F357540

General Info

Members Datasets Scaffolds Average Seq Length
245 175 490 217

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0041644|Ga0395905_0041644_2287_2967
Length 226
Sequence MPLPESKMRRLISGVFQSLDGVMQAPGGPTEDWTQGFTLGGWSATLWDDAMGQAIGGLFSQPFDLLLGRKTYEIFAAHWPYVGPDDPIGQAFDHCRKYVLTRGEEQLDWINSQRLAGIADVAALKQTDGPDLLIQGSSTLYPQLLAADLIDRLFVMTFPVVLGRGKRLFGEGTPSSAWRLVDHQVSTTGVMIATYEPAGAVPIGSFQMQEPSEAEQRRQERMKREG

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
70 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
121 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
122 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
123 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
124 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
125 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
126 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
139 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
158 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
159 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
160 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
161 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
162 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
166 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
169 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
170 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
175 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.96
Nodule 0
Rhizoplane 1.63
Rhizosphere 76.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0041644 3300037471 Bacteria 4310
2 JGI24739J22299_10001313 3300001989 Bacteria 9327
3 JGI24737J22298_10000087 3300001990 Bacteria 27343
4 JGI24737J22298_10006419 3300001990 Bacteria 4018
5 JGI24735J21928_10004769 3300002067 Bacteria 4525
6 JGI24735J21928_10005036 3300002067 Bacteria 4397
7 JGI24735J21928_10032148 3300002067 Bacteria 1553
8 JGI24735J21928_10036968 3300002067 Bacteria 1432
9 JGI24735J21928_10042443 3300002067 Bacteria 1324
10 JGI24738J21930_10001022 3300002075 Bacteria 7987
11 JGI24738J21930_10001128 3300002075 Bacteria 7551
12 JGI24744J21845_10000104 3300002077 Bacteria 11338
13 rootH1_10116888 3300003323 Bacteria 4036
14 JGI25160J50197_1012367 3300003354 Bacteria 2965
15 Ga0055526_1013510 3300003771 Bacteria 3445
16 Ga0055537_1001707 3300003773 Bacteria 8124
17 Ga0055524_1000226 3300003775 Bacteria 59950
18 Ga0055528_1002138 3300003790 Bacteria 10887
19 Ga0055530_10009220 3300003791 Bacteria 3827
20 Ga0055531_10007478 3300003794 Bacteria 5953
21 Ga0055543_1012831 3300004625 Bacteria 1672
22 Ga0065165_1000525 3300005262 Bacteria 58607
23 Ga0065165_1020728 3300005262 Bacteria 2304
24 Ga0065165_1060343 3300005262 Bacteria 1041
25 Ga0070658_10000815 3300005327 Bacteria 26642
26 Ga0070658_10003481 3300005327 Bacteria 12932
27 Ga0070658_10116428 3300005327 Bacteria 2218
28 Ga0070676_10004001 3300005328 Bacteria 7734
29 Ga0068869_100005963 3300005334 Bacteria 7705
30 Ga0068868_100000201 3300005338 Bacteria 40113
31 Ga0070660_100106990 3300005339 Bacteria 2222
32 Ga0070675_100047742 3300005354 Bacteria 3509
33 Ga0070671_100021835 3300005355 Bacteria 5228
34 Ga0070673_100000015 3300005364 Bacteria 118064
35 Ga0070659_100109825 3300005366 Bacteria 2226
36 Ga0070659_100240852 3300005366 Bacteria 1497
37 Ga0070659_100241336 3300005366 Bacteria 1495
38 Ga0070663_100000668 3300005455 Bacteria 18445
