F357751

General Info

Members Datasets Scaffolds Average Seq Length
245 161 490 169

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0000038|Ga0500556_0000038_31579_32211
Length 200
Sequence MIPSERKGLSCWLANLSTEQNDPPLSSRTGKETDMFGISPLGWVHTLGSLPAIPLAICMFARHGRIVPRSRPGAVYFVSMLIGAATVFLVAHQSVSLVAGYGVGRLSGLGRARRYIETVCLSLTAFLLMVPTVTETLRRVPDGHPLVTDLNSPLLLGSQASLLVILIIGVTAQIIHLRRQGKTAASMGPWNRSGHGAGRQ

Samples

Sample ID Description Type Environment
1 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
53 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
122 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
123 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
126 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
127 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
147 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
148 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
149 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
150 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
153 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
154 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
155 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
156 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
157 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
158 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
159 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
160 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
161 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.86
Nodule 0.82
Rhizoplane 2.45
Rhizosphere 59.59
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500556_0000038 3300053104 Bacteria 138208
2 JGI25156J39149_1000320 3300002705 Bacteria 31857
3 JGI25162J39368_1008008 3300002737 Bacteria 1565
4 JGI25154J39366_1000264 3300002738 Bacteria 33263
5 JGI25157J39369_1001452 3300002741 Bacteria 8853
6 JGI25159J45721_1000356 3300002987 Bacteria 21189
7 rootH1_10026225 3300003316 Bacteria 1597
8 rootH2_10138489 3300003320 Bacteria 2468
9 rootL2_10061986 3300003322 Bacteria 1489
10 JGI25161J50226_1000250 3300003374 Bacteria 32181
11 Ga0055538_1001991 3300003751 Bacteria 3322
12 Ga0055539_1004124 3300003752 Bacteria 1957
13 Ga0055532_1000089 3300003758 Bacteria 105631
14 Ga0055532_1000278 3300003758 Bacteria 33197
15 Ga0055535_1002569 3300003761 Bacteria 6119
16 Ga0055526_1002042 3300003771 Bacteria 13892
17 Ga0055537_1001367 3300003773 Bacteria 9810
18 Ga0055524_1000031 3300003775 Bacteria 187744
19 Ga0055524_1001574 3300003775 Bacteria 12815
20 Ga0055534_1006022 3300003784 Bacteria 3130
21 Ga0055534_1052082 3300003784 Bacteria 580
22 Ga0055530_10000500 3300003791 Bacteria 33987
23 Ga0055543_1000273 3300004625 Bacteria 38338
24 Ga0065165_1000902 3300005262 Bacteria 38338
25 Ga0065165_1002936 3300005262 Bacteria 12996
26 Ga0065165_1037709 3300005262 Bacteria 1463
27 Ga0070663_100109987 3300005455 Bacteria 2069
28 Ga0068853_101382880 3300005539 Unclassified 681
29 Ga0070665_100000237 3300005548 Bacteria 91478
30 Ga0070665_100003467 3300005548 Bacteria 16809
31 Ga0070665_100033192 3300005548 Bacteria 5193
32 Ga0068855_100027230 3300005563 Bacteria 6839
33 Ga0068859_100001027 3300005617 Bacteria 28602
34 Ga0068863_100588548 3300005841 Bacteria 1101
35 Ga0068858_100280908 3300005842 Unclassified 1585
36 Ga0068860_100214129 3300005843 Bacteria 1869
