F357355

General Info

Members Datasets Scaffolds Average Seq Length
245 112 490 168

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10149632|Ga0157371_101496322
Length 177
Sequence LAAAGGVRVSITYRTATVADVPAIDRVFRASFCDTFAHLYRPQDLTAFLAKFTNRAWTEEITDLRYAFRLAEDDGEAVGYVKLGPSSLPVQANGSAIELRQLYVLSSHLGTGVGAELTDWALAEARRRGVEELYLTVYTDNHRARRFYARYGFEELGPYAFMVGEQADEDIIMRLKL

Samples

Sample ID Description Type Environment
1 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 0.82
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 8.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157371_10149632 3300013102 Unclassified 1664
2 JGI24737J22298_10091526 3300001990 Bacteria 902
3 JGI24735J21928_10045443 3300002067 Bacteria 1275
4 Ga0065715_10254933 3300005293 Bacteria 1155
5 Ga0070658_10001377 3300005327 Bacteria 20794
6 Ga0070658_10155075 3300005327 Bacteria 1919
7 Ga0070658_10157000 3300005327 Bacteria 1907
8 Ga0070658_10309497 3300005327 Bacteria 1348
9 Ga0070658_10555004 3300005327 Bacteria 994
10 Ga0070676_10071115 3300005328 Bacteria 2089
11 Ga0070683_100020418 3300005329 Bacteria 5895
12 Ga0070670_100013105 3300005331 Bacteria 7103
13 Ga0070670_100019951 3300005331 Bacteria 5755
14 Ga0070677_10001320 3300005333 Bacteria 7929
15 Ga0070666_10550421 3300005335 Unclassified 839
16 Ga0070680_100580164 3300005336 Bacteria 962
17 Ga0070660_100003719 3300005339 Bacteria 10539
18 Ga0070660_100006841 3300005339 Bacteria 7911
19 Ga0070660_100057475 3300005339 Bacteria 3013
20 Ga0070660_100064868 3300005339 Bacteria 2842
21 Ga0070660_100137494 3300005339 Bacteria 1958
22 Ga0070660_100350729 3300005339 Bacteria 1215
23 Ga0070660_101090874 3300005339 Bacteria 675
24 Ga0070661_100156256 3300005344 Bacteria 1726
25 Ga0070661_100159766 3300005344 Bacteria 1706
26 Ga0070661_100238291 3300005344 Bacteria 1400
27 Ga0070692_10000978 3300005345 Bacteria 9776
28 Ga0070692_10036243 3300005345 Bacteria 2502
29 Ga0070668_100028258 3300005347 Bacteria 4259
30 Ga0070669_100008938 3300005353 Bacteria 7149
31 Ga0070669_100015859 3300005353 Bacteria 5375
32 Ga0070675_100047512 3300005354 Bacteria 3517
33 Ga0070675_100227355 3300005354 Bacteria 1627
34 Ga0070675_100957903 3300005354 Bacteria 785
35 Ga0070671_100001816 3300005355 Bacteria 16240
36 Ga0070671_100081390 3300005355 Bacteria 2707
37 Ga0070671_100868630 3300005355 Bacteria 787
38 Ga0070674_100091794 3300005356 Bacteria 2194
39 Ga0070673_100160043 3300005364 Bacteria 1914
40 Ga0070673_100238129 3300005364 Bacteria 1581
41 Ga0070673_100479775 3300005364 Bacteria 1122
42 Ga0070659_100003241 3300005366 Bacteria 11581
43 Ga0070667_100205313 3300005367 Bacteria 1749
44 Ga0070663_100038735 3300005455 Bacteria 3327
45 Ga0070678_100015996 3300005456 Bacteria 4783
46 Ga0070678_100128361 3300005456 Bacteria 2010
47 Ga0070662_100077635 3300005457 Bacteria 2465
48 Ga0070662_100088478 3300005457 Bacteria 2321
49 Ga0070681_10090131 3300005458 Bacteria 3017
50 Ga0068867_100058224 3300005459 Bacteria 2863
51 Ga0068867_100616467 3300005459 Bacteria 948
52 Ga0070679_100000008 3300005530 Bacteria 194672
53 Ga0070684_100033668 3300005535 Bacteria 4376
54 Ga0068853_100102660 3300005539 Bacteria 2530
55 Ga0070672_100027584 3300005543 Bacteria 4238
56 Ga0070686_100376597 3300005544 Unclassified 1073
57 Ga0070665_100075981 3300005548 Bacteria 3366
58 Ga0070665_100197227 3300005548 Bacteria 2014
59 Ga0070664_100002940 3300005564 Bacteria 13775
60 Ga0068854_100880247 3300005578 Unclassified 786
61 Ga0068856_100755003 3300005614 Bacteria 993
62 Ga0068852_100024978 3300005616 Bacteria 4836
63 Ga0068870_10064438 3300005840 Bacteria 1979
