F357496

General Info

Members Datasets Scaffolds Average Seq Length
245 193 240 93

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10484253|Ga0316578_104842532
Length 91
Sequence MIKSFRSRETEKIWNGIRSKRLPQSIQQIARRKLRMLNNARSINDLRVPPANRLEALRGNRKGQHSIKDQWRICFTWMDGDAINVEIVDYH

Samples

Sample ID Description Type Environment
1 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
2 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
3 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
4 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
5 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
6 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
127 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
128 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
129 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
136 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
137 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
163 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
164 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
192 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
193 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.55
Metatranscriptomes 0.41
Isolates 2.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 0
Rhizoplane 1.22
Rhizosphere 82.86
Stem 0
Stem Tuber 0
Unclassified 5.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002788 3300001915 Bacteria 4407
2 JGI24740J21852_10089463 3300001979 Bacteria 796
3 JGI25152J39213_1010722 3300002773 Bacteria 2073
4 JGI25150J39212_1026389 3300002774 Bacteria 840
5 JGI25151J46595_10018792 3300003187 Bacteria 2954
6 JGI25153J46596_10026138 3300003215 Bacteria 2073
7 rootH1_10107700 3300003316 Bacteria 1103
8 Ga0006562J51391_1092627 3300003578 Bacteria 508
9 Ga0055535_1000419 3300003761 Bacteria 40090
10 Ga0055542_1000639 3300003762 Bacteria 29329
11 Ga0070683_100723409 3300005329 Bacteria 953
12 Ga0070690_100083697 3300005330 Bacteria 2090
13 Ga0070666_10409436 3300005335 Bacteria 975
14 Ga0070682_100091401 3300005337 Bacteria 1992
15 Ga0070689_100448186 3300005340 Bacteria 1098
16 Ga0070691_10019962 3300005341 Bacteria 3094
17 Ga0070691_10196188 3300005341 Bacteria 1058
18 Ga0070691_10313556 3300005341 Bacteria 860
19 Ga0070661_100437824 3300005344 Bacteria 1038
20 Ga0070692_10511382 3300005345 Bacteria 780
21 Ga0070668_102200116 3300005347 Bacteria 510
22 Ga0070659_100128072 3300005366 Bacteria 2060
23 Ga0070659_100603508 3300005366 Bacteria 943
24 Ga0070701_10030150 3300005438 Bacteria 2681
25 Ga0070711_100826687 3300005439 Bacteria 787
26 Ga0070694_101527831 3300005444 Unclassified 565
27 Ga0070663_101447687 3300005455 Bacteria 609
28 Ga0068867_100130193 3300005459 Bacteria 1954
29 Ga0070685_10454373 3300005466 Bacteria 898
30 Ga0070707_101457492 3300005468 Bacteria 651
31 Ga0070684_101388062 3300005535 Bacteria 661
32 Ga0068853_100177262 3300005539 Bacteria 1931
33 Ga0068853_101778129 3300005539 Bacteria 597
34 Ga0070695_100164645 3300005545 Bacteria 1560
35 Ga0070696_100232297 3300005546 Bacteria 1388
36 Ga0070693_100028301 3300005547 Bacteria 3046
37 Ga0070693_100291543 3300005547 Bacteria 1096
38 Ga0070664_100060605 3300005564 Bacteria 3223
39 Ga0068857_100233317 3300005577 Bacteria 1683
40 Ga0068859_101031238 3300005617 Bacteria 904
41 Ga0068864_100326275 3300005618 Bacteria 1443
42 Ga0068866_10017379 3300005718 Bacteria 3234
43 Ga0068861_100325171 3300005719 Bacteria 1340
44 Ga0068851_10010964 3300005834 Bacteria 4240
45 Ga0068851_10335880 3300005834 Bacteria 876
46 Ga0068858_100550688 3300005842 Bacteria 1117