37 Ga0068862_100000246 3300005844 Bacteria 60352
38 Ga0068862_100492393 3300005844 Bacteria 1162
39 Ga0075364_10310804 3300006051 Bacteria 1073
40 Ga0097620_100001027 3300006931 Bacteria 28602
41 Ga0105240_10055597 3300009093 Bacteria 4955
42 Ga0105247_10315946 3300009101 Bacteria 1088
43 Ga0105237_10010483 3300009545 Bacteria 9848
44 Ga0105237_10076236 3300009545 Bacteria 3343
45 Ga0105238_10000294 3300009551 Bacteria 55283
46 Ga0105249_10000226 3300009553 Bacteria 64018
47 Ga0105249_10071373 3300009553 Bacteria 3208
48 Ga0105239_10001564 3300010375 Bacteria 30239
49 Ga0105239_10023817 3300010375 Bacteria 6742
50 Ga0105239_10128551 3300010375 Bacteria 2817
51 Ga0105239_10208121 3300010375 Bacteria 2192
52 Ga0105239_10454353 3300010375 Bacteria 1453
53 Ga0105239_12081740 3300010375 Bacteria 659
54 Ga0157373_10037452 3300013100 Bacteria 3476
55 Ga0157374_10655266 3300013296 Bacteria 1062
56 Ga0163162_10034893 3300013306 Bacteria 5008
57 Ga0163162_10445382 3300013306 Bacteria 1427
58 Ga0163163_10208901 3300014325 Bacteria 2001
59 Ga0163163_10222917 3300014325 Bacteria 1934
60 Ga0182008_10000284 3300014497 Bacteria 39712
61 Ga0157379_10067909 3300014968 Bacteria 3187
62 Ga0157379_10078132 3300014968 Bacteria 2964
63 Ga0182007_10108339 3300015262 Bacteria 923
64 Ga0213876_10221011 3300021384 Bacteria 1007
65 Ga0209435_100109 3300025206 Bacteria 32283
66 Ga0209436_100300 3300025208 Bacteria 22899
67 Ga0209784_101385 3300025224 Bacteria 3322
68 Ga0209566_102870 3300025225 Bacteria 2919
69 Ga0209147_100021 3300025229 Bacteria 464719
70 Ga0209147_100060 3300025229 Bacteria 249588
71 Ga0209437_100081 3300025233 Bacteria 271072
72 Ga0209437_100590 3300025233 Bacteria 23064
73 Ga0209258_100141 3300025242 Bacteria 166385
74 Ga0209646_1000101 3300025246 Bacteria 164503
75 Ga0209026_1000264 3300025250 Bacteria 64186
76 Ga0209677_101453 3300025253 Bacteria 10244
77 Ga0209148_1014588 3300025254 Bacteria 1387
78 Ga0209759_1000264 3300025256 Bacteria 75893
79 Ga0209565_1001660 3300025263 Bacteria 9298
80 Ga0209673_1022826 3300025273 Bacteria 2147
81 Ga0209673_1073864 3300025273 Bacteria 802
82 Ga0209130_1000301 3300025284 Bacteria 60251
83 Ga0209675_1001764 3300025291 Bacteria 11849
84 Ga0209675_1008088 3300025291 Bacteria 3923
85 Ga0209564_1000098 3300025295 Bacteria 228906
86 Ga0209564_1000135 3300025295 Bacteria 188117
87 Ga0209050_1000533 3300025298 Bacteria 63043
88 Ga0209050_1006433 3300025298 Bacteria 6957
89 Ga0209256_1000107 3300025299 Bacteria 186233
90 Ga0209256_1000765 3300025299 Bacteria 41750
91 Ga0209051_1069127 3300025303 Bacteria 1072
92 Ga0209257_1000303 3300025304 Bacteria 107862
93 Ga0207685_10528339 3300025905 Bacteria 624
94 Ga0207695_10001257 3300025913 Bacteria 43221
95 Ga0207695_10050976 3300025913 Bacteria 4349
96 Ga0207695_10201767 3300025913 Bacteria 1903
97 Ga0207671_10014753 3300025914 Bacteria 6159
98 Ga0207649_10966114 3300025920 Bacteria 669
99 Ga0207694_10000920 3300025924 Bacteria 26083
100 Ga0207667_10008948 3300025949 Bacteria 11841
101 Ga0207667_10261985 3300025949 Bacteria 1768
102 Ga0207712_10000141 3300025961 Bacteria 75812
103 Ga0207712_10042128 3300025961 Bacteria 3142
104 Ga0207658_10104801 3300025986 Bacteria 2223
105 Ga0207703_10862963 3300026035 Unclassified 866
106 Ga0207639_11277738 3300026041 Bacteria 689
107 Ga0207678_10110460 3300026067 Bacteria 2346
