F357384

General Info

Members Datasets Scaffolds Average Seq Length
245 125 236 208

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10411307|Ga0157372_104113072
Length 244
Sequence MQRNAGRKYRFRRICTLHSSVLLETATRLSNHHKECIVRIPSLFSPKPLCLAALLCAAAGAQAGITVYTSESAFLAAVTAPGTDTFDDLTIAPYGDTLNRTAGAYHYQAYSATGIWGAGGPADFWLSNNLRYNPIVFSNFSSGVTAFGGNFFASDIAGQFVDGSVVLTAVDGGTLTYDLYGATPSSFLGFVSTSALTSVTLGTDGGAYWPTANNVVLAVPEPSTYGMMLAGITLLGVAARRRRG

Samples

Sample ID Description Type Environment
1 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
2 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
3 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
4 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
5 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
19 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
24 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
25 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
36 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
43 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
52 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
53 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
54 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
55 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
56 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
57 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
58 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
59 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
65 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
68 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
69 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
70 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
71 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
72 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
76 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
77 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
83 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
94 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
97 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
98 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
105 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
106 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
107 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
123 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
124 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.96
Metatranscriptomes 0
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.41
Nodule 0
Rhizoplane 3.27
Rhizosphere 93.88
Stem 0
Stem Tuber 0
Unclassified 2.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10097232 3300003322 Bacteria 5617
2 Ga0065165_1000243 3300005262 Bacteria 93455
3 Ga0070670_100006694 3300005331 Bacteria 9766
4 Ga0070675_100142000 3300005354 Bacteria 2053
5 Ga0070667_100385183 3300005367 Unclassified 1274
6 Ga0070678_100034384 3300005456 Bacteria 3529
7 Ga0070672_100017007 3300005543 Bacteria 5222
8 Ga0070664_100287479 3300005564 Bacteria 1484
9 Ga0070664_100909812 3300005564 Unclassified 825
10 Ga0068854_100417247 3300005578 Unclassified 1114
11 Ga0068852_100346890 3300005616 Bacteria 1448
12 Ga0068851_10041850 3300005834 Bacteria 2305
13 Ga0068863_100020654 3300005841 Bacteria 6291
14 Ga0105248_10018072 3300009177 Bacteria 7783
15 Ga0105248_10284011 3300009177 Unclassified 1863
16 Ga0157374_10051882 3300013296 Bacteria 3818
17 Ga0157374_10860259 3300013296 Unclassified 924
18 Ga0163162_10181975 3300013306 Bacteria 2228
19 Ga0157372_10411307 3300013307 Bacteria 1576
20 Ga0157375_10077502 3300013308 Bacteria 3354
21 Ga0157375_10194872 3300013308 Bacteria 2181
22 Ga0157379_10360649 3300014968 Bacteria 1332
23 Ga0163161_10042100 3300017792 Bacteria 3283
24 Ga0207650_10099880 3300025925 Bacteria 2232
25 Ga0207659_10160198 3300025926 Bacteria 1766