39 Ga0070663_100021058 3300005455 Bacteria 4329
40 Ga0070662_100008425 3300005457 Bacteria 6721
41 Ga0070662_100171541 3300005457 Bacteria 1704
42 Ga0068867_100000236 3300005459 Bacteria 36247
43 Ga0070706_100804322 3300005467 Bacteria 870
44 Ga0070707_100966255 3300005468 Bacteria 817
45 Ga0070679_100202823 3300005530 Bacteria 1948
46 Ga0068853_100024318 3300005539 Bacteria 5078
47 Ga0068853_100035402 3300005539 Bacteria 4241
48 Ga0068853_100214383 3300005539 Bacteria 1756
49 Ga0070672_100031388 3300005543 Bacteria 3998
50 Ga0070672_100177226 3300005543 Bacteria 1775
51 Ga0068855_100005189 3300005563 Bacteria 15889
52 Ga0068855_100218212 3300005563 Bacteria 2140
53 Ga0068857_100117703 3300005577 Bacteria 2391
54 Ga0068854_100000118 3300005578 Bacteria 54862
55 Ga0068856_100002333 3300005614 Bacteria 19522
56 Ga0068856_100041261 3300005614 Bacteria 4534
57 Ga0068852_100000052 3300005616 Bacteria 80329
58 Ga0068852_100252598 3300005616 Bacteria 1690
59 Ga0068859_100205555 3300005617 Bacteria 2054
60 Ga0068851_10107380 3300005834 Bacteria 1487
61 Ga0068858_100000318 3300005842 Bacteria 51170
62 Ga0068860_100384684 3300005843 Bacteria 1385
63 Ga0075362_10306248 3300006177 Bacteria 789
64 Ga0075366_10263460 3300006195 Bacteria 1052
65 Ga0097621_100015294 3300006237 Bacteria 5771
66 Ga0075370_10121444 3300006353 Bacteria 1521
67 Ga0075370_10192507 3300006353 Bacteria 1202
68 Ga0068871_100006602 3300006358 Bacteria 8226
69 Ga0068865_100001212 3300006881 Bacteria 15028
70 Ga0068865_100147099 3300006881 Bacteria 1783
71 Ga0097620_100205572 3300006931 Bacteria 2054
72 Ga0105240_10016005 3300009093 Bacteria 10166
73 Ga0105245_10011115 3300009098 Bacteria 7836
74 Ga0105243_10000445 3300009148 Bacteria 43080
75 Ga0105241_10089416 3300009174 Bacteria 2426
76 Ga0105241_11076171 3300009174 Bacteria 756
77 Ga0105242_10008694 3300009176 Bacteria 7790
78 Ga0105248_10025328 3300009177 Bacteria 6596
79 Ga0105249_10009401 3300009553 Bacteria 8554
80 Ga0099796_10028850 3300010159 Bacteria 1785
81 Ga0105239_10073724 3300010375 Bacteria 3753
82 Ga0105239_10146013 3300010375 Bacteria 2638
83 Ga0105246_10004240 3300011119 Bacteria 8718
84 Ga0157373_10003714 3300013100 Bacteria 11553
85 Ga0157371_10094959 3300013102 Bacteria 2113
86 Ga0157369_10444860 3300013105 Bacteria 1342
87 Ga0157374_10005712 3300013296 Bacteria 10496
88 Ga0157374_10006198 3300013296 Bacteria 10136
89 Ga0157378_10000394 3300013297 Bacteria 43079
90 Ga0163162_10035494 3300013306 Bacteria 4967
91 Ga0163162_10265099 3300013306 Bacteria 1849
92 Ga0157372_10013070 3300013307 Bacteria 8856
93 Ga0157372_10097695 3300013307 Bacteria 3350
94 Ga0157372_10167549 3300013307 Bacteria 2541
95 Ga0157372_10278079 3300013307 Bacteria 1946
96 Ga0157372_10532082 3300013307 Bacteria 1370
97 Ga0157375_10004676 3300013308 Bacteria 11907
98 Ga0157376_10000078 3300014969 Bacteria 72879
99 Ga0207425_1009889 3300025245 Bacteria 2348
100 Ga0209148_1000146 3300025254 Bacteria 160734
101 Ga0209565_1000007 3300025263 Bacteria 784361
102 Ga0209455_1026098 3300025272 Bacteria 1052
103 Ga0209673_1000014 3300025273 Bacteria 537082
104 Ga0209673_1000018 3300025273 Bacteria 458281
105 Ga0209673_1001068 3300025273 Bacteria 31210
106 Ga0209564_1013537 3300025295 Bacteria 3454
107 Ga0209564_1016455 3300025295 Bacteria 2942
108 Ga0209758_1004820 3300025297 Bacteria 10891