108 Ga0207678_10272701 3300026067 Bacteria 1451
109 Ga0207702_10052790 3300026078 Bacteria 3441
110 Ga0207641_10396535 3300026088 Bacteria 1324
111 Ga0268266_10000001 3300028379 Bacteria 4040580
112 Ga0268266_10074819 3300028379 Bacteria 2941
113 Ga0268266_10138729 3300028379 Bacteria 2180
114 Ga0268265_10000492 3300028380 Bacteria 41089
115 Ga0268265_10036779 3300028380 Bacteria 3588
116 Ga0268264_10020451 3300028381 Bacteria 5408
117 Ga0268264_10305360 3300028381 Bacteria 1499
118 Ga0307509_10000021 3300031507 Bacteria 250589
119 Ga0307408_100065139 3300031548 Bacteria 2672
120 Ga0307414_10018983 3300032004 Bacteria 4250
121 Ga0307414_10100903 3300032004 Bacteria 2172
122 Ga0307507_10470269 3300033179 Bacteria 687
123 Ga0395905_0107633 3300037471 Bacteria 2617
124 Ga0436365_0966573 3300039437 Bacteria 4963
125 Ga0436365_1607412 3300039437 Bacteria 2081
126 Ga0436362_1083791 3300039453 Bacteria 1107
127 Ga0451804_0399903 3300041463 Bacteria 729
128 Ga0466965_0037985 3300044683 Bacteria 2365
129 Ga0466957_0026593 3300044842 Bacteria 3434
130 Ga0495627_034893 3300046453 Bacteria 1569
131 Ga0495591_008091 3300046458 Bacteria 4349
132 Ga0495650_0002098 3300046471 Bacteria 17142
133 Ga0495650_0005269 3300046471 Bacteria 8465
134 Ga0495650_0015593 3300046471 Bacteria 3890
135 Ga0495605_0006908 3300046474 Bacteria 6482
136 Ga0495584_0011201 3300046491 Bacteria 4594
137 Ga0495585_0021414 3300046492 Bacteria 3711
138 Ga0495585_0051725 3300046492 Bacteria 2275
139 Ga0495594_0000908 3300046499 Bacteria 15354
140 Ga0495607_0002374 3300046501 Bacteria 15369
141 Ga0495607_0034256 3300046501 Bacteria 3082
142 Ga0495607_0198597 3300046501 Bacteria 994
143 Ga0495583_0000233 3300046506 Bacteria 92142
144 Ga0495583_0000528 3300046506 Bacteria 54010
145 Ga0495606_0000047 3300046507 Bacteria 207892
146 Ga0495606_0016898 3300046507 Bacteria 5540
147 Ga0495606_0053314 3300046507 Bacteria 2624
148 Ga0495610_0003574 3300046512 Bacteria 12018
149 Ga0495610_0126721 3300046512 Bacteria 1112
150 Ga0495616_0002007 3300046513 Bacteria 13696
151 Ga0495616_0035146 3300046513 Bacteria 2595
152 Ga0495616_0318576 3300046513 Bacteria 653
153 Ga0495620_0000214 3300046515 Bacteria 43578
154 Ga0495620_0021383 3300046515 Bacteria 3142
155 Ga0495631_0002090 3300046518 Bacteria 11598
156 Ga0495631_0007308 3300046518 Bacteria 5625
157 Ga0495631_0179349 3300046518 Bacteria 907
158 Ga0495632_0011959 3300046519 Bacteria 5033
159 Ga0495632_0087580 3300046519 Bacteria 1480
160 Ga0495637_0000127 3300046520 Bacteria 56837
161 Ga0495637_0001330 3300046520 Bacteria 14810
162 Ga0495637_0106509 3300046520 Bacteria 1090
163 Ga0495644_0002776 3300046523 Bacteria 6941
164 Ga0495648_0000036 3300046524 Bacteria 195997
165 Ga0495648_0000939 3300046524 Bacteria 30267
166 Ga0495654_0031541 3300046530 Bacteria 2690
167 Ga0495654_0176033 3300046530 Bacteria 929
168 Ga0495609_0000494 3300046538 Bacteria 31611
169 Ga0495609_0129159 3300046538 Bacteria 1083
170 Ga0495597_0030556 3300046542 Bacteria 2455
171 Ga0495633_0018550 3300046558 Bacteria 3531
172 Ga0495633_0018577 3300046558 Bacteria 3528
173 Ga0495633_0109665 3300046558 Bacteria 1279
174 Ga0495668_0049097 3300046616 Bacteria 2340
175 Ga0495668_0134023 3300046616 Bacteria 1356
176 Ga0495611_0041174 3300046648 Bacteria 2060
177 Ga0495625_0000016 3300046660 Bacteria 311353