26 Ga0207706_10105605 3300025933 Bacteria 2478
27 Ga0207691_10032366 3300025940 Bacteria 4876
28 Ga0207691_10163829 3300025940 Bacteria 1949
29 Ga0207711_10001888 3300025941 Bacteria 19086
30 Ga0207711_10056024 3300025941 Bacteria 3386
31 Ga0207679_10892387 3300025945 Bacteria 813
32 Ga0207651_10055614 3300025960 Bacteria 2719
33 Ga0207641_10073058 3300026088 Bacteria 2955
34 Ga0207676_10014479 3300026095 Bacteria 5677
35 Ga0207676_10038575 3300026095 Bacteria 3648
36 Ga0207683_10048633 3300026121 Bacteria 3713
37 Ga0207683_10165556 3300026121 Bacteria 2000
38 Ga0373943_0388877 3300035170 Bacteria 804
39 Ga0373946_0143096 3300035171 Bacteria 1110
40 Ga0395899_0013319 3300037312 Bacteria 6291
41 Ga0395899_0106255 3300037312 Bacteria 2021
42 Ga0395899_0131831 3300037312 Bacteria 1784
43 Ga0395899_0183712 3300037312 Bacteria 1466
44 Ga0395900_0000149 3300037418 Bacteria 117114
45 Ga0395900_0153484 3300037418 Bacteria 2352
46 Ga0395898_0074414 3300037466 Bacteria 3280
47 Ga0395898_0166884 3300037466 Bacteria 2105
48 Ga0395898_0270937 3300037466 Bacteria 1619
49 Ga0395898_0455223 3300037466 Bacteria 1218
50 Ga0395905_0082436 3300037471 Bacteria 3013
51 Ga0395905_0267104 3300037471 Bacteria 1596
52 Ga0395905_0447501 3300037471 Bacteria 1189
53 Ga0395905_0645314 3300037471 Bacteria 960
54 Ga0395901_0000025 3300038443 Bacteria 263463
55 Ga0395901_0120710 3300038443 Bacteria 2754
56 Ga0395901_0333651 3300038443 Bacteria 1567
57 Ga0395901_0547985 3300038443 Bacteria 1172
58 Ga0395901_0947996 3300038443 Bacteria 839
59 Ga0439448_0017628 3300042005 Bacteria 2181
60 Ga0439448_0058970 3300042005 Bacteria 1267
61 Ga0439458_0055726 3300042157 Bacteria 981
62 Ga0439458_0081978 3300042157 Bacteria 824
63 Ga0466972_0000413 3300044658 Bacteria 22325
64 Ga0466965_0003323 3300044683 Bacteria 7037
65 Ga0466966_0001360 3300044684 Bacteria 15708
66 Ga0466966_0029900 3300044684 Bacteria 3541
67 Ga0466964_0001985 3300044706 Bacteria 7180
68 Ga0466964_0002629 3300044706 Bacteria 6429
69 Ga0466964_0050773 3300044706 Bacteria 1701
70 Ga0466970_0413717 3300044765 Bacteria 770
71 Ga0466957_0000004 3300044842 Bacteria 106395
72 Ga0466957_0413185 3300044842 Bacteria 925
73 Ga0466959_0018477 3300045049 Bacteria 5119
74 Ga0466959_0072516 3300045049 Bacteria 2492
75 Ga0466967_0014538 3300045976 Bacteria 6137
76 Ga0495627_021209 3300046453 Bacteria 2157
77 Ga0495627_024623 3300046453 Bacteria 1960
78 Ga0495603_0125212 3300046455 Bacteria 1497
79 Ga0495590_0000424 3300046457 Bacteria 21300
80 Ga0495590_0007190 3300046457 Bacteria 4305
81 Ga0495590_0099004 3300046457 Bacteria 1035
82 Ga0495629_0220431 3300046459 Bacteria 1308
83 Ga0495653_0032622 3300046463 Bacteria 4133
84 Ga0495653_0206838 3300046463 Bacteria 1328
85 Ga0495653_0230835 3300046463 Bacteria 1238
86 Ga0495650_0000229 3300046471 Bacteria 114086
87 Ga0495580_0125848 3300046472 Bacteria 1778
88 Ga0495582_0026584 3300046473 Bacteria 3172
89 Ga0495605_0026505 3300046474 Bacteria 3012
90 Ga0495605_0046359 3300046474 Bacteria 2137
91 Ga0495605_0047651 3300046474 Bacteria 2101
92 Ga0495605_0076059 3300046474 Bacteria 1578
93 Ga0495605_0192616 3300046474 Bacteria 891
94 Ga0495584_0000380 3300046491 Bacteria 30618
95 Ga0495584_0001302 3300046491 Bacteria 15182
96 Ga0495584_0010802 3300046491 Bacteria 4687
97 Ga0495584_0117481 3300046491 Bacteria 1346
98 Ga0495584_0182753 3300046491 Bacteria 1065
99 Ga0495584_0184906 3300046491 Bacteria 1059
100 Ga0495585_0006811 3300046492 Bacteria 7051
101 Ga0495585_0065664 3300046492 Bacteria 1987
102 Ga0495585_0176521 3300046492 Bacteria 1100
103 Ga0495585_0348780 3300046492 Bacteria 719
104 Ga0495594_0011180 3300046499 Bacteria 4661
105 Ga0495596_0000498 3300046500 Bacteria 24931
106 Ga0495596_0000812 3300046500 Bacteria 18902
107 Ga0495596_0002348 3300046500 Bacteria 10246
108 Ga0495596_0009387 3300046500 Bacteria 4304