47 Ga0068860_100884955 3300005843 Bacteria 909
48 Ga0068862_100047838 3300005844 Bacteria 3651
49 Ga0081540_1041203 3300005983 Bacteria 2397
50 Ga0075363_100426544 3300006048 Bacteria 781
51 Ga0068871_101225312 3300006358 Bacteria 704
52 Ga0068865_100056654 3300006881 Bacteria 2731
53 Ga0097620_101031387 3300006931 Bacteria 904
54 Ga0075435_100532783 3300007076 Bacteria 1016
55 Ga0105240_11656089 3300009093 Bacteria 669
56 Ga0105240_11866565 3300009093 Bacteria 626
57 Ga0105247_11563214 3300009101 Unclassified 540
58 Ga0105243_10021699 3300009148 Bacteria 4875
59 Ga0105242_10025803 3300009176 Bacteria 4653
60 Ga0105248_10133859 3300009177 Bacteria 2797
61 Ga0105248_10481170 3300009177 Bacteria 1399
62 Ga0105248_11921380 3300009177 Bacteria 672
63 Ga0105237_10175293 3300009545 Bacteria 2144
64 Ga0105237_10741910 3300009545 Bacteria 988
65 Ga0105238_10004586 3300009551 Bacteria 13664
66 Ga0105238_10631785 3300009551 Bacteria 1080
67 Ga0105238_12481709 3300009551 Bacteria 554
68 Ga0105249_10263983 3300009553 Bacteria 1712
69 Ga0105239_10091123 3300010375 Bacteria 3364
70 Ga0105239_11747670 3300010375 Bacteria 720
71 Ga0105246_10711748 3300011119 Bacteria 881
72 Ga0157371_10458184 3300013102 Bacteria 938
73 Ga0157370_10337633 3300013104 Bacteria 1389
74 Ga0157370_11950608 3300013104 Bacteria 527
75 Ga0157369_10245281 3300013105 Bacteria 1870
76 Ga0157369_12095803 3300013105 Bacteria 574
77 Ga0157378_10082883 3300013297 Bacteria 2901
78 Ga0163162_10844214 3300013306 Bacteria 1031
79 Ga0157375_10212313 3300013308 Bacteria 2093
80 Ga0157380_10052900 3300014326 Bacteria 3217
81 Ga0157379_10130945 3300014968 Bacteria 2258
82 Ga0163161_10852957 3300017792 Bacteria 769
83 Ga0209672_100005 3300025228 Bacteria 1069303
84 Ga0209258_100006 3300025242 Bacteria 1069303
85 Ga0207425_1006901 3300025245 Bacteria 3061
86 Ga0209148_1000012 3300025254 Bacteria 1069303
87 Ga0209129_1003991 3300025258 Bacteria 6072
88 Ga0209455_1000008 3300025272 Bacteria 1069303
89 Ga0209025_1016040 3300025294 Bacteria 4460
90 Ga0209758_1004992 3300025297 Bacteria 10600
91 Ga0207656_10101366 3300025321 Bacteria 1320
92 Ga0207656_10126533 3300025321 Bacteria 1194
93 Ga0207642_10439431 3300025899 Bacteria 788
94 Ga0207680_10560147 3300025903 Bacteria 816
95 Ga0207647_10054066 3300025904 Bacteria 2471
96 Ga0207643_10009709 3300025908 Bacteria 5163
97 Ga0207705_10028202 3300025909 Bacteria 4002
98 Ga0207707_10000694 3300025912 Bacteria 33357
99 Ga0207695_10111499 3300025913 Bacteria 2715
100 Ga0207671_10085398 3300025914 Bacteria 2371
101 Ga0207660_10200278 3300025917 Bacteria 1559
102 Ga0207662_10145846 3300025918 Bacteria 1502
103 Ga0207657_10579930 3300025919 Bacteria 876
104 Ga0207649_10823764 3300025920 Bacteria 725
105 Ga0207652_10489032 3300025921 Bacteria 1108
106 Ga0207646_11664503 3300025922 Bacteria 549
107 Ga0207690_10125093 3300025932 Bacteria 1873
108 Ga0207709_10585604 3300025935 Bacteria 882
109 Ga0207669_10563185 3300025937 Bacteria 921
110 Ga0207704_10174140 3300025938 Bacteria 1547
111 Ga0207711_11003014 3300025941 Bacteria 774
112 Ga0207689_10006101 3300025942 Bacteria 10658
113 Ga0207667_10115837 3300025949 Bacteria 2762
114 Ga0207668_10351737 3300025972 Bacteria 1232
115 Ga0207640_10159732 3300025981 Bacteria 1666
116 Ga0207703_10371392 3300026035 Bacteria 1321
117 Ga0207678_10845160 3300026067 Bacteria 809
118 Ga0207678_11650733 3300026067 Bacteria 564
119 Ga0207708_10332073 3300026075 Bacteria 1243
120 Ga0207702_10908989 3300026078 Bacteria 872
121 Ga0207648_10004017 3300026089 Bacteria 15271