109 Ga0209758_1010407 3300025297 Bacteria 5570
110 Ga0209050_1000481 3300025298 Bacteria 70155
111 Ga0209050_1006920 3300025298 Bacteria 6552
112 Ga0209256_1000008 3300025299 Bacteria 975723
113 Ga0207426_1002884 3300025302 Bacteria 10177
114 Ga0209257_1002047 3300025304 Bacteria 21436
115 Ga0207642_10332459 3300025899 Bacteria 891
116 Ga0207647_10000604 3300025904 Bacteria 27991
117 Ga0207647_10003389 3300025904 Bacteria 11949
118 Ga0207647_10019991 3300025904 Bacteria 4495
119 Ga0207645_10006551 3300025907 Bacteria 8336
120 Ga0207705_10000025 3300025909 Bacteria 259826
121 Ga0207705_10000756 3300025909 Bacteria 26658
122 Ga0207684_10719935 3300025910 Bacteria 847
123 Ga0207695_10005706 3300025913 Bacteria 16411
124 Ga0207657_10003967 3300025919 Bacteria 15717
125 Ga0207657_10142299 3300025919 Bacteria 1959
126 Ga0207657_10214510 3300025919 Bacteria 1543
127 Ga0207652_10057198 3300025921 Bacteria 3358
128 Ga0207646_10132513 3300025922 Bacteria 2244
129 Ga0207659_10011485 3300025926 Bacteria 5596
130 Ga0207644_10393638 3300025931 Bacteria 1131
131 Ga0207690_10048978 3300025932 Bacteria 2814
132 Ga0207690_10054178 3300025932 Bacteria 2695
133 Ga0207690_10139641 3300025932 Bacteria 1784
134 Ga0207706_10001626 3300025933 Bacteria 22272
135 Ga0207706_10109312 3300025933 Bacteria 2433
136 Ga0207706_10244280 3300025933 Bacteria 1569
137 Ga0207686_10004020 3300025934 Bacteria 7890
138 Ga0207709_10000118 3300025935 Bacteria 122125
139 Ga0207704_10000027 3300025938 Bacteria 122372
140 Ga0207691_10033022 3300025940 Bacteria 4821
141 Ga0207691_10183853 3300025940 Bacteria 1825
142 Ga0207711_10012992 3300025941 Bacteria 6918
143 Ga0207689_10011327 3300025942 Bacteria 7650
144 Ga0207689_10607484 3300025942 Bacteria 920
145 Ga0207667_10000035 3300025949 Bacteria 301056
146 Ga0207651_10000016 3300025960 Bacteria 122094
147 Ga0207712_10005023 3300025961 Bacteria 8369
148 Ga0207640_10000085 3300025981 Bacteria 73838
149 Ga0207677_10000573 3300026023 Bacteria 22918
150 Ga0207703_10004368 3300026035 Bacteria 11617
151 Ga0207639_10035163 3300026041 Bacteria 3707
152 Ga0207639_10041164 3300026041 Bacteria 3455
153 Ga0207639_10076428 3300026041 Bacteria 2637
154 Ga0207678_10001976 3300026067 Bacteria 18682
155 Ga0207678_10135572 3300026067 Bacteria 2100
156 Ga0207678_10354253 3300026067 Bacteria 1266
157 Ga0207702_10003111 3300026078 Bacteria 15373
158 Ga0207702_10046485 3300026078 Bacteria 3654
159 Ga0207702_10725874 3300026078 Bacteria 980
160 Ga0207648_10000482 3300026089 Bacteria 44351
161 Ga0207676_10772431 3300026095 Bacteria 936
162 Ga0207674_10033823 3300026116 Bacteria 5348
163 Ga0207683_10002831 3300026121 Bacteria 15159
164 Ga0207698_10000198 3300026142 Bacteria 37741
165 Ga0207698_10377822 3300026142 Bacteria 1347
166 Ga0268264_10302001 3300028381 Bacteria 1507
167 Ga0265338_10485594 3300028800 Bacteria 871
168 Ga0307508_10000550 3300031616 Bacteria 44447
169 Ga0373937_0064678 3300036401 Bacteria 3365
170 Ga0395900_0155924 3300037418 Bacteria 2332
171 Ga0395900_0454853 3300037418 Bacteria 1236
172 Ga0395905_0108495 3300037471 Bacteria 2606
173 Ga0395905_0603537 3300037471 Bacteria 999
174 Ga0395901_0020753 3300038443 Bacteria 6726
175 Ga0436363_0307925 3300039450 Bacteria 1537
176 Ga0439436_0015108 3300041404 Bacteria 2323
177 Ga0439436_0018976 3300041404 Bacteria 2055
178 Ga0439439_0054186 3300041406 Bacteria 1056
