 3300037471 Unclassified 981
230 Ga0395901_0001563 3300038443 Bacteria 23722
231 Ga0436365_1855296 3300039437 Bacteria 37922
232 Ga0436363_1178106 3300039450 Bacteria 867
233 Ga0451577_0147593 3300042876 Bacteria 2115
234 Ga0453683_0715754 3300044673 Bacteria 656
235 Ga0453684_0027727 3300044712 Bacteria 8108
236 Ga0453684_0063618 3300044712 Bacteria 4718
237 Ga0451576_0046320 3300045051 Bacteria 4580
238 Ga0495668_0000115 3300046616 Bacteria 125423
239 Ga0495672_0028363 3300047320 Bacteria 3544
240 nmdc:mga05p37_155638_c1 3300050507 Bacteria 2793
241 nmdc:mga08y16_153766_c1 3300050511 Bacteria 2391
242 Ga0500578_0001279 3300053086 Bacteria 26009
243 Ga0500583_0171293 3300053092 Bacteria 1081
244 Ga0500652_297196 3300053131 Bacteria 626

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0001563 Ga0395901_0001563_1051_1584 135
2 3300009174 Ga0105241_11296751 Ga0105241_112967512 136
3 3300025938 Ga0207704_10445649 Ga0207704_104456491 137
4 3300025961 Ga0207712_10262453 Ga0207712_102624532 137
5 3300025986 Ga0207658_10872080 Ga0207658_108720801 137
6 3300026121 Ga0207683_10499662 Ga0207683_104996621 137
7 3300013306 Ga0163162_10857452 Ga0163162_108574522 138
8 3300026089 Ga0207648_10531358 Ga0207648_105313581 138
9 3300013306 Ga0163162_11147211 Ga0163162_111472112 139
10 3300005331 Ga0070670_100291970 Ga0070670_1002919701 140
11 3300005343 Ga0070687_100094057 Ga0070687_1000940572 140
12 3300005459 Ga0068867_101492787 Ga0068867_1014927871 140
13 3300005618 Ga0068864_100197046 Ga0068864_1001970462 140
14 3300013307 Ga0157372_10000251 Ga0157372_1000025143 140
15 3300025936 Ga0207670_10626475 Ga0207670_106264751 140
16 3300025960 Ga0207651_11311603 Ga0207651_113116031 140
17 3300026089 Ga0207648_11240633 Ga0207648_112406331 140
18 3300026116 Ga0207674_10370726 Ga0207674_103707261 140
19 3300026118 Ga0207675_100181426 Ga0207675_1001814262 140
20 3300031456 Ga0307513_10413241 Ga0307513_104132412 140
21 3300005344 Ga0070661_100816472 Ga0070661_1008164721 141
22 3300005471 Ga0070698_100341924 Ga0070698_1003419242 141
23 3300005618 Ga0068864_100021861 Ga0068864_1000218612 141
24 3300006237 Ga0097621_101857309 Ga0097621_1018573091 141
25 3300025903 Ga0207680_10020624 Ga0207680_100206242 141
26 3300026095 Ga0207676_10076936 Ga0207676_100769363 141
27 3300026116 Ga0207674_10782766 Ga0207674_107827662 141
28 3300046616 Ga0495668_0000115 Ga0495668_0000115_107881_108414 141
29 3300005290 Ga0065712_10347044 Ga0065712_103470441 142
30 3300005334 Ga0068869_100140476 Ga0068869_1001404762 142
31 3300005340 Ga0070689_101077177 Ga0070689_1010771772 142
32 3300005577 Ga0068857_100745474 Ga0068857_1007454742 142
33 3300009094 Ga0111539_10124034 Ga0111539_101240344 142
34 3300009094 Ga0111539_10125368 Ga0111539_101253681 142
35 3300013296 Ga0157374_11006751 Ga0157374_110067511 142
36 3300025908 Ga0207643_10367216 Ga0207643_103672161 142
37 3300025918 Ga0207662_10371748 Ga0207662_103717482 142
38 3300025937 Ga0207669_10323149 Ga0207669_103231491 142
39 3300025942 Ga0207689_11037209 Ga0207689_110372091 142
40 3300026116 Ga0207674_10028784 Ga0207674_100287845 142
41 3300047320 Ga0495672_0028363 Ga0495672_0028363_1345_1845 142
42 3300003320 rootH2_10072655 rootH2_100726551 143
43 3300005335 Ga0070666_10000041 Ga0070666_1000004197 143
44 3300005547 Ga0070693_100908801 Ga0070693_1009088011 143