109 Ga0495596_0016316 3300046500 Bacteria 3087
110 Ga0495607_0030054 3300046501 Bacteria 3339
111 Ga0495607_0036166 3300046501 Bacteria 2978
112 Ga0495607_0047767 3300046501 Bacteria 2505
113 Ga0495607_0078052 3300046501 Bacteria 1828
114 Ga0495583_0000314 3300046506 Bacteria 76522
115 Ga0495583_0014817 3300046506 Bacteria 4274
116 Ga0495583_0025197 3300046506 Bacteria 2975
117 Ga0495606_0006154 3300046507 Bacteria 11175
118 Ga0495616_0019507 3300046513 Bacteria 3700
119 Ga0495616_0034209 3300046513 Bacteria 2641
120 Ga0495630_0071104 3300046517 Bacteria 2618
121 Ga0495631_0000254 3300046518 Bacteria 36996
122 Ga0495631_0028890 3300046518 Bacteria 2527
123 Ga0495631_0052820 3300046518 Bacteria 1774
124 Ga0495631_0066574 3300046518 Bacteria 1558
125 Ga0495631_0107312 3300046518 Bacteria 1200
126 Ga0495631_0172022 3300046518 Unclassified 928
127 Ga0495632_0000057 3300046519 Bacteria 123635
128 Ga0495637_0192458 3300046520 Bacteria 752
129 Ga0495643_0022702 3300046522 Bacteria 3575
130 Ga0495643_0054281 3300046522 Bacteria 2146
131 Ga0495648_0000905 3300046524 Bacteria 30973
132 Ga0495648_0021817 3300046524 Bacteria 4424
133 Ga0495648_0089479 3300046524 Bacteria 1727
134 Ga0495666_0000830 3300046526 Bacteria 14241
135 Ga0495666_0004950 3300046526 Bacteria 6746
136 Ga0495666_0263402 3300046526 Bacteria 784
137 Ga0495642_0000167 3300046528 Bacteria 38275
138 Ga0495642_0002622 3300046528 Bacteria 7245
139 Ga0495642_0021930 3300046528 Bacteria 2513
140 Ga0495642_0041609 3300046528 Bacteria 1869
141 Ga0495642_0085867 3300046528 Bacteria 1328
142 Ga0495642_0170534 3300046528 Bacteria 945
143 Ga0495654_0005621 3300046530 Bacteria 7253
144 Ga0495654_0038091 3300046530 Bacteria 2406
145 Ga0495665_0002298 3300046531 Bacteria 10329
146 Ga0495665_0004154 3300046531 Bacteria 7811
147 Ga0495665_0234742 3300046531 Bacteria 946
148 Ga0495640_0120579 3300046533 Bacteria 1705
149 Ga0495640_0203489 3300046533 Bacteria 1254
150 Ga0495587_0012116 3300046536 Bacteria 5444
151 Ga0495587_0027339 3300046536 Bacteria 3474
152 Ga0495609_0001880 3300046538 Bacteria 13405
153 Ga0495609_0003119 3300046538 Bacteria 9681
154 Ga0495609_0143664 3300046538 Bacteria 1017
155 Ga0495597_0000009 3300046542 Bacteria 227319
156 Ga0495597_0000672 3300046542 Bacteria 27772
157 Ga0495597_0007392 3300046542 Bacteria 5582
158 Ga0495597_0074029 3300046542 Bacteria 1463
159 Ga0495597_0097646 3300046542 Bacteria 1241
160 Ga0495633_0043977 3300046558 Bacteria 2117
161 Ga0495633_0119166 3300046558 Bacteria 1222
162 Ga0495656_0036178 3300046615 Bacteria 2033
163 Ga0495668_0002097 3300046616 Bacteria 17259
164 Ga0495668_0027822 3300046616 Bacteria 3202
165 Ga0495668_0057973 3300046616 Bacteria 2137
166 Ga0495634_0038910 3300046642 Bacteria 3241
167 Ga0495611_0000818 3300046648 Bacteria 17196
168 Ga0495611_0006830 3300046648 Bacteria 4848
169 Ga0495625_0023714 3300046660 Bacteria 4683
170 Ga0495625_0168596 3300046660 Bacteria 1463
171 Ga0495661_0013001 3300046665 Bacteria 5607
172 Ga0495661_0033938 3300046665 Bacteria 3214
173 Ga0495661_0116091 3300046665 Bacteria 1485
174 Ga0495661_0230720 3300046665 Bacteria 954
175 Ga0495588_0000041 3300046674 Bacteria 377896
176 Ga0495588_0114116 3300046674 Bacteria 1423
177 Ga0495588_0274304 3300046674 Bacteria 888
178 Ga0495623_0015150 3300046679 Bacteria 4984
179 Ga0495623_0175618 3300046679 Bacteria 1248
180 Ga0495669_0000017 3300046684 Bacteria 131447
181 Ga0495670_0022323 3300046691 Bacteria 3124
182 Ga0495671_0010607 3300046692 Bacteria 5095
183 Ga0495671_0019826 3300046692 Bacteria 3550
184 Ga0495671_0021008 3300046692 Bacteria 3434
185 Ga0495649_0157869 3300046694 Bacteria 1190
186 Ga0495649_0224704 3300046694 Bacteria 970
187 Ga0495649_0341591 3300046694 Bacteria 757
188 Ga0495589_0000102 3300046794 Bacteria 82380
189 Ga0495589_0006892 3300046794 Bacteria 5972
190 Ga0495589_0023620 3300046794 Bacteria 3131