178 Ga0495625_0000108 3300046660 Bacteria 125604
179 Ga0495625_0058916 3300046660 Bacteria 2726
180 Ga0495661_0000001 3300046665 Bacteria 898372
181 Ga0495661_0002335 3300046665 Bacteria 14634
182 Ga0495670_0026199 3300046691 Bacteria 2885
183 Ga0495670_0144488 3300046691 Bacteria 1246
184 Ga0495670_0404306 3300046691 Bacteria 738
185 Ga0495671_0029969 3300046692 Bacteria 2789
186 Ga0495671_0061288 3300046692 Bacteria 1856
187 Ga0495649_0034133 3300046694 Bacteria 2800
188 Ga0495589_0024713 3300046794 Bacteria 3052
189 Ga0495660_0024611 3300046810 Bacteria 3428
190 Ga0495660_0069701 3300046810 Bacteria 1868
191 Ga0495672_0014600 3300047320 Bacteria 5370
192 Ga0495683_0000150 3300047323 Bacteria 68562
193 Ga0495683_0000268 3300047323 Bacteria 46160
194 Ga0495679_000302 3300047446 Bacteria 39783
195 Ga0495679_023426 3300047446 Bacteria 2094
196 Ga0495673_0001186 3300047469 Bacteria 21914
197 Ga0495673_0011015 3300047469 Bacteria 4890
198 Ga0495673_0085441 3300047469 Bacteria 1298
199 Ga0495681_0000364 3300047470 Bacteria 35327
200 Ga0495681_0005041 3300047470 Bacteria 8903
201 Ga0495681_0026832 3300047470 Bacteria 2989
202 Ga0495686_0045679 3300047472 Bacteria 2770
203 Ga0495686_0173541 3300047472 Bacteria 1253
204 Ga0496100_0402921 3300048903 Bacteria 1042
205 Ga0496102_0701641 3300048905 Bacteria 935
206 Ga0496114_0218110 3300048917 Bacteria 1674
207 Ga0496115_0112644 3300048918 Bacteria 2235
208 Ga0496115_0440908 3300048918 Bacteria 1053
209 Ga0496117_0075408 3300048920 Bacteria 2241
210 Ga0496117_0405790 3300048920 Bacteria 686
211 Ga0496118_0088058 3300048921 Bacteria 2150
212 Ga0496118_0110710 3300048921 Bacteria 1823
213 Ga0496121_0045164 3300048924 Bacteria 3789
214 Ga0496121_0513379 3300048924 Bacteria 758
215 Ga0496122_0001093 3300048925 Bacteria 46994
216 Ga0496122_0001281 3300048925 Bacteria 41818
217 Ga0496122_0020635 3300048925 Bacteria 5938
218 Ga0496123_0001497 3300048926 Bacteria 32439
219 Ga0496123_0002085 3300048926 Bacteria 25741
220 Ga0496125_0000734 3300048928 Bacteria 54288
221 Ga0496125_0061073 3300048928 Bacteria 3025
222 Ga0496126_0042726 3300048929 Bacteria 4185
223 Ga0496126_0100952 3300048929 Bacteria 2524
224 Ga0496126_0148142 3300048929 Bacteria 2014
225 Ga0496126_0790647 3300048929 Bacteria 729
226 Ga0495678_117336 3300049459 Bacteria 898
227 nmdc:mga03683_17299_c2 3300050489 Bacteria 1460
228 nmdc:mga09592_114840_c1 3300050508 Bacteria 2311
229 Ga0500644_0069757 3300053088 Bacteria 1263
230 Ga0500572_000860 3300053111 Bacteria 9428
231 Ga0500595_001365 3300053119 Bacteria 13120
232 Ga0500597_000063 3300053120 Bacteria 21630
233 Ga0500614_131393 3300053123 Bacteria 744
234 Ga0500652_047309 3300053131 Bacteria 1748
235 Ga0500559_0000628 3300053136 Bacteria 23950
236 Ga0500568_0007325 3300053139 Bacteria 5424
237 Ga0500639_007874 3300053163 Bacteria 5540
238 Ga0500576_214371 3300053725 Bacteria 639
239 2550696774 2548876994 Bacteria 4904866
240 2739351186 2738543031 Bacteria 5769731
241 2909400817 2909399089 Bacteria 3922598
242 2917700627 2917699015 Bacteria 7043791
243 2989779519 2989776772 Bacteria 4843317
244 8054804164 8054795415 Bacteria 9785225
245 8055818200 8055817908 Bacteria 6609162
246 Ga0500556_0000038
247 JGI25156J39149_1000320
248 JGI25162J39368_1008008
249 JGI25154J39366_1000264
250 JGI25157J39369_1001452
251 JGI25159J45721_1000356
252 rootH1_10026225
253 rootH2_10138489