45 3300009147 Ga0114129_10938162 Ga0114129_109381622 143
46 3300009553 Ga0105249_11972931 Ga0105249_119729312 143
47 3300013308 Ga0157375_12314250 Ga0157375_123142501 143
48 3300031251 Ga0265327_10001555 Ga0265327_100015556 143
49 3300031711 Ga0265314_10056118 Ga0265314_100561182 143
50 3300050507 nmdc:mga05p37_155638_c1 nmdc:mga05p37_155638_c1_2129_2662 143
51 3300053086 Ga0500578_0001279 Ga0500578_0001279_6091_6549 143
52 3300005367 Ga0070667_100549517 Ga0070667_1005495172 144
53 3300025986 Ga0207658_10472293 Ga0207658_104722932 144
54 3300005543 Ga0070672_100140189 Ga0070672_1001401893 145
55 3300005834 Ga0068851_10000094 Ga0068851_1000009430 145
56 3300006358 Ga0068871_100067023 Ga0068871_1000670236 145
57 3300013306 Ga0163162_11163010 Ga0163162_111630102 145
58 3300013307 Ga0157372_10084406 Ga0157372_100844063 145
59 3300025321 Ga0207656_10000061 Ga0207656_1000006126 145
60 3300025940 Ga0207691_10039832 Ga0207691_100398323 145
61 3300005340 Ga0070689_100509764 Ga0070689_1005097641 146
62 3300005353 Ga0070669_100250788 Ga0070669_1002507882 146
63 3300025923 Ga0207681_10237841 Ga0207681_102378412 146
64 3300031507 Ga0307509_10318907 Ga0307509_103189072 146
65 3300035725 Ga0373947_0402605 Ga0373947_0402605_17_517 146
66 3300037471 Ga0395905_0001159 Ga0395905_0001159_17511_18038 146
67 3300009147 Ga0114129_11400774 Ga0114129_114007741 147
68 3300005544 Ga0070686_100349874 Ga0070686_1003498741 148
69 3300005985 Ga0081539_10311526 Ga0081539_103115261 148
70 3300026075 Ga0207708_10317217 Ga0207708_103172173 149
71 3300005331 Ga0070670_100397088 Ga0070670_1003970881 150
72 3300005577 Ga0068857_100147927 Ga0068857_1001479272 150
73 3300005577 Ga0068857_100226525 Ga0068857_1002265253 150
74 3300005841 Ga0068863_100479551 Ga0068863_1004795512 150
75 3300006844 Ga0075428_100453323 Ga0075428_1004533233 150
76 3300025925 Ga0207650_10056219 Ga0207650_100562194 150
77 3300026088 Ga0207641_10230856 Ga0207641_102308562 150
78 3300026116 Ga0207674_10089245 Ga0207674_100892455 150
79 3300026116 Ga0207674_10285297 Ga0207674_102852972 150
80 3300005327 Ga0070658_10435428 Ga0070658_104354281 151
81 3300005328 Ga0070676_10226370 Ga0070676_102263701 151
82 3300005338 Ga0068868_100709112 Ga0068868_1007091121 151
83 3300005345 Ga0070692_10833650 Ga0070692_108336501 151
84 3300005347 Ga0070668_100749270 Ga0070668_1007492702 151
85 3300005364 Ga0070673_100686063 Ga0070673_1006860632 151
86 3300005548 Ga0070665_100374730 Ga0070665_1003747302 151
87 3300005563 Ga0068855_100770235 Ga0068855_1007702351 151
88 3300005564 Ga0070664_100142531 Ga0070664_1001425312 151
89 3300005616 Ga0068852_100557173 Ga0068852_1005571731 151
90 3300005841 Ga0068863_100005882 Ga0068863_10000588212 151
91 3300005843 Ga0068860_100008378 Ga0068860_1000083784 151
92 3300006358 Ga0068871_100957174 Ga0068871_1009571742 151
93 3300009101 Ga0105247_10197914 Ga0105247_101979142 151
94 3300009176 Ga0105242_10740901 Ga0105242_107409012 151
95 3300009553 Ga0105249_10233767 Ga0105249_102337672 151
96 3300013104 Ga0157370_11113290 Ga0157370_111132901 151
97 3300013296 Ga0157374_10122942 Ga0157374_101229423 151
98 3300013297 Ga0157378_10553240 Ga0157378_105532402 151
99 3300013306 Ga0163162_10275480 Ga0163162_102754802 151
100 3300014325 Ga0163163_10231784 Ga0163163_102317842 151
101 3300014969 Ga0157376_10134966 Ga0157376_101349663 151
102 3300017792 Ga0163161_10108624 Ga0163161_101086242 151