191 Ga0495589_0090666 3300046794 Bacteria 1484
192 Ga0495589_0240050 3300046794 Bacteria 848
193 Ga0495660_0081987 3300046810 Bacteria 1690
194 Ga0495581_0365374 3300047315 Bacteria 842
195 Ga0495604_0001651 3300047317 Bacteria 18344
196 Ga0495672_0000290 3300047320 Bacteria 69104
197 Ga0495672_0001461 3300047320 Bacteria 23188
198 Ga0495672_0008692 3300047320 Bacteria 7452
199 Ga0495680_0196200 3300047322 Bacteria 1450
200 Ga0495683_0025766 3300047323 Bacteria 3012
201 Ga0495683_0037249 3300047323 Bacteria 2466
202 Ga0495683_0136302 3300047323 Bacteria 1153
203 Ga0495687_000023 3300047443 Bacteria 317750
204 Ga0495687_000048 3300047443 Bacteria 205967
205 Ga0495675_0021590 3300047444 Bacteria 4101
206 Ga0495677_0018473 3300047445 Bacteria 2528
207 Ga0495677_0070712 3300047445 Bacteria 1300
208 Ga0495679_039826 3300047446 Bacteria 1463
209 Ga0495685_057724 3300047447 Bacteria 1310
210 Ga0495681_0000018 3300047470 Bacteria 177306
211 Ga0495681_0004371 3300047470 Bacteria 9654
212 Ga0495681_0041289 3300047470 Bacteria 2240
213 Ga0495686_0000222 3300047472 Bacteria 104411
214 Ga0495686_0229751 3300047472 Bacteria 1051
215 Ga0495593_0266118 3300047673 Bacteria 858
216 Ga0495602_0038883 3300048088 Bacteria 4390
217 Ga0495626_0000015 3300048091 Bacteria 232238
218 Ga0495626_0013507 3300048091 Bacteria 4242
219 Ga0495626_0015465 3300048091 Bacteria 3905
220 Ga0495626_0090526 3300048091 Bacteria 1345
221 Ga0496101_0105096 3300048904 Bacteria 2119
222 Ga0496103_0011726 3300048906 Bacteria 5200
223 Ga0496105_0697118 3300048908 Bacteria 780
224 Ga0496106_0157672 3300048909 Bacteria 1793
225 Ga0496108_0545246 3300048911 Bacteria 1012
226 Ga0496110_0003487 3300048913 Bacteria 12064
227 Ga0496111_0021184 3300048914 Bacteria 4535
228 Ga0496121_0041321 3300048924 Bacteria 4032
229 Ga0496124_0041634 3300048927 Bacteria 3962
230 Ga0496124_0058290 3300048927 Bacteria 3249
231 Ga0496124_0141600 3300048927 Bacteria 1897
232 Ga0495678_000100 3300049459 Bacteria 106118
233 Ga0495678_000272 3300049459 Bacteria 57239
234 Ga0495682_0000066 3300049460 Bacteria 97829
235 Ga0501035_0001316 3300049822 Bacteria 25645
236 Ga0466962_0084960 3300061719 Bacteria 1515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_024623 Ga0495627_024623_165_770 188
2 3300046492 Ga0495585_0006811 Ga0495585_0006811_2891_3496 188
3 3300046499 Ga0495594_0011180 Ga0495594_0011180_1638_2243 188
4 3300046500 Ga0495596_0002348 Ga0495596_0002348_2244_2849 188
5 3300046518 Ga0495631_0028890 Ga0495631_0028890_1601_2206 188
6 3300046648 Ga0495611_0000818 Ga0495611_0000818_8001_8606 188
7 3300047445 Ga0495677_0018473 Ga0495677_0018473_275_880 188
8 3300048091 Ga0495626_0015465 Ga0495626_0015465_778_1383 188
9 3300046474 Ga0495605_0076059 Ga0495605_0076059_372_1007 190
10 3300046538 Ga0495609_0143664 Ga0495609_0143664_315_887 190
11 3300046542 Ga0495597_0007392 Ga0495597_0007392_1732_2304 190
12 3300046616 Ga0495668_0027822 Ga0495668_0027822_903_1475 190
13 3300046694 Ga0495649_0341591 Ga0495649_0341591_70_642 190
14 3300046794 Ga0495589_0006892 Ga0495589_0006892_5209_5781 190
15 3300047320 Ga0495672_0008692 Ga0495672_0008692_2345_2917 190
16 3300046463 Ga0495653_0230835 Ga0495653_0230835_619_1200 191
17 3300046472 Ga0495580_0125848 Ga0495580_0125848_824_1405 191
18 3300046517 Ga0495630_0071104 Ga0495630_0071104_328_909 191
19 3300046526 Ga0495666_0004950 Ga0495666_0004950_4986_5567 191
20 3300046531 Ga0495665_0004154 Ga0495665_0004154_3904_4485 191
21 3300046536 Ga0495587_0027339 Ga0495587_0027339_1622_2203 191
22 3300046642 Ga0495634_0038910 Ga0495634_0038910_1180_1761 191
23 3300046679 Ga0495623_0015150 Ga0495623_0015150_1581_2162 191
24 3300047317 Ga0495604_0001651 Ga0495604_0001651_13872_14453 191
25 3300047444 Ga0495675_0021590 Ga0495675_0021590_1791_2372 191
26 3300046558 Ga0495633_0119166 Ga0495633_0119166_42_641 192