179 Ga0439439_0068946 3300041406 Bacteria 945
180 Ga0439461_0000038 3300041410 Bacteria 16271
181 Ga0439466_0105330 3300041411 Bacteria 877
182 Ga0439465_0001731 3300041413 Bacteria 7139
183 Ga0439465_0056611 3300041413 Bacteria 1292
184 Ga0451793_0822967 3300041452 Bacteria 1771
185 Ga0451802_0050544 3300041460 Bacteria 2552
186 Ga0451807_0413610 3300041486 Bacteria 2848
187 Ga0439431_0000211 3300041997 Bacteria 11608
188 Ga0439442_000819 3300042002 Bacteria 6438
189 Ga0439445_0024896 3300042004 Bacteria 1524
190 Ga0439445_0049497 3300042004 Bacteria 1132
191 Ga0439448_0002944 3300042005 Bacteria 4673
192 Ga0439448_0005395 3300042005 Bacteria 3644
193 Ga0439432_000877 3300042006 Bacteria 11269
194 Ga0439450_037327 3300042008 Bacteria 1116
195 Ga0439452_036650 3300042010 Bacteria 1174
196 Ga0439455_0000361 3300042012 Bacteria 5911
197 Ga0439455_0001231 3300042012 Bacteria 4190
198 Ga0439455_0003075 3300042012 Bacteria 3136
199 Ga0439462_0003378 3300042015 Bacteria 3827
200 Ga0439462_0011114 3300042015 Bacteria 2288
201 Ga0439446_0015138 3300042156 Bacteria 2137
202 Ga0439458_0000415 3300042157 Bacteria 10732
203 Ga0439458_0000568 3300042157 Bacteria 9503
204 Ga0439434_0002786 3300042435 Bacteria 5098
205 Ga0466972_0001273 3300044658 Bacteria 12167
206 Ga0466965_0106033 3300044683 Bacteria 1441
207 Ga0466966_0009843 3300044684 Bacteria 6337
208 Ga0466961_0027839 3300044693 Bacteria 3634
209 Ga0466964_0002598 3300044706 Bacteria 6449
210 Ga0466968_0021573 3300044735 Bacteria 2609
211 Ga0466970_0004885 3300044765 Bacteria 6620
212 Ga0466960_0001185 3300044901 Bacteria 9393
213 Ga0466959_0017484 3300045049 Bacteria 5256
214 Ga0466958_0084236 3300045836 Bacteria 1960
215 Ga0466958_0210151 3300045836 Bacteria 1240
216 Ga0495638_0002975 3300046460 Bacteria 13525
217 Ga0495641_0236508 3300046461 Bacteria 820
218 Ga0495625_0001098 3300046660 Bacteria 35115
219 Ga0495649_0026356 3300046694 Bacteria 3233
220 Ga0495687_042422 3300047443 Bacteria 1988
221 Ga0495686_0013725 3300047472 Bacteria 5613
222 Ga0496100_0410185 3300048903 Bacteria 1033
223 Ga0496117_0140505 3300048920 Bacteria 1447
224 Ga0496118_0036599 3300048921 Bacteria 3964
225 Ga0496120_0040389 3300048923 Bacteria 2742
226 Ga0496121_0009365 3300048924 Bacteria 11280
227 Ga0496122_0029814 3300048925 Bacteria 4589
228 Ga0496123_0101299 3300048926 Bacteria 1674
229 Ga0501035_0355702 3300049822 Bacteria 1225
230 Ga0501044_0080147 3300049823 Bacteria 3307
231 nmdc:mga07m45_178091_c1 3300050496 Bacteria 1236
232 nmdc:mga07m45_20988_c1 3300050496 Bacteria 3552
233 nmdc:mga0sz30_354471_c1 3300050516 Bacteria 656
234 Ga0500643_010345 3300053087 Bacteria 3480
235 Ga0500643_081307 3300053087 Bacteria 889
236 Ga0500651_0331507 3300053093 Bacteria 867
237 Ga0500556_0104594 3300053104 Bacteria 1093
238 Ga0500595_000700 3300053119 Bacteria 20020
239 Ga0500658_0006669 3300053134 Bacteria 4278
240 Ga0500658_0008330 3300053134 Bacteria 3832
241 Ga0500658_0051426 3300053134 Bacteria 1684
242 Ga0500559_0073774 3300053136 Bacteria 1540
243 Ga0500645_002595 3300053730 Bacteria 7942
244 2644125695 2643221622 Bacteria 4212502
245 8057105550 8057101203 Bacteria 5034064
246 Ga0395905_0041644
247 JGI24739J22299_10001313
248 JGI24737J22298_10000087
249 JGI24737J22298_10006419
250 JGI24735J21928_10004769
251 JGI24735J21928_10005036
252 JGI24735J21928_10032148
253 JGI24735J21928_10036968
