F357804

General Info

Members Datasets Scaffolds Average Seq Length
245 133 490 204

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2939664404|2939668933
Length 225
Sequence PVRAFIPAGFFYADPFSTFGAMIELLKDSFSQFFIQTGALEWFGVFTGILCVWLAAKNNIYSWPVAIVSVVIYIFIFFESRLYADMGLQFYFFFMNLYGWYYWSENRNNPEASRPVANINQKEVLLSVIGIIVFTFLLGQLLYKNTDASFPYLDSFCTACSLVAQIFLARKVIQNWLIWIFVDIIYVGMYISKNLYATAVMYAIYIYIAAVGYLDWRRTYREQEN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
107 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
120 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
123 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
124 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
127 2738541284 Pedobacter sp. YR016 Isolate Unclassified
128 2738543023 Pedobacter sp. OK628 Isolate Unclassified
129 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
130 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
131 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
132 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
133 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0
Isolates 3.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.49
Nodule 0
Rhizoplane 0
Rhizosphere 89.8
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_246485 2162886007 Bacteria 2705
2 JGI24736J21556_1000386 3300001904 Bacteria 8364
3 JGI24736J21556_1010712 3300001904 Bacteria 1497
4 JGI24740J21852_10013851 3300001979 Bacteria 2993
5 JGI24737J22298_10001377 3300001990 Bacteria 8624
6 JGI24737J22298_10002749 3300001990 Bacteria 6222
7 JGI24737J22298_10020673 3300001990 Bacteria 2100
8 JGI24744J21845_10001319 3300002077 Bacteria 4897
9 JGI25162J39368_1001475 3300002737 Bacteria 12347
10 JGI25164J39214_1000856 3300002772 Bacteria 10444
11 JGI25165J46597_1000542 3300003214 Bacteria 34723
12 rootH1_10074897 3300003316 Bacteria 2605
13 rootH2_10007960 3300003320 Bacteria 49899
14 rootH2_10024804 3300003320 Bacteria 8221
15 rootH1_10001642 3300003323 Bacteria 53790
16 rootH1_10053495 3300003323 Bacteria 4346
17 rootH1_10150649 3300003323 Bacteria 4877
18 Ga0065714_10003052 3300005288 Bacteria 15344
19 Ga0065714_10006036 3300005288 Bacteria 3497
20 Ga0065714_10067657 3300005288 Bacteria 5302
21 Ga0065704_10001017 3300005289 Bacteria 10600
22 Ga0065704_10092169 3300005289 Bacteria 2666
23 Ga0070658_10128097 3300005327 Bacteria 2114
24 Ga0070658_10189722 3300005327 Bacteria 1732
25 Ga0070658_11099944 3300005327 Bacteria 691
26 Ga0070676_10000205 3300005328 Bacteria 25133
27 Ga0070683_100025784 3300005329 Bacteria 5286
28 Ga0068868_100026294 3300005338 Bacteria 4434
29 Ga0068868_100080696 3300005338 Bacteria 2607
30 Ga0070660_100015229 3300005339 Bacteria 5548
31 Ga0070660_100067334 3300005339 Bacteria 2790
32 Ga0070660_101040175 3300005339 Unclassified 692
33 Ga0070671_100017668 3300005355 Bacteria 5780
34 Ga0070673_100005151 3300005364 Bacteria 8338
35 Ga0070659_100078360 3300005366 Bacteria 2636