122 Ga0207676_10232869 3300026095 Bacteria 1648
123 Ga0207674_10003063 3300026116 Bacteria 20678
124 Ga0207674_10013900 3300026116 Bacteria 8907
125 Ga0268265_10076166 3300028380 Bacteria 2631
126 Ga0268264_10156371 3300028381 Bacteria 2049
127 Ga0265338_10327728 3300028800 Bacteria 1107
128 Ga0316575_10003770 3300031665 Bacteria 5272
129 Ga0316575_10039883 3300031665 Bacteria 1854
130 Ga0316579_10001301 3300031691 Bacteria 9006
131 Ga0316579_10624883 3300031691 Bacteria 521
132 Ga0316576_10001613 3300031727 Bacteria 12319
133 Ga0316576_11197704 3300031727 Bacteria 536
134 Ga0316576_11339212 3300031727 Bacteria 503
135 Ga0316578_10009966 3300031728 Bacteria 4910
136 Ga0316578_10484253 3300031728 Bacteria 730
137 Ga0307516_10632292 3300031730 Bacteria 725
138 Ga0316577_10001890 3300031733 Bacteria 10132
139 Ga0316577_10411095 3300031733 Bacteria 769
140 Ga0307413_11078939 3300031824 Unclassified 692
141 Ga0307412_10001915 3300031911 Bacteria 11500
142 Ga0307416_100162205 3300032002 Bacteria 2068
143 Ga0307414_10853274 3300032004 Unclassified 833
144 Ga0307415_100364592 3300032126 Unclassified 1221
145 Ga0316583_10132827 3300032133 Bacteria 867
146 Ga0316583_10154584 3300032133 Bacteria 798
147 Ga0316585_10000147 3300032137 Bacteria 13871
148 Ga0316580_10000203 3300032139 Bacteria 12154
149 Ga0316574_0001773 3300035398 Bacteria 10477
150 Ga0316574_0349607 3300035398 Bacteria 935
151 Ga0373937_1234392 3300036401 Unclassified 696
152 Ga0316582_0001193 3300036647 Bacteria 11152
153 Ga0316584_0002526 3300036712 Bacteria 11598
154 Ga0316581_0133887 3300037588 Bacteria 764
155 Ga0436365_1620355 3300039437 Bacteria 1828
156 Ga0439465_0005824 3300041413 Bacteria 3924
157 Ga0451791_0233200 3300041451 Bacteria 692
158 Ga0451797_0287777 3300041453 Unclassified 570
159 Ga0451800_0764704 3300041459 Bacteria 820
160 Ga0451837_1412251 3300041494 Bacteria 1184
161 Ga0439445_0035800 3300042004 Bacteria 1304
162 Ga0450923_121401 3300042125 Bacteria 617
163 Ga0451577_0083566 3300042876 Bacteria 2848
164 Ga0451577_0339457 3300042876 Bacteria 1363
165 Ga0451577_0609266 3300042876 Bacteria 991
166 Ga0453683_0141362 3300044673 Bacteria 1519
167 Ga0453683_1060513 3300044673 Bacteria 539
168 Ga0453684_0027966 3300044712 Bacteria 8065
169 Ga0453684_0133937 3300044712 Bacteria 2970
170 Ga0453684_1436143 3300044712 Unclassified 714
171 Ga0451576_0007601 3300045051 Bacteria 12910
172 Ga0466967_0492092 3300045976 Bacteria 1203
173 Ga0495585_0034889 3300046492 Bacteria 2844
174 Ga0495606_0285093 3300046507 Bacteria 901
175 Ga0495610_0000618 3300046512 Bacteria 35134
176 Ga0495610_0051676 3300046512 Bacteria 1999
177 Ga0495620_0077666 3300046515 Bacteria 1347
178 Ga0495632_0064331 3300046519 Bacteria 1774
179 Ga0495632_0210210 3300046519 Bacteria 883
180 Ga0495643_0175119 3300046522 Bacteria 1046
181 Ga0495668_0770935 3300046616 Bacteria 532
182 Ga0495625_0122969 3300046660 Bacteria 1764
183 Ga0495661_0477423 3300046665 Bacteria 597
184 Ga0495588_0066513 3300046674 Bacteria 1871
185 Ga0495670_0430100 3300046691 Bacteria 714
186 Ga0495681_0055251 3300047470 Bacteria 1852
187 Ga0495686_0014563 3300047472 Bacteria 5409
188 Ga0495686_0373636 3300047472 Bacteria 770
189 Ga0496116_0249934 3300048919 Bacteria 883
190 Ga0496119_0277738 3300048922 Bacteria 834
191 Ga0496121_0128792 3300048924 Bacteria 1898
192 Ga0496122_0172469 3300048925 Bacteria 1301
193 Ga0496122_0220357 3300048925 Bacteria 1089
194 Ga0496123_0113947 3300048926 Bacteria 1538
195 Ga0501033_0002258 3300049570 Bacteria 16507
196 Ga0501033_0465941 3300049570 Bacteria 876