64 Ga0068863_100779344 3300005841 Bacteria 953
65 Ga0068863_102217733 3300005841 Bacteria 559
66 Ga0157371_10013797 3300013102 Bacteria 6121
67 Ga0157370_10190045 3300013104 Bacteria 1906
68 Ga0157370_11180164 3300013104 Bacteria 691
69 Ga0157369_10008450 3300013105 Bacteria 11809
70 Ga0157369_10032870 3300013105 Bacteria 5702
71 Ga0157374_11680719 3300013296 Unclassified 659
72 Ga0157372_11129403 3300013307 Bacteria 906
73 Ga0157380_10005985 3300014326 Bacteria 8510
74 Ga0157380_10722481 3300014326 Bacteria 1004
75 Ga0206354_10413920 3300020081 Bacteria 1330
76 Ga0206353_11288468 3300020082 Bacteria 4619
77 Ga0213873_10000012 3300021358 Bacteria 210531
78 Ga0213876_10000021 3300021384 Bacteria 260105
79 Ga0213876_10000863 3300021384 Bacteria 20272
80 Ga0213876_10051408 3300021384 Bacteria 2178
81 Ga0207697_10295525 3300025315 Bacteria 718
82 Ga0207682_10007220 3300025893 Bacteria 4443
83 Ga0207682_10037745 3300025893 Bacteria 1958
84 Ga0207688_10080834 3300025901 Bacteria 1855
85 Ga0207688_10163293 3300025901 Bacteria 1321
86 Ga0207645_10371397 3300025907 Bacteria 959
87 Ga0207643_10060508 3300025908 Bacteria 2162
88 Ga0207705_10000002 3300025909 Bacteria 2046852
89 Ga0207705_10002088 3300025909 Bacteria 15529
90 Ga0207705_10019495 3300025909 Bacteria 4850
91 Ga0207705_10021171 3300025909 Bacteria 4638
92 Ga0207705_10335556 3300025909 Bacteria 1163
93 Ga0207705_10353156 3300025909 Bacteria 1133
94 Ga0207705_10403790 3300025909 Bacteria 1057
95 Ga0207705_10436578 3300025909 Bacteria 1014
96 Ga0207707_10007643 3300025912 Bacteria 9417
97 Ga0207660_10008606 3300025917 Bacteria 6600
98 Ga0207660_11001343 3300025917 Bacteria 682
99 Ga0207657_10056280 3300025919 Bacteria 3394
100 Ga0207657_10082400 3300025919 Bacteria 2700
101 Ga0207657_10116535 3300025919 Bacteria 2201
102 Ga0207649_10000038 3300025920 Bacteria 129260
103 Ga0207649_10011003 3300025920 Bacteria 4977
104 Ga0207649_10080584 3300025920 Bacteria 2106
105 Ga0207652_10000008 3300025921 Bacteria 286698
106 Ga0207652_10235169 3300025921 Bacteria 1651
107 Ga0207652_10395371 3300025921 Bacteria 1247
108 Ga0207681_10016147 3300025923 Bacteria 4665
109 Ga0207681_10034991 3300025923 Bacteria 3307
110 Ga0207681_10092722 3300025923 Bacteria 2160
111 Ga0207650_10034190 3300025925 Bacteria 3686
112 Ga0207650_10051589 3300025925 Bacteria 3044
113 Ga0207650_10836627 3300025925 Bacteria 781
114 Ga0207659_10003141 3300025926 Bacteria 9875
115 Ga0207644_10005005 3300025931 Bacteria 8651
116 Ga0207690_10002318 3300025932 Bacteria 11610
117 Ga0207706_10037005 3300025933 Bacteria 4334
118 Ga0207706_10077991 3300025933 Bacteria 2913
119 Ga0207706_10083599 3300025933 Bacteria 2806
120 Ga0207669_10133663 3300025937 Bacteria 1709
121 Ga0207691_10051935 3300025940 Bacteria 3745
122 Ga0207691_10388518 3300025940 Bacteria 1191
123 Ga0207661_10063940 3300025944 Bacteria 2981
124 Ga0207679_10083892 3300025945 Bacteria 2444
125 Ga0207651_10177816 3300025960 Bacteria 1685
126 Ga0207651_10183793 3300025960 Bacteria 1661
127 Ga0207651_10183835 3300025960 Bacteria 1661
128 Ga0207712_10537296 3300025961 Bacteria 1004
129 Ga0207668_10104438 3300025972 Bacteria 2112
130 Ga0207668_10193762 3300025972 Bacteria 1613
131 Ga0207668_10476551 3300025972 Bacteria 1070
132 Ga0207639_10022210 3300026041 Bacteria 4568
133 Ga0207678_10117552 3300026067 Bacteria 2269
134 Ga0207678_10224349 3300026067 Bacteria 1609
135 Ga0207702_10705541 3300026078 Bacteria 994
136 Ga0207648_10424836 3300026089 Bacteria 1207
137 Ga0207676_10197394 3300026095 Bacteria 1775
138 Ga0207683_10003583 3300026121 Bacteria 13540
139 Ga0207683_10103872 3300026121 Bacteria 2539