36 Ga0070678_100008338 3300005456 Bacteria 6205
37 Ga0070662_100000062 3300005457 Bacteria 57251
38 Ga0070681_10148301 3300005458 Bacteria 2273
39 Ga0068867_100000809 3300005459 Bacteria 21093
40 Ga0070679_100180775 3300005530 Bacteria 2081
41 Ga0070684_100042765 3300005535 Bacteria 3913
42 Ga0068853_100139205 3300005539 Bacteria 2178
43 Ga0068853_100340954 3300005539 Bacteria 1392
44 Ga0070672_100654655 3300005543 Bacteria 918
45 Ga0070665_100000017 3300005548 Bacteria 448013
46 Ga0068855_100000021 3300005563 Bacteria 195708
47 Ga0068855_100045871 3300005563 Bacteria 5167
48 Ga0068855_100046024 3300005563 Bacteria 5158
49 Ga0068855_100194481 3300005563 Bacteria 2286
50 Ga0068855_100594261 3300005563 Unclassified 1194
51 Ga0068855_100622604 3300005563 Bacteria 1162
52 Ga0068857_100014983 3300005577 Bacteria 6763
53 Ga0068856_100075048 3300005614 Bacteria 3349
54 Ga0068856_100173220 3300005614 Bacteria 2170
55 Ga0068856_100605915 3300005614 Bacteria 1116
56 Ga0068852_100004850 3300005616 Bacteria 9552
57 Ga0068870_10033062 3300005840 Bacteria 2636
58 Ga0097621_100005700 3300006237 Bacteria 8796
59 Ga0075370_10183436 3300006353 Bacteria 1232
60 Ga0068871_100000080 3300006358 Bacteria 53930
61 Ga0068865_100000218 3300006881 Bacteria 31890
62 Ga0105240_10000515 3300009093 Bacteria 71183
63 Ga0105240_10051670 3300009093 Bacteria 5170
64 Ga0105240_10075373 3300009093 Bacteria 4161
65 Ga0105240_10092622 3300009093 Bacteria 3690
66 Ga0105240_10206459 3300009093 Bacteria 2299
67 Ga0105240_10309094 3300009093 Bacteria 1806
68 Ga0105240_11085876 3300009093 Unclassified 852
69 Ga0105243_10644712 3300009148 Unclassified 1026
70 Ga0105241_10000282 3300009174 Bacteria 37799
71 Ga0105241_10003510 3300009174 Bacteria 11668
72 Ga0105241_10012866 3300009174 Bacteria 6141
73 Ga0105241_10509462 3300009174 Bacteria 1074
74 Ga0105242_10021950 3300009176 Bacteria 5017
75 Ga0105237_10000779 3300009545 Bacteria 43629
76 Ga0105237_10003619 3300009545 Bacteria 18250
77 Ga0105237_10003760 3300009545 Bacteria 17868
78 Ga0105237_10348675 3300009545 Bacteria 1485
79 Ga0105237_10580486 3300009545 Bacteria 1128
80 Ga0105238_10157342 3300009551 Bacteria 2248
81 Ga0105238_10251974 3300009551 Bacteria 1744
82 Ga0105238_10387722 3300009551 Bacteria 1389
83 Ga0105239_10000015 3300010375 Bacteria 319892
84 Ga0105239_10001703 3300010375 Bacteria 28972
85 Ga0105239_10067313 3300010375 Bacteria 3934
86 Ga0105239_10491254 3300010375 Bacteria 1395
87 Ga0105246_10125840 3300011119 Bacteria 1906
88 Ga0157373_10000303 3300013100 Bacteria 39933
89 Ga0157373_10001282 3300013100 Bacteria 19215
90 Ga0157373_10003127 3300013100 Bacteria 12507
91 Ga0157373_10005432 3300013100 Bacteria 9572
92 Ga0157373_10033027 3300013100 Bacteria 3725
93 Ga0157373_10082757 3300013100 Bacteria 2262
94 Ga0157371_10002904 3300013102 Bacteria 16023
95 Ga0157371_10005552 3300013102 Bacteria 10604