197 Ga0501034_0003074 3300049571 Bacteria 19249
198 Ga0501034_0069399 3300049571 Bacteria 3535
199 Ga0501034_0259560 3300049571 Bacteria 1680
200 Ga0501034_0310009 3300049571 Bacteria 1513
201 Ga0501036_0372514 3300049572 Bacteria 1192
202 Ga0501037_0131431 3300049573 Bacteria 1795
203 Ga0501037_0756217 3300049573 Bacteria 644
204 Ga0501038_0665175 3300049574 Bacteria 783
205 Ga0501039_0026277 3300049575 Bacteria 4474
206 Ga0501043_0230859 3300049579 Bacteria 1429
207 Ga0501046_0092347 3300049580 Bacteria 2327
208 Ga0501047_0001606 3300049581 Bacteria 22029
209 Ga0501047_0182388 3300049581 Bacteria 1965
210 Ga0501047_0448241 3300049581 Bacteria 1120
211 Ga0501047_0487593 3300049581 Bacteria 1060
212 Ga0501067_0573711 3300049583 Bacteria 632
213 Ga0501068_0461668 3300049584 Bacteria 822
214 Ga0501070_0011696 3300049586 Bacteria 7410
215 Ga0501073_0062820 3300049589 Bacteria 2590
216 Ga0501073_0580476 3300049589 Bacteria 774
217 Ga0501074_0031424 3300049590 Bacteria 3846
218 Ga0501198_055880 3300049649 Bacteria 713
219 Ga0501079_0139973 3300049741 Bacteria 1885
220 Ga0501080_0010014 3300049742 Bacteria 8665
221 Ga0501080_0182701 3300049742 Bacteria 1929
222 Ga0501080_0625278 3300049742 Bacteria 954
223 Ga0501035_0111870 3300049822 Bacteria 2392
224 Ga0501035_0395654 3300049822 Bacteria 1150
225 Ga0501035_0466401 3300049822 Bacteria 1043
226 Ga0501035_0983406 3300049822 Bacteria 664
227 Ga0501044_0177651 3300049823 Bacteria 2097
228 Ga0501044_0201698 3300049823 Bacteria 1947
229 Ga0501044_0277518 3300049823 Bacteria 1610
230 nmdc:mga03n38_367224_c1 3300050490 Bacteria 786
231 nmdc:mga0n895_1678561_c1 3300050512 Bacteria 598
232 Ga0500644_0105972 3300053088 Bacteria 1075
233 Ga0500646_0078453 3300053090 Unclassified 1003
234 Ga0500562_002935 3300053108 Bacteria 4260
235 Ga0500618_008896 3300053125 Bacteria 2769
236 Ga0500652_210723 3300053131 Bacteria 785
237 Ga0500655_061185 3300053133 Bacteria 759
238 Ga0500622_0115704 3300053156 Bacteria 1305
239 Ga0500622_0312331 3300053156 Bacteria 665
240 Ga0500627_0244741 3300053158 Unclassified 795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1041203 Ga0081540_10412033 84
2 3300009545 Ga0105237_10175293 Ga0105237_101752933 85
3 3300009551 Ga0105238_10004586 Ga0105238_100045863 85
4 3300010375 Ga0105239_10091123 Ga0105239_100911235 85
5 3300025914 Ga0207671_10085398 Ga0207671_100853983 85
6 3300005347 Ga0070668_102200116 Ga0070668_1022001161 86
7 3300005618 Ga0068864_100326275 Ga0068864_1003262754 86
8 3300009177 Ga0105248_11921380 Ga0105248_119213802 86
9 3300013308 Ga0157375_10212313 Ga0157375_102123135 86
10 3300025972 Ga0207668_10351737 Ga0207668_103517372 86
11 3300026095 Ga0207676_10232869 Ga0207676_102328692 86
12 iso_pu_bacteria 2582581298 2585225447 89
13 iso_pu_bacteria 2585427529 2585548278 89
14 iso_pu_bacteria 2643221634 2644191028 89
15 iso_pu_bacteria 2818991461 2819685246 89
16 iso_pu_bacteria 2996336353 2996336419 89
17 3300031728 Ga0316578_10484253 Ga0316578_104842532 91
18 3300006048 Ga0075363_100426544 Ga0075363_1004265442 92
19 3300046507 Ga0495606_0285093 Ga0495606_0285093_14_295 92
20 3300046512 Ga0495610_0000618 Ga0495610_0000618_33644_33925 92
21 3300046515 Ga0495620_0077666 Ga0495620_0077666_29_310 92
22 3300046522 Ga0495643_0175119 Ga0495643_0175119_19_300 92
23 3300047472 Ga0495686_0014563 Ga0495686_0014563_1701_1982 92
24 3300050490 nmdc:mga03n38_367224_c1 nmdc:mga03n38_367224_c1_336_617 92
25 3300053125 Ga0500618_008896 Ga0500618_008896_146_427 92
26 3300001915 JGI24741J21665_1002788 JGI24741J21665_10027886 93