27 3300046616 Ga0495668_0057973 Ga0495668_0057973_1270_1869 192
28 3300046648 Ga0495611_0006830 Ga0495611_0006830_3583_4182 192
29 3300046665 Ga0495661_0013001 Ga0495661_0013001_2556_3137 192
30 3300046674 Ga0495588_0000041 Ga0495588_0000041_260688_261266 192
31 3300046674 Ga0495588_0274304 Ga0495588_0274304_201_821 192
32 3300047673 Ga0495593_0266118 Ga0495593_0266118_232_831 192
33 3300048906 Ga0496103_0011726 Ga0496103_0011726_3769_4386 192
34 3300046492 Ga0495585_0176521 Ga0495585_0176521_394_1047 194
35 3300047470 Ga0495681_0000018 Ga0495681_0000018_142893_143510 194
36 3300048908 Ga0496105_0697118 Ga0496105_0697118_91_711 194
37 3300005331 Ga0070670_100006694 Ga0070670_1000066946 195
38 3300005354 Ga0070675_100142000 Ga0070675_1001420002 195
39 3300013296 Ga0157374_10860259 Ga0157374_108602591 195
40 3300013308 Ga0157375_10194872 Ga0157375_101948722 195
41 3300025925 Ga0207650_10099880 Ga0207650_100998802 195
42 3300025926 Ga0207659_10160198 Ga0207659_101601982 195
43 3300048911 Ga0496108_0545246 Ga0496108_0545246_74_700 195
44 3300048913 Ga0496110_0003487 Ga0496110_0003487_2212_2838 195
45 3300048914 Ga0496111_0021184 Ga0496111_0021184_553_1179 195
46 3300044842 Ga0466957_0413185 Ga0466957_0413185_80_763 196
47 3300048904 Ga0496101_0105096 Ga0496101_0105096_280_870 196
48 3300046453 Ga0495627_021209 Ga0495627_021209_266_883 197
49 3300046455 Ga0495603_0125212 Ga0495603_0125212_169_786 197
50 3300046457 Ga0495590_0007190 Ga0495590_0007190_3406_4050 197
51 3300046457 Ga0495590_0099004 Ga0495590_0099004_244_885 197
52 3300046459 Ga0495629_0220431 Ga0495629_0220431_584_1201 197
53 3300046473 Ga0495582_0026584 Ga0495582_0026584_1285_1902 197
54 3300046474 Ga0495605_0026505 Ga0495605_0026505_1211_1828 197
55 3300046474 Ga0495605_0192616 Ga0495605_0192616_106_723 197
56 3300046491 Ga0495584_0117481 Ga0495584_0117481_278_895 197
57 3300046491 Ga0495584_0182753 Ga0495584_0182753_278_895 197
58 3300046492 Ga0495585_0065664 Ga0495585_0065664_1057_1674 197
59 3300046492 Ga0495585_0348780 Ga0495585_0348780_42_683 197
60 3300046500 Ga0495596_0000812 Ga0495596_0000812_7760_8377 197
61 3300046501 Ga0495607_0030054 Ga0495607_0030054_1894_2538 197
62 3300046501 Ga0495607_0036166 Ga0495607_0036166_833_1450 197
63 3300046506 Ga0495583_0014817 Ga0495583_0014817_2889_3533 197
64 3300046518 Ga0495631_0000254 Ga0495631_0000254_24604_25248 197
65 3300046518 Ga0495631_0066574 Ga0495631_0066574_230_847 197
66 3300046518 Ga0495631_0107312 Ga0495631_0107312_298_915 197
67 3300046522 Ga0495643_0022702 Ga0495643_0022702_945_1589 197
68 3300046524 Ga0495648_0089479 Ga0495648_0089479_819_1463 197
69 3300046528 Ga0495642_0041609 Ga0495642_0041609_1115_1735 197
70 3300046528 Ga0495642_0085867 Ga0495642_0085867_50_667 197
71 3300046528 Ga0495642_0170534 Ga0495642_0170534_240_860 197
72 3300046530 Ga0495654_0005621 Ga0495654_0005621_596_1240 197
73 3300046538 Ga0495609_0001880 Ga0495609_0001880_10825_11454 197
74 3300046542 Ga0495597_0000009 Ga0495597_0000009_120250_120891 197
75 3300046542 Ga0495597_0000672 Ga0495597_0000672_16346_16975 197
76 3300046542 Ga0495597_0074029 Ga0495597_0074029_558_1175 197
77 3300046616 Ga0495668_0002097 Ga0495668_0002097_11003_11647 197
78 3300046660 Ga0495625_0023714 Ga0495625_0023714_2011_2655 197
79 3300046665 Ga0495661_0116091 Ga0495661_0116091_564_1181 197
80 3300046674 Ga0495588_0114116 Ga0495588_0114116_96_713 197
81 3300046684 Ga0495669_0000017 Ga0495669_0000017_113437_114054 197
82 3300046691 Ga0495670_0022323 Ga0495670_0022323_1285_1902 197
83 3300046692 Ga0495671_0019826 Ga0495671_0019826_771_1415 197
84 3300046794 Ga0495589_0000102 Ga0495589_0000102_15390_16031 197
85 3300046794 Ga0495589_0090666 Ga0495589_0090666_570_1187 197
86 3300047323 Ga0495683_0136302 Ga0495683_0136302_11_628 197
87 3300047443 Ga0495687_000048 Ga0495687_000048_94795_95436 197
88 3300047446 Ga0495679_039826 Ga0495679_039826_590_1234 197