140 Ga0207698_10028385 3300026142 Bacteria 3990
141 Ga0268266_10032942 3300028379 Bacteria 4404
142 Ga0268266_11276054 3300028379 Bacteria 710
143 Ga0307408_100042605 3300031548 Bacteria 3226
144 Ga0307408_100057504 3300031548 Bacteria 2824
145 Ga0307408_100309801 3300031548 Bacteria 1326
146 Ga0307405_10000893 3300031731 Bacteria 11834
147 Ga0307405_10039177 3300031731 Bacteria 2862
148 Ga0307405_10071682 3300031731 Bacteria 2230
149 Ga0307405_10124488 3300031731 Bacteria 1770
150 Ga0307405_10445630 3300031731 Bacteria 1025
151 Ga0307413_10001276 3300031824 Bacteria 9393
152 Ga0307413_10019877 3300031824 Bacteria 3559
153 Ga0307413_10037738 3300031824 Bacteria 2793
154 Ga0307413_10048321 3300031824 Bacteria 2542
155 Ga0307413_10134306 3300031824 Bacteria 1699
156 Ga0307413_10138776 3300031824 Bacteria 1676
157 Ga0307413_10314841 3300031824 Bacteria 1193
158 Ga0307413_10732718 3300031824 Unclassified 824
159 Ga0307410_10009601 3300031852 Bacteria 5438
160 Ga0307410_10052939 3300031852 Bacteria 2744
161 Ga0307410_10110600 3300031852 Bacteria 1987
162 Ga0307410_10113643 3300031852 Bacteria 1963
163 Ga0307410_10204685 3300031852 Unclassified 1509
164 Ga0307410_10214331 3300031852 Bacteria 1477
165 Ga0307410_10263445 3300031852 Bacteria 1345
166 Ga0307410_11486829 3300031852 Unclassified 596
167 Ga0307406_10002193 3300031901 Bacteria 10634
168 Ga0307406_10048131 3300031901 Bacteria 2691
169 Ga0307406_10054372 3300031901 Bacteria 2555
170 Ga0307406_10283177 3300031901 Unclassified 1265
171 Ga0307407_10004996 3300031903 Bacteria 5707
172 Ga0307407_10054931 3300031903 Bacteria 2299
173 Ga0307412_10002006 3300031911 Bacteria 11290
174 Ga0307412_10004772 3300031911 Bacteria 7564
175 Ga0307412_10036599 3300031911 Bacteria 3146
176 Ga0307409_100014835 3300031995 Bacteria 5086
177 Ga0307409_100029646 3300031995 Bacteria 3919
178 Ga0307409_100063032 3300031995 Bacteria 2905
179 Ga0307409_100114299 3300031995 Bacteria 2270
180 Ga0307409_100190217 3300031995 Bacteria 1826
181 Ga0307409_100217758 3300031995 Bacteria 1721
182 Ga0307409_100355129 3300031995 Unclassified 1384
183 Ga0307409_100525044 3300031995 Bacteria 1157
184 Ga0307409_100556289 3300031995 Bacteria 1127
185 Ga0307409_100731719 3300031995 Unclassified 991
186 Ga0307409_101286078 3300031995 Unclassified 756
187 Ga0307416_100002373 3300032002 Bacteria 10776
188 Ga0307416_100252719 3300032002 Bacteria 1717
189 Ga0307416_100330589 3300032002 Bacteria 1531
190 Ga0307416_101116393 3300032002 Unclassified 893
191 Ga0307414_10008668 3300032004 Bacteria 5787
192 Ga0307414_10066264 3300032004 Bacteria 2580
193 Ga0307414_10094941 3300032004 Bacteria 2227
194 Ga0307414_10135528 3300032004 Bacteria 1919
195 Ga0307414_10149961 3300032004 Bacteria 1838
196 Ga0307414_10209471 3300032004 Bacteria 1592
197 Ga0307414_10370259 3300032004 Unclassified 1235
198 Ga0307411_10003495 3300032005 Bacteria 7299
199 Ga0307411_10025467 3300032005 Bacteria 3545
200 Ga0307411_10040222 3300032005 Bacteria 2964
201 Ga0307411_10076290 3300032005 Bacteria 2291
202 Ga0307411_10124094 3300032005 Unclassified 1874
203 Ga0307411_10233011 3300032005 Unclassified 1436
204 Ga0307411_10237955 3300032005 Bacteria 1423
205 Ga0307411_10259428 3300032005 Bacteria 1371
206 Ga0307411_10435785 3300032005 Bacteria 1092
207 Ga0307411_10743249 3300032005 Bacteria 859
208 Ga0307415_100055363 3300032126 Bacteria 2713
209 Ga0395899_0006947 3300037312 Bacteria 8767
210 Ga0395899_0166709 3300037312 Unclassified 1553
211 Ga0395899_0255638 3300037312 Bacteria 1200
212 Ga0395899_0286218 3300037312 Bacteria 1119
213 Ga0395900_0000336 3300037418 Bacteria 69212