27 3300001979 JGI24740J21852_10089463 JGI24740J21852_100894632 93
28 3300002773 JGI25152J39213_1010722 JGI25152J39213_10107223 93
29 3300002774 JGI25150J39212_1026389 JGI25150J39212_10263892 93
30 3300003187 JGI25151J46595_10018792 JGI25151J46595_100187923 93
31 3300003215 JGI25153J46596_10026138 JGI25153J46596_100261383 93
32 3300003316 rootH1_10107700 rootH1_101077002 93
33 3300003578 Ga0006562J51391_1092627 Ga0006562J51391_10926271 93
34 3300003761 Ga0055535_1000419 Ga0055535_10004192 93
35 3300003762 Ga0055542_1000639 Ga0055542_100063939 93
36 3300005329 Ga0070683_100723409 Ga0070683_1007234092 93
37 3300005330 Ga0070690_100083697 Ga0070690_1000836972 93
38 3300005335 Ga0070666_10409436 Ga0070666_104094362 93
39 3300005337 Ga0070682_100091401 Ga0070682_1000914012 93
40 3300005340 Ga0070689_100448186 Ga0070689_1004481862 93
41 3300005341 Ga0070691_10019962 Ga0070691_100199621 93
42 3300005341 Ga0070691_10196188 Ga0070691_101961882 93
43 3300005341 Ga0070691_10313556 Ga0070691_103135562 93
44 3300005344 Ga0070661_100437824 Ga0070661_1004378241 93
45 3300005345 Ga0070692_10511382 Ga0070692_105113822 93
46 3300005366 Ga0070659_100128072 Ga0070659_1001280722 93
47 3300005366 Ga0070659_100603508 Ga0070659_1006035082 93
48 3300005438 Ga0070701_10030150 Ga0070701_100301506 93
49 3300005439 Ga0070711_100826687 Ga0070711_1008266872 93
50 3300005444 Ga0070694_101527831 Ga0070694_1015278311 93
51 3300005455 Ga0070663_101447687 Ga0070663_1014476872 93
52 3300005459 Ga0068867_100130193 Ga0068867_1001301932 93
53 3300005466 Ga0070685_10454373 Ga0070685_104543732 93
54 3300005468 Ga0070707_101457492 Ga0070707_1014574921 93
55 3300005535 Ga0070684_101388062 Ga0070684_1013880622 93
56 3300005539 Ga0068853_100177262 Ga0068853_1001772625 93
57 3300005539 Ga0068853_101778129 Ga0068853_1017781292 93
58 3300005545 Ga0070695_100164645 Ga0070695_1001646452 93
59 3300005546 Ga0070696_100232297 Ga0070696_1002322972 93
60 3300005547 Ga0070693_100028301 Ga0070693_1000283016 93
61 3300005547 Ga0070693_100291543 Ga0070693_1002915433 93
62 3300005564 Ga0070664_100060605 Ga0070664_1000606054 93
63 3300005577 Ga0068857_100233317 Ga0068857_1002333172 93
64 3300005617 Ga0068859_101031238 Ga0068859_1010312381 93
65 3300005718 Ga0068866_10017379 Ga0068866_100173793 93
66 3300005719 Ga0068861_100325171 Ga0068861_1003251713 93
67 3300005834 Ga0068851_10010964 Ga0068851_100109644 93
68 3300005834 Ga0068851_10335880 Ga0068851_103358802 93
69 3300005842 Ga0068858_100550688 Ga0068858_1005506882 93
70 3300005843 Ga0068860_100884955 Ga0068860_1008849552 93
71 3300005844 Ga0068862_100047838 Ga0068862_1000478385 93
72 3300006358 Ga0068871_101225312 Ga0068871_1012253122 93
73 3300006881 Ga0068865_100056654 Ga0068865_1000566543 93
74 3300006931 Ga0097620_101031387 Ga0097620_1010313871 93
75 3300007076 Ga0075435_100532783 Ga0075435_1005327832 93
76 3300009093 Ga0105240_11656089 Ga0105240_116560892 93
77 3300009093 Ga0105240_11866565 Ga0105240_118665652 93
78 3300009101 Ga0105247_11563214 Ga0105247_115632141 93
79 3300009148 Ga0105243_10021699 Ga0105243_100216997 93
80 3300009176 Ga0105242_10025803 Ga0105242_100258035 93
81 3300009177 Ga0105248_10133859 Ga0105248_101338596 93
82 3300009177 Ga0105248_10481170 Ga0105248_104811701 93
83 3300009545 Ga0105237_10741910 Ga0105237_107419102 93
84 3300009551 Ga0105238_10631785 Ga0105238_106317852 93
85 3300009551 Ga0105238_12481709 Ga0105238_124817091 93
86 3300009553 Ga0105249_10263983 Ga0105249_102639831 93
87 3300010375 Ga0105239_11747670 Ga0105239_117476702 93