89 3300047447 Ga0495685_057724 Ga0495685_057724_359_1003 197
90 3300047470 Ga0495681_0041289 Ga0495681_0041289_311_928 197
91 3300005262 Ga0065165_1000243 Ga0065165_100024364 198
92 3300046491 Ga0495584_0001302 Ga0495584_0001302_12412_13029 198
93 3300046491 Ga0495584_0184906 Ga0495584_0184906_228_851 198
94 3300046506 Ga0495583_0000314 Ga0495583_0000314_41586_42209 198
95 3300048927 Ga0496124_0041634 Ga0496124_0041634_3304_3933 198
96 3300048927 Ga0496124_0141600 Ga0496124_0141600_434_1057 198
97 3300035170 Ga0373943_0388877 Ga0373943_0388877_17_661 199
98 3300046500 Ga0495596_0000498 Ga0495596_0000498_3034_3678 199
99 3300046518 Ga0495631_0052820 Ga0495631_0052820_77_721 199
100 3300046518 Ga0495631_0172022 Ga0495631_0172022_88_711 199
101 3300046528 Ga0495642_0002622 Ga0495642_0002622_4681_5304 199
102 3300046558 Ga0495633_0043977 Ga0495633_0043977_557_1180 199
103 3300046692 Ga0495671_0010607 Ga0495671_0010607_4269_4913 199
104 3300046692 Ga0495671_0021008 Ga0495671_0021008_183_827 199
105 3300046694 Ga0495649_0157869 Ga0495649_0157869_339_962 199
106 3300046810 Ga0495660_0081987 Ga0495660_0081987_916_1560 199
107 3300047470 Ga0495681_0004371 Ga0495681_0004371_4739_5362 199
108 3300046474 Ga0495605_0046359 Ga0495605_0046359_245_868 202
109 3300047472 Ga0495686_0000222 Ga0495686_0000222_76361_76975 202
110 3300044683 Ga0466965_0003323 Ga0466965_0003323_5406_6017 203
111 3300044684 Ga0466966_0029900 Ga0466966_0029900_388_999 203
112 3300044842 Ga0466957_0000004 Ga0466957_0000004_82405_83016 203
113 3300045049 Ga0466959_0072516 Ga0466959_0072516_497_1108 203
114 3300046457 Ga0495590_0000424 Ga0495590_0000424_17684_18301 203
115 3300046463 Ga0495653_0206838 Ga0495653_0206838_678_1295 203
116 3300046491 Ga0495584_0010802 Ga0495584_0010802_2896_3522 203
117 3300046528 Ga0495642_0021930 Ga0495642_0021930_242_868 203
118 3300046530 Ga0495654_0038091 Ga0495654_0038091_1394_2020 203
119 3300046533 Ga0495640_0203489 Ga0495640_0203489_100_717 203
120 3300046542 Ga0495597_0007392 Ga0495597_0007392_915_1541 203
121 3300046616 Ga0495668_0027822 Ga0495668_0027822_86_712 203
122 3300046794 Ga0495589_0006892 Ga0495589_0006892_4392_5018 203
123 3300047320 Ga0495672_0008692 Ga0495672_0008692_1528_2154 203
124 3300048088 Ga0495602_0038883 Ga0495602_0038883_2273_2890 203
125 iso_pu_bacteria 2600255292 2601670230 203
126 iso_pu_bacteria 2857547612 2857552197 203
127 iso_pu_bacteria 2885080285 2885082918 203
128 iso_pu_bacteria 2932410948 2932413740 203
129 iso_pu_bacteria 2932416698 2932417800 203
130 3300046471 Ga0495650_0000229 Ga0495650_0000229_39064_39678 204
131 3300046474 Ga0495605_0047651 Ga0495605_0047651_156_770 204
132 3300046500 Ga0495596_0009387 Ga0495596_0009387_3543_4160 204
133 3300046524 Ga0495648_0000905 Ga0495648_0000905_15380_15994 204
134 3300046538 Ga0495609_0003119 Ga0495609_0003119_3430_4044 204
135 3300046794 Ga0495589_0023620 Ga0495589_0023620_1031_1645 204
136 3300047320 Ga0495672_0001461 Ga0495672_0001461_974_1588 204
137 3300047323 Ga0495683_0025766 Ga0495683_0025766_1073_1687 204
138 3300005367 Ga0070667_100385183 Ga0070667_1003851831 205
139 3300005456 Ga0070678_100034384 Ga0070678_1000343842 205
140 3300005543 Ga0070672_100017007 Ga0070672_1000170076 205
141 3300005564 Ga0070664_100909812 Ga0070664_1009098121 205
142 3300005578 Ga0068854_100417247 Ga0068854_1004172472 205
143 3300005616 Ga0068852_100346890 Ga0068852_1003468902 205
144 3300005834 Ga0068851_10041850 Ga0068851_100418502 205
145 3300005841 Ga0068863_100020654 Ga0068863_1000206542 205
146 3300009177 Ga0105248_10018072 Ga0105248_100180722 205
147 3300009177 Ga0105248_10284011 Ga0105248_102840113 205
148 3300013296 Ga0157374_10051882 Ga0157374_100518822 205
149 3300013306 Ga0163162_10181975 Ga0163162_101819752 205
150 3300013308 Ga0157375_10077502 Ga0157375_100775022 205
151 3300014968 Ga0157379_10360649 Ga0157379_103606492 205