103 3300025903 Ga0207680_10335821 Ga0207680_103358211 151
104 3300025907 Ga0207645_10167956 Ga0207645_101679561 151
105 3300025918 Ga0207662_10620850 Ga0207662_106208502 151
106 3300025931 Ga0207644_11200137 Ga0207644_112001371 151
107 3300025940 Ga0207691_10093647 Ga0207691_100936473 151
108 3300025945 Ga0207679_10323161 Ga0207679_103231612 151
109 3300025949 Ga0207667_10286021 Ga0207667_102860212 151
110 3300026035 Ga0207703_11258135 Ga0207703_112581351 151
111 3300026088 Ga0207641_10001301 Ga0207641_1000130117 151
112 3300026089 Ga0207648_10047735 Ga0207648_100477353 151
113 3300026095 Ga0207676_10412583 Ga0207676_104125831 151
114 3300026118 Ga0207675_100839000 Ga0207675_1008390001 151
115 3300028381 Ga0268264_10005049 Ga0268264_1000504916 151
116 3300028381 Ga0268264_10427499 Ga0268264_104274992 151
117 3300028794 Ga0307515_10000092 Ga0307515_1000009221 151
118 3300031251 Ga0265327_10247166 Ga0265327_102471662 151
119 3300039450 Ga0436363_1178106 Ga0436363_1178106_282_830 151
120 3300042876 Ga0451577_0147593 Ga0451577_0147593_239_772 151
121 3300044712 Ga0453684_0027727 Ga0453684_0027727_5436_5969 151
122 3300045051 Ga0451576_0046320 Ga0451576_0046320_2939_3472 151
123 3300053131 Ga0500652_297196 Ga0500652_297196_34_564 151
124 3300006844 Ga0075428_100249467 Ga0075428_1002494672 152
125 3300021384 Ga0213876_10007588 Ga0213876_100075885 152
126 3300039437 Ga0436365_1855296 Ga0436365_1855296_3769_4299 152
127 3300044712 Ga0453684_0063618 Ga0453684_0063618_3628_4161 152
128 3300005330 Ga0070690_100355047 Ga0070690_1003550472 153
129 3300005335 Ga0070666_10272213 Ga0070666_102722131 153
130 3300005343 Ga0070687_100153031 Ga0070687_1001530312 153
131 3300005355 Ga0070671_100024447 Ga0070671_1000244472 153
132 3300013297 Ga0157378_10012625 Ga0157378_1001262512 153
133 3300013308 Ga0157375_10098485 Ga0157375_100984855 153
134 3300025918 Ga0207662_10173748 Ga0207662_101737482 153
135 3300025940 Ga0207691_10021564 Ga0207691_1002156410 153
136 3300025961 Ga0207712_10025942 Ga0207712_100259422 153
137 3300025986 Ga0207658_11040333 Ga0207658_110403331 153
138 3300026035 Ga0207703_10063158 Ga0207703_100631582 153
139 3300026089 Ga0207648_10079074 Ga0207648_100790743 153
140 3300026118 Ga0207675_100406172 Ga0207675_1004061722 153
141 3300005338 Ga0068868_100009572 Ga0068868_1000095722 154
142 3300005347 Ga0070668_100799096 Ga0070668_1007990961 154
143 3300005364 Ga0070673_100680900 Ga0070673_1006809002 154
144 3300006881 Ga0068865_100437709 Ga0068865_1004377091 154
145 3300009176 Ga0105242_10134535 Ga0105242_101345354 154
146 3300011119 Ga0105246_10016857 Ga0105246_100168572 154
147 3300013308 Ga0157375_10227359 Ga0157375_102273593 154
148 3300014326 Ga0157380_10913049 Ga0157380_109130492 154
149 3300025972 Ga0207668_10721879 Ga0207668_107218791 154
150 3300026023 Ga0207677_10028549 Ga0207677_100285494 154
151 3300037418 Ga0395900_0089985 Ga0395900_0089985_59_589 154
152 3300044673 Ga0453683_0715754 Ga0453683_0715754_45_575 154
153 3300013102 Ga0157371_10202731 Ga0157371_102027313 155
154 3300005471 Ga0070698_100007455 Ga0070698_1000074559 157
155 3300009553 Ga0105249_10043223 Ga0105249_100432232 157
156 3300013306 Ga0163162_10007246 Ga0163162_100072466 157
157 3300005338 Ga0068868_100285586 Ga0068868_1002855862 158
158 3300005354 Ga0070675_100589610 Ga0070675_1005896101 158