88 3300011119 Ga0105246_10711748 Ga0105246_107117482 93
89 3300013102 Ga0157371_10458184 Ga0157371_104581842 93
90 3300013104 Ga0157370_10337633 Ga0157370_103376333 93
91 3300013104 Ga0157370_11950608 Ga0157370_119506082 93
92 3300013105 Ga0157369_10245281 Ga0157369_102452814 93
93 3300013105 Ga0157369_12095803 Ga0157369_120958032 93
94 3300013297 Ga0157378_10082883 Ga0157378_100828836 93
95 3300013306 Ga0163162_10844214 Ga0163162_108442143 93
96 3300014326 Ga0157380_10052900 Ga0157380_100529001 93
97 3300014968 Ga0157379_10130945 Ga0157379_101309454 93
98 3300017792 Ga0163161_10852957 Ga0163161_108529572 93
99 3300025228 Ga0209672_100005 Ga0209672_100005756 93
100 3300025242 Ga0209258_100006 Ga0209258_100006756 93
101 3300025245 Ga0207425_1006901 Ga0207425_10069013 93
102 3300025254 Ga0209148_1000012 Ga0209148_1000012756 93
103 3300025258 Ga0209129_1003991 Ga0209129_10039914 93
104 3300025272 Ga0209455_1000008 Ga0209455_1000008756 93
105 3300025294 Ga0209025_1016040 Ga0209025_10160405 93
106 3300025297 Ga0209758_1004992 Ga0209758_10049922 93
107 3300025321 Ga0207656_10101366 Ga0207656_101013662 93
108 3300025321 Ga0207656_10126533 Ga0207656_101265332 93
109 3300025899 Ga0207642_10439431 Ga0207642_104394311 93
110 3300025903 Ga0207680_10560147 Ga0207680_105601472 93
111 3300025904 Ga0207647_10054066 Ga0207647_100540662 93
112 3300025908 Ga0207643_10009709 Ga0207643_100097097 93
113 3300025909 Ga0207705_10028202 Ga0207705_100282023 93
114 3300025912 Ga0207707_10000694 Ga0207707_100006945 93
115 3300025913 Ga0207695_10111499 Ga0207695_101114993 93
116 3300025917 Ga0207660_10200278 Ga0207660_102002782 93
117 3300025918 Ga0207662_10145846 Ga0207662_101458461 93
118 3300025919 Ga0207657_10579930 Ga0207657_105799302 93
119 3300025920 Ga0207649_10823764 Ga0207649_108237642 93
120 3300025921 Ga0207652_10489032 Ga0207652_104890323 93
121 3300025922 Ga0207646_11664503 Ga0207646_116645031 93
122 3300025932 Ga0207690_10125093 Ga0207690_101250932 93
123 3300025935 Ga0207709_10585604 Ga0207709_105856042 93
124 3300025937 Ga0207669_10563185 Ga0207669_105631852 93
125 3300025938 Ga0207704_10174140 Ga0207704_101741401 93
126 3300025941 Ga0207711_11003014 Ga0207711_110030141 93
127 3300025942 Ga0207689_10006101 Ga0207689_100061012 93
128 3300025949 Ga0207667_10115837 Ga0207667_101158374 93
129 3300025981 Ga0207640_10159732 Ga0207640_101597321 93
130 3300026035 Ga0207703_10371392 Ga0207703_103713923 93
131 3300026067 Ga0207678_10845160 Ga0207678_108451602 93
132 3300026067 Ga0207678_11650733 Ga0207678_116507331 93
133 3300026075 Ga0207708_10332073 Ga0207708_103320733 93
134 3300026078 Ga0207702_10908989 Ga0207702_109089892 93
135 3300026089 Ga0207648_10004017 Ga0207648_1000401712 93
136 3300026116 Ga0207674_10003063 Ga0207674_1000306320 93
137 3300026116 Ga0207674_10013900 Ga0207674_100139006 93
138 3300028380 Ga0268265_10076166 Ga0268265_100761663 93
139 3300028381 Ga0268264_10156371 Ga0268264_101563711 93
140 3300028800 Ga0265338_10327728 Ga0265338_103277282 93
141 3300031665 Ga0316575_10003770 Ga0316575_100037705 93
142 3300031665 Ga0316575_10039883 Ga0316575_100398832 93
143 3300031691 Ga0316579_10001301 Ga0316579_100013013 93
144 3300031691 Ga0316579_10624883 Ga0316579_106248831 93
145 3300031727 Ga0316576_10001613 Ga0316576_100016139 93
146 3300031727 Ga0316576_11197704 Ga0316576_111977041 93
147 3300031727 Ga0316576_11339212 Ga0316576_113392122 93
148 3300031728 Ga0316578_10009966 Ga0316578_100099667 93
149 3300031730 Ga0307516_10632292 Ga0307516_106322921 93
150 3300031733 Ga0316577_10001890 Ga0316577_100018907 93