152 3300017792 Ga0163161_10042100 Ga0163161_100421002 205
153 3300025940 Ga0207691_10032366 Ga0207691_100323666 205
154 3300025940 Ga0207691_10163829 Ga0207691_101638293 205
155 3300025941 Ga0207711_10001888 Ga0207711_1000188810 205
156 3300025941 Ga0207711_10056024 Ga0207711_100560244 205
157 3300025945 Ga0207679_10892387 Ga0207679_108923871 205
158 3300025960 Ga0207651_10055614 Ga0207651_100556142 205
159 3300026088 Ga0207641_10073058 Ga0207641_100730582 205
160 3300026095 Ga0207676_10014479 Ga0207676_100144792 205
161 3300026095 Ga0207676_10038575 Ga0207676_100385752 205
162 3300026121 Ga0207683_10048633 Ga0207683_100486333 205
163 3300026121 Ga0207683_10165556 Ga0207683_101655564 205
164 3300035171 Ga0373946_0143096 Ga0373946_0143096_38_700 205
165 3300046501 Ga0495607_0047767 Ga0495607_0047767_1023_1667 205
166 3300046519 Ga0495632_0000057 Ga0495632_0000057_120424_121080 205
167 3300046520 Ga0495637_0192458 Ga0495637_0192458_57_701 205
168 3300046522 Ga0495643_0054281 Ga0495643_0054281_1298_1918 205
169 3300046524 Ga0495648_0021817 Ga0495648_0021817_2984_3628 205
170 3300046665 Ga0495661_0230720 Ga0495661_0230720_129_773 205
171 3300047320 Ga0495672_0000290 Ga0495672_0000290_12506_13162 205
172 3300048091 Ga0495626_0013507 Ga0495626_0013507_3393_4037 205
173 3300048091 Ga0495626_0090526 Ga0495626_0090526_109_753 205
174 3300049459 Ga0495678_000100 Ga0495678_000100_36220_36864 205
175 3300046463 Ga0495653_0032622 Ga0495653_0032622_595_1221 206
176 3300046500 Ga0495596_0016316 Ga0495596_0016316_1239_1883 206
177 3300046506 Ga0495583_0025197 Ga0495583_0025197_1465_2109 206
178 3300046513 Ga0495616_0034209 Ga0495616_0034209_1842_2486 206
179 3300046526 Ga0495666_0000830 Ga0495666_0000830_9973_10593 206
180 3300046526 Ga0495666_0263402 Ga0495666_0263402_132_758 206
181 3300046531 Ga0495665_0002298 Ga0495665_0002298_3023_3643 206
182 3300046531 Ga0495665_0234742 Ga0495665_0234742_308_934 206
183 3300046533 Ga0495640_0120579 Ga0495640_0120579_100_720 206
184 3300046536 Ga0495587_0012116 Ga0495587_0012116_3075_3701 206
185 3300046660 Ga0495625_0168596 Ga0495625_0168596_321_965 206
186 3300046679 Ga0495623_0175618 Ga0495623_0175618_230_853 206
187 3300046694 Ga0495649_0224704 Ga0495649_0224704_251_895 206
188 3300046794 Ga0495589_0240050 Ga0495589_0240050_97_741 206
189 3300047315 Ga0495581_0365374 Ga0495581_0365374_59_685 206
190 3300047322 Ga0495680_0196200 Ga0495680_0196200_613_1239 206
191 3300047323 Ga0495683_0037249 Ga0495683_0037249_541_1185 206
192 3300047445 Ga0495677_0070712 Ga0495677_0070712_417_1061 206
193 3300047472 Ga0495686_0229751 Ga0495686_0229751_217_900 206
194 3300048909 Ga0496106_0157672 Ga0496106_0157672_971_1654 206
195 3300049459 Ga0495678_000272 Ga0495678_000272_1764_2408 206
196 3300049460 Ga0495682_0000066 Ga0495682_0000066_80104_80748 206
197 3300013307 Ga0157372_10411307 Ga0157372_104113072 207
198 3300037312 Ga0395899_0013319 Ga0395899_0013319_4499_5122 207
199 3300037312 Ga0395899_0106255 Ga0395899_0106255_126_812 207
200 3300037312 Ga0395899_0131831 Ga0395899_0131831_928_1662 207
201 3300037312 Ga0395899_0183712 Ga0395899_0183712_501_1187 207
202 3300037418 Ga0395900_0153484 Ga0395900_0153484_325_1011 207
203 3300037466 Ga0395898_0074414 Ga0395898_0074414_1342_2028 207
204 3300037466 Ga0395898_0166884 Ga0395898_0166884_269_892 207
205 3300037466 Ga0395898_0270937 Ga0395898_0270937_734_1468 207
206 3300037466 Ga0395898_0455223 Ga0395898_0455223_115_738 207
207 3300037471 Ga0395905_0082436 Ga0395905_0082436_714_1337 207
208 3300037471 Ga0395905_0267104 Ga0395905_0267104_149_835 207
209 3300037471 Ga0395905_0447501 Ga0395905_0447501_135_869 207
210 3300037471 Ga0395905_0645314 Ga0395905_0645314_107_730 207
211 3300038443 Ga0395901_0120710 Ga0395901_0120710_1337_1960 207
212 3300038443 Ga0395901_0333651 Ga0395901_0333651_805_1428 207