214 Ga0395900_0083504 3300037418 Bacteria 3281
215 Ga0395900_0257815 3300037418 Bacteria 1742
216 Ga0395898_0016208 3300037466 Bacteria 7631
217 Ga0395898_0022790 3300037466 Bacteria 6337
218 Ga0395898_0384952 3300037466 Unclassified 1337
219 Ga0395905_0045997 3300037471 Bacteria 4093
220 Ga0395905_0049188 3300037471 Bacteria 3950
221 Ga0395905_0321723 3300037471 Bacteria 1436
222 Ga0395905_0421061 3300037471 Bacteria 1231
223 Ga0395905_0503944 3300037471 Unclassified 1111
224 Ga0395905_1326231 3300037471 Bacteria 623
225 Ga0395901_0002173 3300038443 Bacteria 20032
226 Ga0395901_0111452 3300038443 Bacteria 2873
227 Ga0395901_0159827 3300038443 Bacteria 2366
228 Ga0436365_1360649 3300039437 Bacteria 21586
229 Ga0436365_1794861 3300039437 Bacteria 40929
230 Ga0436365_1902390 3300039437 Bacteria 4486
231 Ga0439449_0075766 3300042007 Bacteria 1240
232 Ga0466972_0093239 3300044658 Bacteria 1427
233 Ga0466963_0127549 3300044694 Bacteria 1755
234 Ga0466957_0139363 3300044842 Bacteria 1562
235 Ga0466958_0800296 3300045836 Bacteria 615
236 Ga0466967_0096585 3300045976 Bacteria 2696
237 Ga0466967_0175035 3300045976 Bacteria 2021
238 Ga0495643_0245474 3300046522 Bacteria 838
239 Ga0495621_0051769 3300046539 Bacteria 1470
240 Ga0495669_0073073 3300046684 Bacteria 1566
241 Ga0495672_0336478 3300047320 Unclassified 705
242 Ga0496101_0276899 3300048904 Bacteria 1311
243 Ga0496102_0958254 3300048905 Unclassified 777
244 nmdc:mga03683_170370_c1 3300050489 Unclassified 989
245 Ga0590071_065828 3300059421 Bacteria 889
246 Ga0157371_10149632
247 JGI24737J22298_10091526
248 JGI24735J21928_10045443
249 Ga0065715_10254933
250 Ga0070658_10001377
251 Ga0070658_10155075
252 Ga0070658_10157000
253 Ga0070658_10309497
254 Ga0070658_10555004
255 Ga0070676_10071115
256 Ga0070683_100020418
257 Ga0070670_100013105
258 Ga0070670_100019951
259 Ga0070677_10001320
260 Ga0070666_10550421
261 Ga0070680_100580164
262 Ga0070660_100003719
263 Ga0070660_100006841
264 Ga0070660_100057475
265 Ga0070660_100064868
266 Ga0070660_100137494
267 Ga0070660_100350729
268 Ga0070660_101090874
269 Ga0070661_100156256
270 Ga0070661_100159766
271 Ga0070661_100238291
272 Ga0070692_10000978
273 Ga0070692_10036243
274 Ga0070668_100028258
275 Ga0070669_100008938
276 Ga0070669_100015859
277 Ga0070675_100047512
278 Ga0070675_100227355
279 Ga0070675_100957903
280 Ga0070671_100001816
281 Ga0070671_100081390
282 Ga0070671_100868630
283 Ga0070674_100091794
284 Ga0070673_100160043
285 Ga0070673_100238129
286 Ga0070673_100479775
287 Ga0070659_100003241
288 Ga0070667_100205313
289 Ga0070663_100038735
290 Ga0070678_100015996
291 Ga0070678_100128361
292 Ga0070662_100077635
293 Ga0070662_100088478
294 Ga0070681_10090131
295 Ga0068867_100058224
296 Ga0068867_100616467
297 Ga0070679_100000008
298 Ga0070684_100033668
299 Ga0068853_100102660
300 Ga0070672_100027584
301 Ga0070686_100376597
302 Ga0070665_100075981
303 Ga0070665_100197227
304 Ga0070664_100002940
305 Ga0068854_100880247
306 Ga0068856_100755003
307 Ga0068852_100024978
308 Ga0068870_10064438
309 Ga0068863_100779344
310 Ga0068863_102217733
311 Ga0157371_10013797
312 Ga0157370_10190045
313 Ga0157370_11180164
314 Ga0157369_10008450
315 Ga0157369_10032870
316 Ga0157374_11680719
317 Ga0157372_11129403
318 Ga0157380_10005985
319 Ga0157380_10722481
320 Ga0206354_10413920
321 Ga0206353_11288468
322 Ga0213873_10000012
323 Ga0213876_10000021
324 Ga0213876_10000863
325 Ga0213876_10051408
326 Ga0207697_10295525
327 Ga0207682_10007220
328 Ga0207682_10037745
329 Ga0207688_10080834
330 Ga0207688_10163293
331 Ga0207645_10371397
332 Ga0207643_10060508
333 Ga0207705_10000002