254 JGI24735J21928_10042443
255 JGI24738J21930_10001022
256 JGI24738J21930_10001128
257 JGI24744J21845_10000104
258 rootH1_10116888
259 JGI25160J50197_1012367
260 Ga0055526_1013510
261 Ga0055537_1001707
262 Ga0055524_1000226
263 Ga0055528_1002138
264 Ga0055530_10009220
265 Ga0055531_10007478
266 Ga0055543_1012831
267 Ga0065165_1000525
268 Ga0065165_1020728
269 Ga0065165_1060343
270 Ga0070658_10000815
271 Ga0070658_10003481
272 Ga0070658_10116428
273 Ga0070676_10004001
274 Ga0068869_100005963
275 Ga0068868_100000201
276 Ga0070660_100106990
277 Ga0070675_100047742
278 Ga0070671_100021835
279 Ga0070673_100000015
280 Ga0070659_100109825
281 Ga0070659_100240852
282 Ga0070659_100241336
283 Ga0070663_100000668
284 Ga0070663_100021058
285 Ga0070662_100008425
286 Ga0070662_100171541
287 Ga0068867_100000236
288 Ga0070706_100804322
289 Ga0070707_100966255
290 Ga0070679_100202823
291 Ga0068853_100024318
292 Ga0068853_100035402
293 Ga0068853_100214383
294 Ga0070672_100031388
295 Ga0070672_100177226
296 Ga0068855_100005189
297 Ga0068855_100218212
298 Ga0068857_100117703
299 Ga0068854_100000118
300 Ga0068856_100002333
301 Ga0068856_100041261
302 Ga0068852_100000052
303 Ga0068852_100252598
304 Ga0068859_100205555
305 Ga0068851_10107380
306 Ga0068858_100000318
307 Ga0068860_100384684
308 Ga0075362_10306248
309 Ga0075366_10263460
310 Ga0097621_100015294
311 Ga0075370_10121444
312 Ga0075370_10192507
313 Ga0068871_100006602
314 Ga0068865_100001212
315 Ga0068865_100147099
316 Ga0097620_100205572
317 Ga0105240_10016005
318 Ga0105245_10011115
319 Ga0105243_10000445
320 Ga0105241_10089416
321 Ga0105241_11076171
322 Ga0105242_10008694
323 Ga0105248_10025328
324 Ga0105249_10009401
325 Ga0099796_10028850
326 Ga0105239_10073724
327 Ga0105239_10146013
328 Ga0105246_10004240
329 Ga0157373_10003714
330 Ga0157371_10094959
331 Ga0157369_10444860
332 Ga0157374_10005712
333 Ga0157374_10006198
334 Ga0157378_10000394
335 Ga0163162_10035494
336 Ga0163162_10265099
337 Ga0157372_10013070
338 Ga0157372_10097695
339 Ga0157372_10167549
340 Ga0157372_10278079
341 Ga0157372_10532082
342 Ga0157375_10004676
343 Ga0157376_10000078
344 Ga0207425_1009889
345 Ga0209148_1000146
346 Ga0209565_1000007
347 Ga0209455_1026098
348 Ga0209673_1000014
349 Ga0209673_1000018
350 Ga0209673_1001068
351 Ga0209564_1013537
352 Ga0209564_1016455
353 Ga0209758_1004820
354 Ga0209758_1010407
355 Ga0209050_1000481
356 Ga0209050_1006920
357 Ga0209256_1000008
358 Ga0207426_1002884
359 Ga0209257_1002047
360 Ga0207642_10332459
361 Ga0207647_10000604
362 Ga0207647_10003389
363 Ga0207647_10019991
364 Ga0207645_10006551
365 Ga0207705_10000025
366 Ga0207705_10000756
367 Ga0207684_10719935
368 Ga0207695_10005706
369 Ga0207657_10003967
370 Ga0207657_10142299
371 Ga0207657_10214510
372 Ga0207652_10057198
373 Ga0207646_10132513
374 Ga0207659_10011485
375 Ga0207644_10393638
376 Ga0207690_10048978
377 Ga0207690_10054178
378 Ga0207690_10139641
379 Ga0207706_10001626
380 Ga0207706_10109312
381 Ga0207706_10244280
382 Ga0207686_10004020
383 Ga0207709_10000118
384 Ga0207704_10000027
385 Ga0207691_10033022
386 Ga0207691_10183853
387 Ga0207711_10012992
388 Ga0207689_10011327
389 Ga0207689_10607484
390 Ga0207667_10000035
391 Ga0207651_10000016
392 Ga0207712_10005023
393 Ga0207640_10000085
394 Ga0207677_10000573
395 Ga0207703_10004368
396 Ga0207639_10035163
397 Ga0207639_10041164
398 Ga0207639_10076428