96 Ga0157371_10025739 3300013102 Bacteria 4284
97 Ga0157371_10060784 3300013102 Bacteria 2678
98 Ga0157371_10060954 3300013102 Bacteria 2675
99 Ga0157371_10153236 3300013102 Unclassified 1644
100 Ga0157370_10008546 3300013104 Bacteria 11035
101 Ga0157370_10037461 3300013104 Bacteria 4701
102 Ga0157370_10043261 3300013104 Bacteria 4335
103 Ga0157370_10123047 3300013104 Bacteria 2422
104 Ga0157370_10165789 3300013104 Bacteria 2054
105 Ga0157370_10253362 3300013104 Bacteria 1628
106 Ga0157370_10381570 3300013104 Bacteria 1298
107 Ga0157369_10000101 3300013105 Bacteria 118683
108 Ga0157369_10069401 3300013105 Bacteria 3786
109 Ga0157369_10073483 3300013105 Bacteria 3669
110 Ga0157369_10158847 3300013105 Bacteria 2387
111 Ga0157374_10000848 3300013296 Bacteria 26742
112 Ga0157374_10001470 3300013296 Bacteria 19891
113 Ga0157374_10001936 3300013296 Bacteria 17362
114 Ga0157374_10303780 3300013296 Bacteria 1579
115 Ga0157374_10705150 3300013296 Bacteria 1022
116 Ga0157378_10011640 3300013297 Bacteria 7700
117 Ga0163162_10000051 3300013306 Bacteria 117695
118 Ga0157372_10000041 3300013307 Bacteria 158494
119 Ga0157372_10000472 3300013307 Bacteria 44394
120 Ga0157372_10001084 3300013307 Bacteria 29622
121 Ga0157372_10006390 3300013307 Bacteria 12536
122 Ga0157372_10821031 3300013307 Bacteria 1080
123 Ga0157375_10004963 3300013308 Bacteria 11574
124 Ga0182008_10000002 3300014497 Bacteria 480216
125 Ga0182008_10021124 3300014497 Bacteria 3346
126 Ga0182008_10197416 3300014497 Bacteria 1023
127 Ga0182008_10246393 3300014497 Bacteria 921
128 Ga0157377_10028149 3300014745 Bacteria 3023
129 Ga0157376_10485460 3300014969 Bacteria 1211
130 Ga0182006_1002342 3300015261 Bacteria 10406
131 Ga0182006_1010547 3300015261 Bacteria 4107
132 Ga0182007_10008830 3300015262 Bacteria 4111
133 Ga0182007_10051790 3300015262 Bacteria 1353
134 Ga0163161_10040371 3300017792 Bacteria 3352
135 Ga0163161_10042863 3300017792 Bacteria 3257
136 Ga0213872_10002931 3300021361 Bacteria 9696
137 Ga0207427_100060 3300025231 Bacteria 186274
138 Ga0209437_100021 3300025233 Bacteria 646400
139 Ga0209026_1000251 3300025250 Bacteria 67956
140 Ga0209026_1002177 3300025250 Bacteria 7607
141 Ga0209233_1000035 3300025261 Bacteria 568478
142 Ga0209233_1003692 3300025261 Bacteria 5351
143 Ga0209233_1043932 3300025261 Bacteria 949
144 Ga0207647_10000012 3300025904 Bacteria 152879
145 Ga0207647_10000411 3300025904 Bacteria 35218
146 Ga0207645_10000398 3300025907 Bacteria 35913
147 Ga0207643_10120399 3300025908 Bacteria 1554
148 Ga0207705_10152505 3300025909 Bacteria 1732
149 Ga0207705_10182859 3300025909 Bacteria 1583
150 Ga0207705_10805517 3300025909 Bacteria 729
151 Ga0207654_10023384 3300025911 Bacteria 3310
152 Ga0207654_10579602 3300025911 Bacteria 799
153 Ga0207707_10035752 3300025912 Bacteria 4344
154 Ga0207695_10000267 3300025913 Bacteria 131133
155 Ga0207695_10011047 3300025913 Bacteria 10972
156 Ga0207695_10011189 3300025913 Bacteria 10885