334 Ga0207705_10002088
335 Ga0207705_10019495
336 Ga0207705_10021171
337 Ga0207705_10335556
338 Ga0207705_10353156
339 Ga0207705_10403790
340 Ga0207705_10436578
341 Ga0207707_10007643
342 Ga0207660_10008606
343 Ga0207660_11001343
344 Ga0207657_10056280
345 Ga0207657_10082400
346 Ga0207657_10116535
347 Ga0207649_10000038
348 Ga0207649_10011003
349 Ga0207649_10080584
350 Ga0207652_10000008
351 Ga0207652_10235169
352 Ga0207652_10395371
353 Ga0207681_10016147
354 Ga0207681_10034991
355 Ga0207681_10092722
356 Ga0207650_10034190
357 Ga0207650_10051589
358 Ga0207650_10836627
359 Ga0207659_10003141
360 Ga0207644_10005005
361 Ga0207690_10002318
362 Ga0207706_10037005
363 Ga0207706_10077991
364 Ga0207706_10083599
365 Ga0207669_10133663
366 Ga0207691_10051935
367 Ga0207691_10388518
368 Ga0207661_10063940
369 Ga0207679_10083892
370 Ga0207651_10177816
371 Ga0207651_10183793
372 Ga0207651_10183835
373 Ga0207712_10537296
374 Ga0207668_10104438
375 Ga0207668_10193762
376 Ga0207668_10476551
377 Ga0207639_10022210
378 Ga0207678_10117552
379 Ga0207678_10224349
380 Ga0207702_10705541
381 Ga0207648_10424836
382 Ga0207676_10197394
383 Ga0207683_10003583
384 Ga0207683_10103872
385 Ga0207698_10028385
386 Ga0268266_10032942
387 Ga0268266_11276054
388 Ga0307408_100042605
389 Ga0307408_100057504
390 Ga0307408_100309801
391 Ga0307405_10000893
392 Ga0307405_10039177
393 Ga0307405_10071682
394 Ga0307405_10124488
395 Ga0307405_10445630
396 Ga0307413_10001276
397 Ga0307413_10019877
398 Ga0307413_10037738
399 Ga0307413_10048321
400 Ga0307413_10134306
401 Ga0307413_10138776
402 Ga0307413_10314841
403 Ga0307413_10732718
404 Ga0307410_10009601
405 Ga0307410_10052939
406 Ga0307410_10110600
407 Ga0307410_10113643
408 Ga0307410_10204685
409 Ga0307410_10214331
410 Ga0307410_10263445
411 Ga0307410_11486829
412 Ga0307406_10002193
413 Ga0307406_10048131
414 Ga0307406_10054372
415 Ga0307406_10283177
416 Ga0307407_10004996
417 Ga0307407_10054931
418 Ga0307412_10002006
419 Ga0307412_10004772
420 Ga0307412_10036599
421 Ga0307409_100014835
422 Ga0307409_100029646
423 Ga0307409_100063032
424 Ga0307409_100114299
425 Ga0307409_100190217
426 Ga0307409_100217758
427 Ga0307409_100355129
428 Ga0307409_100525044
429 Ga0307409_100556289
430 Ga0307409_100731719
431 Ga0307409_101286078
432 Ga0307416_100002373
433 Ga0307416_100252719
434 Ga0307416_100330589
435 Ga0307416_101116393
436 Ga0307414_10008668
437 Ga0307414_10066264
438 Ga0307414_10094941
439 Ga0307414_10135528
440 Ga0307414_10149961
441 Ga0307414_10209471
442 Ga0307414_10370259
443 Ga0307411_10003495
444 Ga0307411_10025467
445 Ga0307411_10040222
446 Ga0307411_10076290
447 Ga0307411_10124094
448 Ga0307411_10233011
449 Ga0307411_10237955
450 Ga0307411_10259428
451 Ga0307411_10435785
452 Ga0307411_10743249
453 Ga0307415_100055363
454 Ga0395899_0006947
455 Ga0395899_0166709
456 Ga0395899_0255638
457 Ga0395899_0286218
458 Ga0395900_0000336
459 Ga0395900_0083504
460 Ga0395900_0257815
461 Ga0395898_0016208
462 Ga0395898_0022790
463 Ga0395898_0384952
464 Ga0395905_0045997
465 Ga0395905_0049188
466 Ga0395905_0321723
467 Ga0395905_0421061
468 Ga0395905_0503944
469 Ga0395905_1326231
470 Ga0395901_0002173
471 Ga0395901_0111452
472 Ga0395901_0159827
473 Ga0436365_1360649
474 Ga0436365_1794861
475 Ga0436365_1902390
476 Ga0439449_0075766
477 Ga0466972_0093239
478 Ga0466963_0127549
479 Ga0466957_0139363
480 Ga0466958_0800296
481 Ga0466967_0096585
482 Ga0466967_0175035
483 Ga0495643_0245474
484 Ga0495621_0051769
485 Ga0495669_0073073
486 Ga0495672_0336478
487 Ga0496101_0276899
488 Ga0496102_0958254
489 nmdc:mga03683_170370_c1
490 Ga0590071_065828