159 3300005719 Ga0068861_100945440 Ga0068861_1009454401 158
160 3300014326 Ga0157380_10297786 Ga0157380_102977863 158
161 3300025960 Ga0207651_10030579 Ga0207651_100305792 158
162 3300031251 Ga0265327_10069925 Ga0265327_100699251 158
163 3300013306 Ga0163162_10907969 Ga0163162_109079692 159
164 3300053092 Ga0500583_0171293 Ga0500583_0171293_482_1048 159
165 iso_pu_bacteria 2929239360 2929241081 159
166 3300005843 Ga0068860_100186129 Ga0068860_1001861292 160
167 3300028381 Ga0268264_10163225 Ga0268264_101632252 160
168 3300031251 Ga0265327_10000533 Ga0265327_1000053352 160
169 3300006237 Ga0097621_100030652 Ga0097621_1000306525 161
170 3300006358 Ga0068871_100100696 Ga0068871_1001006961 161
171 3300006881 Ga0068865_100754486 Ga0068865_1007544861 161
172 3300009553 Ga0105249_10081029 Ga0105249_100810294 161
173 3300013296 Ga0157374_10240875 Ga0157374_102408752 161
174 3300013297 Ga0157378_10112286 Ga0157378_101122862 161
175 3300013308 Ga0157375_10109853 Ga0157375_101098537 161
176 3300025938 Ga0207704_10979313 Ga0207704_109793131 161
177 3300025961 Ga0207712_10771221 Ga0207712_107712212 161
178 3300014326 Ga0157380_10000013 Ga0157380_1000001323 163
179 3300003322 rootL2_10008241 rootL2_100082413 164
180 3300005367 Ga0070667_100109441 Ga0070667_1001094413 165
181 3300014968 Ga0157379_10518115 Ga0157379_105181152 165
182 3300002459 JGI24751J29686_10003380 JGI24751J29686_100033802 167
183 3300005295 Ga0065707_10784166 Ga0065707_107841661 167
184 3300005331 Ga0070670_100095972 Ga0070670_1000959722 167
185 3300005331 Ga0070670_101198741 Ga0070670_1011987411 167
186 3300005334 Ga0068869_100457021 Ga0068869_1004570212 167
187 3300005343 Ga0070687_100143483 Ga0070687_1001434832 167
188 3300005353 Ga0070669_100432632 Ga0070669_1004326322 167
189 3300005354 Ga0070675_100014588 Ga0070675_1000145884 167
190 3300005365 Ga0070688_100011452 Ga0070688_1000114525 167
191 3300005365 Ga0070688_100064478 Ga0070688_1000644782 167
192 3300005365 Ga0070688_100228534 Ga0070688_1002285342 167
193 3300005438 Ga0070701_10062120 Ga0070701_100621203 167
194 3300005466 Ga0070685_10034136 Ga0070685_100341362 167
195 3300005466 Ga0070685_10059889 Ga0070685_100598894 167
196 3300005549 Ga0070704_100191040 Ga0070704_1001910403 167
197 3300005578 Ga0068854_100110010 Ga0068854_1001100103 167
198 3300005617 Ga0068859_100000139 Ga0068859_10000013912 167
199 3300005617 Ga0068859_100208893 Ga0068859_1002088933 167
200 3300005840 Ga0068870_10039516 Ga0068870_100395163 167
201 3300005841 Ga0068863_100721902 Ga0068863_1007219022 167
202 3300005842 Ga0068858_100015680 Ga0068858_1000156806 167
203 3300005843 Ga0068860_100411500 Ga0068860_1004115002 167
204 3300005844 Ga0068862_100011449 Ga0068862_1000114493 167
205 3300005844 Ga0068862_100394136 Ga0068862_1003941362 167
206 3300006881 Ga0068865_100429292 Ga0068865_1004292923 167
207 3300006931 Ga0097620_100000139 Ga0097620_10000013912 167
208 3300006931 Ga0097620_100208909 Ga0097620_1002089093 167
209 3300009094 Ga0111539_10179579 Ga0111539_101795792 167
210 3300009101 Ga0105247_10001499 Ga0105247_1000149911 167
211 3300009174 Ga0105241_10001041 Ga0105241_100010413 167
212 3300009176 Ga0105242_10128238 Ga0105242_101282384 167
213 3300009545 Ga0105237_10145523 Ga0105237_101455234 167
214 3300009553 Ga0105249_10041400 Ga0105249_100414003 167
215 3300013297 Ga0157378_10111420 Ga0157378_101114203 167