254 rootL2_10061986
255 JGI25161J50226_1000250
256 Ga0055538_1001991
257 Ga0055539_1004124
258 Ga0055532_1000089
259 Ga0055532_1000278
260 Ga0055535_1002569
261 Ga0055526_1002042
262 Ga0055537_1001367
263 Ga0055524_1000031
264 Ga0055524_1001574
265 Ga0055534_1006022
266 Ga0055534_1052082
267 Ga0055530_10000500
268 Ga0055543_1000273
269 Ga0065165_1000902
270 Ga0065165_1002936
271 Ga0065165_1037709
272 Ga0070663_100109987
273 Ga0068853_101382880
274 Ga0070665_100000237
275 Ga0070665_100003467
276 Ga0070665_100033192
277 Ga0068855_100027230
278 Ga0068859_100001027
279 Ga0068863_100588548
280 Ga0068858_100280908
281 Ga0068860_100214129
282 Ga0068862_100000246
283 Ga0068862_100492393
284 Ga0075364_10310804
285 Ga0097620_100001027
286 Ga0105240_10055597
287 Ga0105247_10315946
288 Ga0105237_10010483
289 Ga0105237_10076236
290 Ga0105238_10000294
291 Ga0105249_10000226
292 Ga0105249_10071373
293 Ga0105239_10001564
294 Ga0105239_10023817
295 Ga0105239_10128551
296 Ga0105239_10208121
297 Ga0105239_10454353
298 Ga0105239_12081740
299 Ga0157373_10037452
300 Ga0157374_10655266
301 Ga0163162_10034893
302 Ga0163162_10445382
303 Ga0163163_10208901
304 Ga0163163_10222917
305 Ga0182008_10000284
306 Ga0157379_10067909
307 Ga0157379_10078132
308 Ga0182007_10108339
309 Ga0213876_10221011
310 Ga0209435_100109
311 Ga0209436_100300
312 Ga0209784_101385
313 Ga0209566_102870
314 Ga0209147_100021
315 Ga0209147_100060
316 Ga0209437_100081
317 Ga0209437_100590
318 Ga0209258_100141
319 Ga0209646_1000101
320 Ga0209026_1000264
321 Ga0209677_101453
322 Ga0209148_1014588
323 Ga0209759_1000264
324 Ga0209565_1001660
325 Ga0209673_1022826
326 Ga0209673_1073864
327 Ga0209130_1000301
328 Ga0209675_1001764
329 Ga0209675_1008088
330 Ga0209564_1000098
331 Ga0209564_1000135
332 Ga0209050_1000533
333 Ga0209050_1006433
334 Ga0209256_1000107
335 Ga0209256_1000765
336 Ga0209051_1069127
337 Ga0209257_1000303
338 Ga0207685_10528339
339 Ga0207695_10001257
340 Ga0207695_10050976
341 Ga0207695_10201767
342 Ga0207671_10014753
343 Ga0207649_10966114
344 Ga0207694_10000920
345 Ga0207667_10008948
346 Ga0207667_10261985
347 Ga0207712_10000141
348 Ga0207712_10042128
349 Ga0207658_10104801
350 Ga0207703_10862963
351 Ga0207639_11277738
352 Ga0207678_10110460
353 Ga0207678_10272701
354 Ga0207702_10052790
355 Ga0207641_10396535
356 Ga0268266_10000001
357 Ga0268266_10074819
358 Ga0268266_10138729
359 Ga0268265_10000492
360 Ga0268265_10036779
361 Ga0268264_10020451
362 Ga0268264_10305360
363 Ga0307509_10000021
364 Ga0307408_100065139
365 Ga0307414_10018983
366 Ga0307414_10100903
367 Ga0307507_10470269
368 Ga0395905_0107633
369 Ga0436365_0966573
370 Ga0436365_1607412
371 Ga0436362_1083791
372 Ga0451804_0399903
373 Ga0466965_0037985
374 Ga0466957_0026593
375 Ga0495627_034893
376 Ga0495591_008091
377 Ga0495650_0002098
378 Ga0495650_0005269
379 Ga0495650_0015593
380 Ga0495605_0006908
381 Ga0495584_0011201
382 Ga0495585_0021414
383 Ga0495585_0051725
384 Ga0495594_0000908
385 Ga0495607_0002374
386 Ga0495607_0034256
387 Ga0495607_0198597
388 Ga0495583_0000233
389 Ga0495583_0000528
390 Ga0495606_0000047
391 Ga0495606_0016898
392 Ga0495606_0053314
393 Ga0495610_0003574
394 Ga0495610_0126721
395 Ga0495616_0002007
396 Ga0495616_0035146
397 Ga0495616_0318576
398 Ga0495620_0000214
399 Ga0495620_0021383
400 Ga0495631_0002090
401 Ga0495631_0007308
402 Ga0495631_0179349