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

36

164

0.92

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

155

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

28

153

0.8

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

10

154

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v8h-assembly1.cif.gz_D crystal structure of thymidylate synthase from burkholderia thailandensis 0.9111 123 168
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.905 2 168
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.895 2 168
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.8926 2 168
8osp-assembly2.cif.gz_C gcn5-related n-acetyltransferase from lactobacillus curiae 0.8835 2 168
ID Description Score Start End Superfamily
af_Q2FVQ1_4_171_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8987 4 168 3.40.630.30
af_Q2G0G4_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8935 3 164 3.40.630.30
3v8hC00 Alpha Beta;2-Layer Sandwich;Thymidylate Synthase; Chain A;Thymidylate synthase/dCMP hydroxymethylase domain 0.8804 123 168 3.30.572.10
af_Q9SI32_150_379_2.40.160.200 Mainly Beta;Beta Barrel;Porin;LURP1-related 0.8801 58 74 2.40.160.200
3fncA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.879 2 168 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7H0GAG2-F1-model_v4 deleted 0.9911 1 168
AF-A0A7H0GAG2-F1-model_v4 deleted 0.9853 1 168
AF-A0A5C7L0V2-F1-model_v4 deleted 0.9791 3 168
AF-A0A2D7XR87-F1-model_v4 GNAT family N-acetyltransferase 0.9766 1 168 GO:0016747
AF-A0A1V1PU57-F1-model_v4 Acetyltransferase, GNAT family 0.9748 3 168 GO:0016747

Map