216 3300013306 Ga0163162_10939405 Ga0163162_109394052 167
217 3300013308 Ga0157375_10064116 Ga0157375_100641163 167
218 3300013308 Ga0157375_10802487 Ga0157375_108024872 167
219 3300014326 Ga0157380_10001341 Ga0157380_1000134111 167
220 3300014326 Ga0157380_11918440 Ga0157380_119184401 167
221 3300014745 Ga0157377_10456442 Ga0157377_104564421 167
222 3300025900 Ga0207710_10055859 Ga0207710_100558593 167
223 3300025907 Ga0207645_10008025 Ga0207645_100080251 167
224 3300025908 Ga0207643_10035742 Ga0207643_100357423 167
225 3300025911 Ga0207654_10004289 Ga0207654_100042899 167
226 3300025914 Ga0207671_10113477 Ga0207671_101134772 167
227 3300025918 Ga0207662_10032371 Ga0207662_100323714 167
228 3300025918 Ga0207662_10513098 Ga0207662_105130982 167
229 3300025925 Ga0207650_10185912 Ga0207650_101859122 167
230 3300025925 Ga0207650_10801926 Ga0207650_108019261 167
231 3300025926 Ga0207659_10244904 Ga0207659_102449042 167
232 3300025938 Ga0207704_10177076 Ga0207704_101770762 167
233 3300025942 Ga0207689_10488016 Ga0207689_104880161 167
234 3300025960 Ga0207651_10386442 Ga0207651_103864421 167
235 3300025961 Ga0207712_10053926 Ga0207712_100539262 167
236 3300025972 Ga0207668_10460454 Ga0207668_104604542 167
237 3300025981 Ga0207640_10042114 Ga0207640_100421142 167
238 3300026035 Ga0207703_10011582 Ga0207703_100115826 167
239 3300026075 Ga0207708_10041721 Ga0207708_100417212 167
240 3300026088 Ga0207641_10054164 Ga0207641_100541642 167
241 3300026089 Ga0207648_10037869 Ga0207648_100378693 167
242 3300027907 Ga0207428_10413307 Ga0207428_104133072 167
243 3300028380 Ga0268265_10025384 Ga0268265_100253843 167
244 3300037471 Ga0395905_0622910 Ga0395905_0622910_79_609 167
245 3300050511 nmdc:mga08y16_153766_c1 nmdc:mga08y16_153766_c1_192_722 167

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wa9-assembly1.cif.gz_A crystal structure of msmeg_5634 from mycobacterium smegmatis 0.7983 29 163
3ijt-assembly1.cif.gz_A structural characterization of smu.440, a hypothetical protein from streptococcus mutans 0.7701 27 164
5non-assembly3.cif.gz_C structure of truncated norcoclaurine synthase from thalictrum flavum with product mimic 0.7586 28 163
8ho2-assembly1.cif.gz_B crystal structure of norcoclaurine synthase from chinese lotus (nelumbo nucicera) 0.749 28 163
2le1-assembly1.cif.gz_A solution nmr structure of tfu_2981 from thermobifida fusca, northeast structural genomics consortium target tfr85a 0.7469 30 163
ID Description Score Start End Superfamily
af_P9WJ05_1_142_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7856 29 163 3.30.530.20
af_I6X666_8_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7673 29 163 3.30.530.20
3ijtB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7668 26 161 3.30.530.20
5nonC00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7586 28 163 3.30.530.20
2le1A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7469 30 163 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4Q3CLK1-F1-model_v4 Polyketide cyclase 0.952 45 163
AF-A0A534YPF1-F1-model_v4 SRPBCC family protein 0.9518 29 146
AF-A0A519MTZ1-F1-model_v4 Polyketide cyclase 0.9361 31 162
AF-A0A7Y3B323-F1-model_v4 SRPBCC family protein 0.9231 29 138
AF-A0A1Q8L8D4-F1-model_v4 Transcriptional regulator 0.9148 28 162

Feature Viewer

pLDDT pTM Quality
88.8 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map