151 3300031733 Ga0316577_10411095 Ga0316577_104110952 93
152 3300031824 Ga0307413_11078939 Ga0307413_110789392 93
153 3300031911 Ga0307412_10001915 Ga0307412_1000191515 93
154 3300032002 Ga0307416_100162205 Ga0307416_1001622052 93
155 3300032004 Ga0307414_10853274 Ga0307414_108532742 93
156 3300032126 Ga0307415_100364592 Ga0307415_1003645923 93
157 3300032133 Ga0316583_10132827 Ga0316583_101328272 93
158 3300032133 Ga0316583_10154584 Ga0316583_101545842 93
159 3300032137 Ga0316585_10000147 Ga0316585_100001477 93
160 3300032139 Ga0316580_10000203 Ga0316580_100002037 93
161 3300035398 Ga0316574_0001773 Ga0316574_0001773_2503_2784 93
162 3300035398 Ga0316574_0349607 Ga0316574_0349607_173_454 93
163 3300036401 Ga0373937_1234392 Ga0373937_1234392_269_550 93
164 3300036647 Ga0316582_0001193 Ga0316582_0001193_3730_4011 93
165 3300036712 Ga0316584_0002526 Ga0316584_0002526_7661_7942 93
166 3300037588 Ga0316581_0133887 Ga0316581_0133887_248_529 93
167 3300039437 Ga0436365_1620355 Ga0436365_1620355_1246_1527 93
168 3300041413 Ga0439465_0005824 Ga0439465_0005824_3408_3692 93
169 3300041451 Ga0451791_0233200 Ga0451791_0233200_155_436 93
170 3300041453 Ga0451797_0287777 Ga0451797_0287777_98_379 93
171 3300041459 Ga0451800_0764704 Ga0451800_0764704_227_508 93
172 3300041494 Ga0451837_1412251 Ga0451837_1412251_63_344 93
173 3300042004 Ga0439445_0035800 Ga0439445_0035800_861_1142 93
174 3300042125 Ga0450923_121401 Ga0450923_121401_236_517 93
175 3300042876 Ga0451577_0083566 Ga0451577_0083566_430_744 93
176 3300042876 Ga0451577_0339457 Ga0451577_0339457_982_1263 93
177 3300042876 Ga0451577_0609266 Ga0451577_0609266_408_722 93
178 3300044673 Ga0453683_0141362 Ga0453683_0141362_630_911 93
179 3300044673 Ga0453683_1060513 Ga0453683_1060513_89_403 93
180 3300044712 Ga0453684_0027966 Ga0453684_0027966_5926_6240 93
181 3300044712 Ga0453684_0133937 Ga0453684_0133937_1645_1926 93
182 3300044712 Ga0453684_1436143 Ga0453684_1436143_313_594 93
183 3300045051 Ga0451576_0007601 Ga0451576_0007601_2162_2443 93
184 3300045976 Ga0466967_0492092 Ga0466967_0492092_142_435 93
185 3300046492 Ga0495585_0034889 Ga0495585_0034889_11_295 93
186 3300046512 Ga0495610_0051676 Ga0495610_0051676_1144_1428 93
187 3300046519 Ga0495632_0064331 Ga0495632_0064331_776_1060 93
188 3300046519 Ga0495632_0210210 Ga0495632_0210210_197_481 93
189 3300046616 Ga0495668_0770935 Ga0495668_0770935_21_305 93
190 3300046660 Ga0495625_0122969 Ga0495625_0122969_988_1272 93
191 3300046665 Ga0495661_0477423 Ga0495661_0477423_234_518 93
192 3300046674 Ga0495588_0066513 Ga0495588_0066513_1348_1632 93
193 3300046691 Ga0495670_0430100 Ga0495670_0430100_363_647 93
194 3300047470 Ga0495681_0055251 Ga0495681_0055251_753_1037 93
195 3300047472 Ga0495686_0373636 Ga0495686_0373636_105_389 93
196 3300048919 Ga0496116_0249934 Ga0496116_0249934_415_699 93
197 3300048922 Ga0496119_0277738 Ga0496119_0277738_490_774 93
198 3300048924 Ga0496121_0128792 Ga0496121_0128792_345_629 93
199 3300048925 Ga0496122_0172469 Ga0496122_0172469_832_1116 93
200 3300048925 Ga0496122_0220357 Ga0496122_0220357_461_745 93
201 3300048926 Ga0496123_0113947 Ga0496123_0113947_493_777 93
202 3300049570 Ga0501033_0002258 Ga0501033_0002258_7299_7580 93
203 3300049570 Ga0501033_0465941 Ga0501033_0465941_244_525 93
204 3300049571 Ga0501034_0003074 Ga0501034_0003074_3536_3817 93
205 3300049571 Ga0501034_0069399 Ga0501034_0069399_1728_2009 93
206 3300049571 Ga0501034_0259560 Ga0501034_0259560_679_963 93
207 3300049571 Ga0501034_0310009 Ga0501034_0310009_587_868 93
208 3300049572 Ga0501036_0372514 Ga0501036_0372514_150_431 93