157 Ga0207695_10057992 3300025913 Bacteria 4021
158 Ga0207695_10722615 3300025913 Unclassified 876
159 Ga0207671_10000244 3300025914 Bacteria 81258
160 Ga0207671_10003548 3300025914 Bacteria 15461
161 Ga0207671_10128562 3300025914 Bacteria 1943
162 Ga0207671_10505430 3300025914 Bacteria 963
163 Ga0207657_10017942 3300025919 Bacteria 6772
164 Ga0207657_10077402 3300025919 Bacteria 2803
165 Ga0207652_10003347 3300025921 Bacteria 13249
166 Ga0207694_10348576 3300025924 Bacteria 1225
167 Ga0207694_10419097 3300025924 Bacteria 1115
168 Ga0207644_10004264 3300025931 Bacteria 9279
169 Ga0207690_10021299 3300025932 Bacteria 4019
170 Ga0207706_10000430 3300025933 Bacteria 44993
171 Ga0207686_10385065 3300025934 Bacteria 1064
172 Ga0207704_10000065 3300025938 Bacteria 69867
173 Ga0207691_10444360 3300025940 Bacteria 1104
174 Ga0207661_10053752 3300025944 Bacteria 3224
175 Ga0207667_10000014 3300025949 Bacteria 421261
176 Ga0207667_10029021 3300025949 Bacteria 6005
177 Ga0207667_10029435 3300025949 Bacteria 5956
178 Ga0207651_10649231 3300025960 Bacteria 926
179 Ga0207677_10015448 3300026023 Bacteria 4492
180 Ga0207677_10172970 3300026023 Bacteria 1691
181 Ga0207639_10094638 3300026041 Bacteria 2399
182 Ga0207639_10364294 3300026041 Bacteria 1294
183 Ga0207702_10011651 3300026078 Bacteria 7326
184 Ga0207702_10062085 3300026078 Bacteria 3189
185 Ga0207702_10339089 3300026078 Bacteria 1436
186 Ga0207648_10000886 3300026089 Bacteria 33749
187 Ga0207674_10022392 3300026116 Bacteria 6786
188 Ga0207683_10029073 3300026121 Bacteria 4783
189 Ga0207698_10313013 3300026142 Unclassified 1467
190 Ga0268266_10000037 3300028379 Bacteria 342368
191 Ga0307515_10033601 3300028794 Bacteria 8434
192 Ga0265338_10016385 3300028800 Bacteria 8071
193 Ga0265338_10621665 3300028800 Unclassified 751
194 Ga0307412_10000001 3300031911 Bacteria 822691
195 Ga0307412_10229635 3300031911 Unclassified 1428
196 Ga0307414_10003776 3300032004 Bacteria 8135
197 Ga0307510_10000249 3300033180 Bacteria 48754
198 Ga0395899_0000024 3300037312 Bacteria 357402
199 Ga0395899_0043390 3300037312 Bacteria 3354
200 Ga0395899_0255338 3300037312 Bacteria 1201
201 Ga0395899_0518147 3300037312 Unclassified 771
202 Ga0395900_0006199 3300037418 Bacteria 12487
203 Ga0395900_0014405 3300037418 Bacteria 8070
204 Ga0395900_0299518 3300037418 Unclassified 1595
205 Ga0395898_0027357 3300037466 Bacteria 5727
206 Ga0395898_0125499 3300037466 Bacteria 2459
207 Ga0395905_0000327 3300037471 Bacteria 68334
208 Ga0395905_0006989 3300037471 Bacteria 11280
209 Ga0395901_0000895 3300038443 Bacteria 32740
210 Ga0395901_0006084 3300038443 Bacteria 12224
211 Ga0395901_0017514 3300038443 Bacteria 7313
212 Ga0436361_0762305 3300039447 Bacteria 18071
213 Ga0466969_0011366 3300044656 Bacteria 4714
214 Ga0466966_0004510 3300044684 Bacteria 9186
215 Ga0466961_0447790 3300044693 Bacteria 781
216 Ga0495606_0007729 3300046507 Bacteria 9521