403 Ga0495632_0011959
404 Ga0495632_0087580
405 Ga0495637_0000127
406 Ga0495637_0001330
407 Ga0495637_0106509
408 Ga0495644_0002776
409 Ga0495648_0000036
410 Ga0495648_0000939
411 Ga0495654_0031541
412 Ga0495654_0176033
413 Ga0495609_0000494
414 Ga0495609_0129159
415 Ga0495597_0030556
416 Ga0495633_0018550
417 Ga0495633_0018577
418 Ga0495633_0109665
419 Ga0495668_0049097
420 Ga0495668_0134023
421 Ga0495611_0041174
422 Ga0495625_0000016
423 Ga0495625_0000108
424 Ga0495625_0058916
425 Ga0495661_0000001
426 Ga0495661_0002335
427 Ga0495670_0026199
428 Ga0495670_0144488
429 Ga0495670_0404306
430 Ga0495671_0029969
431 Ga0495671_0061288
432 Ga0495649_0034133
433 Ga0495589_0024713
434 Ga0495660_0024611
435 Ga0495660_0069701
436 Ga0495672_0014600
437 Ga0495683_0000150
438 Ga0495683_0000268
439 Ga0495679_000302
440 Ga0495679_023426
441 Ga0495673_0001186
442 Ga0495673_0011015
443 Ga0495673_0085441
444 Ga0495681_0000364
445 Ga0495681_0005041
446 Ga0495681_0026832
447 Ga0495686_0045679
448 Ga0495686_0173541
449 Ga0496100_0402921
450 Ga0496102_0701641
451 Ga0496114_0218110
452 Ga0496115_0112644
453 Ga0496115_0440908
454 Ga0496117_0075408
455 Ga0496117_0405790
456 Ga0496118_0088058
457 Ga0496118_0110710
458 Ga0496121_0045164
459 Ga0496121_0513379
460 Ga0496122_0001093
461 Ga0496122_0001281
462 Ga0496122_0020635
463 Ga0496123_0001497
464 Ga0496123_0002085
465 Ga0496125_0000734
466 Ga0496125_0061073
467 Ga0496126_0042726
468 Ga0496126_0100952
469 Ga0496126_0148142
470 Ga0496126_0790647
471 Ga0495678_117336
472 nmdc:mga03683_17299_c2
473 nmdc:mga09592_114840_c1
474 Ga0500644_0069757
475 Ga0500572_000860
476 Ga0500595_001365
477 Ga0500597_000063
478 Ga0500614_131393
479 Ga0500652_047309
480 Ga0500559_0000628
481 Ga0500568_0007325
482 Ga0500639_007874
483 Ga0500576_214371
484 2550696774
485 2739351186
486 2909400817
487 2917700627
488 2989779519
489 8054804164
490 8055818200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ze4-assembly1.cif.gz_C crystal structure of the integral membrane diacylglycerol kinase - wild-type 0.6317 63 151
4bpd-assembly2.cif.gz_D structure determination of an integral membrane kinase 0.6241 50 151
4cjz-assembly1.cif.gz_B crystal structure of the integral membrane diacylglycerol kinase dgka- 9.9, delta 4 0.596 50 153
3ze4-assembly1.cif.gz_C crystal structure of the integral membrane diacylglycerol kinase - wild-type 0.5742 63 151
4brb-assembly2.cif.gz_E crystal structure of the integral membrane enzyme dgka-ref, delta 7 0.551 70 156
ID Description Score Start End Superfamily
4up6C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6327 63 151 1.10.287.3610
3ze4C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6317 63 151 1.10.287.3610
4uxxB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.609 49 153 1.10.287.3610
4uxwB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6011 50 151 1.10.287.3610
4bpdB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5999 58 151 1.10.287.3610
ID Description Score Start End GO Terms
AF-A0A108UAN8-F1-model_v4 Transmembrane protein 0.9606 25 161 GO:0016020
AF-A0A3M0A4P8-F1-model_v4 DUF2306 domain-containing protein 0.9473 4 157 GO:0016020
AF-A0A212L0Y9-F1-model_v4 Transmembrane protein 0.9424 1 163 GO:0016020
AF-A0A423I1V7-F1-model_v4 Uncharacterized protein 0.9395 1 164 GO:0016020
AF-A0A2M8UM35-F1-model_v4 deleted 0.9388 1 155

Map