209 3300049573 Ga0501037_0131431 Ga0501037_0131431_287_571 93
210 3300049573 Ga0501037_0756217 Ga0501037_0756217_249_530 93
211 3300049574 Ga0501038_0665175 Ga0501038_0665175_407_691 93
212 3300049575 Ga0501039_0026277 Ga0501039_0026277_3376_3657 93
213 3300049579 Ga0501043_0230859 Ga0501043_0230859_276_557 93
214 3300049580 Ga0501046_0092347 Ga0501046_0092347_2029_2310 93
215 3300049581 Ga0501047_0001606 Ga0501047_0001606_794_1075 93
216 3300049581 Ga0501047_0182388 Ga0501047_0182388_822_1103 93
217 3300049581 Ga0501047_0448241 Ga0501047_0448241_590_871 93
218 3300049581 Ga0501047_0487593 Ga0501047_0487593_56_337 93
219 3300049583 Ga0501067_0573711 Ga0501067_0573711_10_291 93
220 3300049584 Ga0501068_0461668 Ga0501068_0461668_233_514 93
221 3300049586 Ga0501070_0011696 Ga0501070_0011696_2974_3255 93
222 3300049589 Ga0501073_0062820 Ga0501073_0062820_486_767 93
223 3300049589 Ga0501073_0580476 Ga0501073_0580476_302_583 93
224 3300049590 Ga0501074_0031424 Ga0501074_0031424_256_537 93
225 3300049649 Ga0501198_055880 Ga0501198_055880_285_566 93
226 3300049741 Ga0501079_0139973 Ga0501079_0139973_76_357 93
227 3300049742 Ga0501080_0010014 Ga0501080_0010014_3521_3802 93
228 3300049742 Ga0501080_0182701 Ga0501080_0182701_561_842 93
229 3300049742 Ga0501080_0625278 Ga0501080_0625278_478_762 93
230 3300049822 Ga0501035_0111870 Ga0501035_0111870_1230_1511 93
231 3300049822 Ga0501035_0395654 Ga0501035_0395654_369_650 93
232 3300049822 Ga0501035_0466401 Ga0501035_0466401_211_492 93
233 3300049822 Ga0501035_0983406 Ga0501035_0983406_38_319 93
234 3300049823 Ga0501044_0177651 Ga0501044_0177651_902_1183 93
235 3300049823 Ga0501044_0201698 Ga0501044_0201698_359_640 93
236 3300049823 Ga0501044_0277518 Ga0501044_0277518_610_894 93
237 3300050512 nmdc:mga0n895_1678561_c1 nmdc:mga0n895_1678561_c1_183_464 93
238 3300053088 Ga0500644_0105972 Ga0500644_0105972_401_682 93
239 3300053090 Ga0500646_0078453 Ga0500646_0078453_311_592 93
240 3300053108 Ga0500562_002935 Ga0500562_002935_15_296 93
241 3300053131 Ga0500652_210723 Ga0500652_210723_320_601 93
242 3300053133 Ga0500655_061185 Ga0500655_061185_270_554 93
243 3300053156 Ga0500622_0115704 Ga0500622_0115704_577_858 93
244 3300053156 Ga0500622_0312331 Ga0500622_0312331_231_512 93
245 3300053158 Ga0500627_0244741 Ga0500627_0244741_354_635 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

3

91

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9078 1 92
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.9073 1 93
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9059 1 93
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9057 1 93
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.8987 1 92
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.905 1 93 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8872 1 93 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8859 5 91 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8499 5 91 3.30.2310.20
af_Q5RHH4_186_376_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7102 53 91 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2W4R4H1-F1-model_v4 Plasmid maintenance system killer protein 1.002 1 93
AF-A0A084ENV9-F1-model_v4 HigB toxin protein 1.002 1 90
AF-A0A1H1C7Y0-F1-model_v4 Proteic killer suppression protein 1.001 1 93
AF-A0A850BW79-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 1.001 1 93
AF-A0A0R2DDU7-F1-model_v4 Plasmid maintenance system killer protein 1.001 1 93

Feature Viewer

pLDDT pTM Quality
94.71 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map