213 3300038443 Ga0395901_0547985 Ga0395901_0547985_304_1038 207
214 3300038443 Ga0395901_0947996 Ga0395901_0947996_19_705 207
215 3300046542 Ga0495597_0097646 Ga0495597_0097646_19_660 207
216 3300048091 Ga0495626_0000015 Ga0495626_0000015_82534_83205 207
217 3300048924 Ga0496121_0041321 Ga0496121_0041321_2179_2847 207
218 3300003322 rootL2_10097232 rootL2_100972324 208
219 3300005564 Ga0070664_100287479 Ga0070664_1002874792 208
220 3300025933 Ga0207706_10105605 Ga0207706_101056051 208
221 3300037418 Ga0395900_0000149 Ga0395900_0000149_11353_11979 208
222 3300038443 Ga0395901_0000025 Ga0395901_0000025_21773_22399 208
223 3300042005 Ga0439448_0017628 Ga0439448_0017628_240_875 208
224 3300042005 Ga0439448_0058970 Ga0439448_0058970_289_915 208
225 3300042157 Ga0439458_0055726 Ga0439458_0055726_162_797 208
226 3300042157 Ga0439458_0081978 Ga0439458_0081978_153_779 208
227 3300044658 Ga0466972_0000413 Ga0466972_0000413_17984_18679 208
228 3300044684 Ga0466966_0001360 Ga0466966_0001360_6030_6656 208
229 3300044706 Ga0466964_0001985 Ga0466964_0001985_4394_5089 208
230 3300044706 Ga0466964_0002629 Ga0466964_0002629_3893_4519 208
231 3300044706 Ga0466964_0050773 Ga0466964_0050773_342_1016 208
232 3300044765 Ga0466970_0413717 Ga0466970_0413717_127_753 208
233 3300045049 Ga0466959_0018477 Ga0466959_0018477_4242_4937 208
234 3300045976 Ga0466967_0014538 Ga0466967_0014538_1591_2217 208
235 3300046491 Ga0495584_0000380 Ga0495584_0000380_13932_14627 208
236 3300046501 Ga0495607_0078052 Ga0495607_0078052_192_887 208
237 3300046507 Ga0495606_0006154 Ga0495606_0006154_8205_8900 208
238 3300046513 Ga0495616_0019507 Ga0495616_0019507_1886_2581 208
239 3300046528 Ga0495642_0000167 Ga0495642_0000167_21914_22609 208
240 3300046615 Ga0495656_0036178 Ga0495656_0036178_259_954 208
241 3300046665 Ga0495661_0033938 Ga0495661_0033938_1450_2145 208
242 3300047443 Ga0495687_000023 Ga0495687_000023_74423_75118 208
243 3300048927 Ga0496124_0058290 Ga0496124_0058290_247_942 208
244 3300049822 Ga0501035_0001316 Ga0501035_0001316_20212_20838 208
245 3300061719 Ga0466962_0084960 Ga0466962_0084960_28_717 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07589

PEP-CTERM

PEP-CTERM motif

218

243

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yc4-assembly1.cif.gz_A intraflagellar transport complex 25-27 from chlamydomonas 0.6041 83 185
1bev-assembly1.cif.gz_1 bovine enterovirus vg-5-27 0.5844 106 185
3gza-assembly1.cif.gz_B crystal structure of putative alpha-l-fucosidase (np_812709.1) from bacteroides thetaiotaomicron vpi-5482 at 1.60 a resolution 0.5558 88 183
2qbx-assembly1.cif.gz_A ephb2/snew antagonistic peptide complex 0.5556 72 183
1w99-assembly1.cif.gz_A mosquito-larvicidal toxin cry4ba from bacillus thuringiensis ssp. israelensis 0.5538 73 188
ID Description Score Start End Superfamily
af_A0A368UHS9_5_166_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.6613 86 180 2.60.120.430
af_I1LIY1_31_167_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6365 70 181 2.60.120.260
af_I1M5E9_31_354_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.6363 86 183 2.60.120.430
af_A0A0R0IW52_41_387_2.60.120.260 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6339 86 183 2.60.120.260
af_O22187_38_191_2.60.120.430 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding lectin 0.6219 72 184 2.60.120.430
ID Description Score Start End GO Terms
AF-A0A7Y2NYV2-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.9281 24 208 GO:0016020
AF-A0A7Y2NYV2-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.8914 24 208 GO:0016020
AF-A0A542LJE5-F1-model_v4 Putative secreted protein 0.8747 2 205
AF-A0A2G8TIR7-F1-model_v4 PEP-CTERM sorting domain-containing protein 0.8705 2 207 GO:0016020
AF-A0A2W5MXD5-F1-model_v4 Uncharacterized protein 0.868 30 186

Feature Viewer

pLDDT pTM Quality
85.01 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map