399 Ga0207678_10001976
400 Ga0207678_10135572
401 Ga0207678_10354253
402 Ga0207702_10003111
403 Ga0207702_10046485
404 Ga0207702_10725874
405 Ga0207648_10000482
406 Ga0207676_10772431
407 Ga0207674_10033823
408 Ga0207683_10002831
409 Ga0207698_10000198
410 Ga0207698_10377822
411 Ga0268264_10302001
412 Ga0265338_10485594
413 Ga0307508_10000550
414 Ga0373937_0064678
415 Ga0395900_0155924
416 Ga0395900_0454853
417 Ga0395905_0108495
418 Ga0395905_0603537
419 Ga0395901_0020753
420 Ga0436363_0307925
421 Ga0439436_0015108
422 Ga0439436_0018976
423 Ga0439439_0054186
424 Ga0439439_0068946
425 Ga0439461_0000038
426 Ga0439466_0105330
427 Ga0439465_0001731
428 Ga0439465_0056611
429 Ga0451793_0822967
430 Ga0451802_0050544
431 Ga0451807_0413610
432 Ga0439431_0000211
433 Ga0439442_000819
434 Ga0439445_0024896
435 Ga0439445_0049497
436 Ga0439448_0002944
437 Ga0439448_0005395
438 Ga0439432_000877
439 Ga0439450_037327
440 Ga0439452_036650
441 Ga0439455_0000361
442 Ga0439455_0001231
443 Ga0439455_0003075
444 Ga0439462_0003378
445 Ga0439462_0011114
446 Ga0439446_0015138
447 Ga0439458_0000415
448 Ga0439458_0000568
449 Ga0439434_0002786
450 Ga0466972_0001273
451 Ga0466965_0106033
452 Ga0466966_0009843
453 Ga0466961_0027839
454 Ga0466964_0002598
455 Ga0466968_0021573
456 Ga0466970_0004885
457 Ga0466960_0001185
458 Ga0466959_0017484
459 Ga0466958_0084236
460 Ga0466958_0210151
461 Ga0495638_0002975
462 Ga0495641_0236508
463 Ga0495625_0001098
464 Ga0495649_0026356
465 Ga0495687_042422
466 Ga0495686_0013725
467 Ga0496100_0410185
468 Ga0496117_0140505
469 Ga0496118_0036599
470 Ga0496120_0040389
471 Ga0496121_0009365
472 Ga0496122_0029814
473 Ga0496123_0101299
474 Ga0501035_0355702
475 Ga0501044_0080147
476 nmdc:mga07m45_178091_c1
477 nmdc:mga07m45_20988_c1
478 nmdc:mga0sz30_354471_c1
479 Ga0500643_010345
480 Ga0500643_081307
481 Ga0500651_0331507
482 Ga0500556_0104594
483 Ga0500595_000700
484 Ga0500658_0006669
485 Ga0500658_0008330
486 Ga0500658_0051426
487 Ga0500559_0073774
488 Ga0500645_002595
489 2644125695
490 8057105550

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

9

192

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8129 7 195
3jtw-assembly2.cif.gz_B-3 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8042 7 195
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7942 8 195
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.7861 7 193
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7855 8 195
ID Description Score Start End Superfamily
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8066 7 195 3.40.430.10
3jtwB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.798 7 195 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7784 8 195 3.40.430.10
1vdrA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7784 8 195 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7765 7 192 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A3E1KB80-F1-model_v4 Dihydrofolate reductase 0.9649 6 220 GO:0008703
GO:0009231
AF-A0A4Q3ASH4-F1-model_v4 Dihydrofolate reductase 0.9588 7 223 GO:0008703
GO:0009231
AF-A0A520HNH4-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9556 44 219 GO:0008703
GO:0009231
AF-A0A1H4P4V0-F1-model_v4 Dihydrofolate reductase 0.9513 2 223 GO:0008703
GO:0009231
AF-A0A1W2CR52-F1-model_v4 Dihydrofolate reductase 0.9469 7 203 GO:0008703
GO:0009231
GO:0019684
GO:0030077
GO:0045156

Map