217 Ga0495644_0003385 3300046523 Bacteria 6305
218 Ga0495609_0034619 3300046538 Bacteria 2289
219 Ga0495625_0011030 3300046660 Bacteria 7409
220 Ga0495625_0021388 3300046660 Bacteria 4983
221 Ga0495625_0661454 3300046660 Bacteria 621
222 Ga0495661_0001677 3300046665 Bacteria 18054
223 Ga0495661_0008391 3300046665 Bacteria 7147
224 Ga0495670_0102495 3300046691 Unclassified 1475
225 Ga0495687_001569 3300047443 Bacteria 20749
226 Ga0495677_0023588 3300047445 Bacteria 2233
227 Ga0495686_0000249 3300047472 Bacteria 96604
228 Ga0495686_0001285 3300047472 Bacteria 28340
229 Ga0495686_0022635 3300047472 Bacteria 4157
230 Ga0495686_0146686 3300047472 Bacteria 1388
231 Ga0495678_008994 3300049459 Bacteria 4989
232 Ga0501077_0301799 3300049593 Unclassified 1020
233 Ga0501079_0055598 3300049741 Bacteria 3054
234 Ga0501241_005962 3300049758 Bacteria 2260
235 Ga0500651_0027633 3300053093 Bacteria 3568
236 Ga0500608_000883 3300053122 Bacteria 10831
237 Ga0501084_0136337 3300054114 Bacteria 2066
238 2939668933 2939664404 Bacteria 6364494
239 2738761690 2738541284 Bacteria 5199923
240 2739304298 2738543023 Bacteria 6767879
241 2776615661 2775506987 Bacteria 5373360
242 2852627911 2852627209 Bacteria 5896285
243 2919190856 2919186247 Bacteria 6244071
244 2919439510 2919437846 Bacteria 6199444
245 2977235070 2977232053 Bacteria 5485925
246 SwRhRL2b_contig_246485
247 JGI24736J21556_1000386
248 JGI24736J21556_1010712
249 JGI24740J21852_10013851
250 JGI24737J22298_10001377
251 JGI24737J22298_10002749
252 JGI24737J22298_10020673
253 JGI24744J21845_10001319
254 JGI25162J39368_1001475
255 JGI25164J39214_1000856
256 JGI25165J46597_1000542
257 rootH1_10074897
258 rootH2_10007960
259 rootH2_10024804
260 rootH1_10001642
261 rootH1_10053495
262 rootH1_10150649
263 Ga0065714_10003052
264 Ga0065714_10006036
265 Ga0065714_10067657
266 Ga0065704_10001017
267 Ga0065704_10092169
268 Ga0070658_10128097
269 Ga0070658_10189722
270 Ga0070658_11099944
271 Ga0070676_10000205
272 Ga0070683_100025784
273 Ga0068868_100026294
274 Ga0068868_100080696
275 Ga0070660_100015229
276 Ga0070660_100067334
277 Ga0070660_101040175
278 Ga0070671_100017668
279 Ga0070673_100005151
280 Ga0070659_100078360
281 Ga0070678_100008338
282 Ga0070662_100000062
283 Ga0070681_10148301
284 Ga0068867_100000809
285 Ga0070679_100180775
286 Ga0070684_100042765
287 Ga0068853_100139205
288 Ga0068853_100340954
289 Ga0070672_100654655
290 Ga0070665_100000017
291 Ga0068855_100000021
292 Ga0068855_100045871
293 Ga0068855_100046024
294 Ga0068855_100194481
295 Ga0068855_100594261
296 Ga0068855_100622604
297 Ga0068857_100014983
298 Ga0068856_100075048
299 Ga0068856_100173220
300 Ga0068856_100605915
301 Ga0068852_100004850
302 Ga0068870_10033062
303 Ga0097621_100005700
304 Ga0075370_10183436
305 Ga0068871_100000080
306 Ga0068865_100000218
307 Ga0105240_10000515
308 Ga0105240_10051670
309 Ga0105240_10075373
310 Ga0105240_10092622
311 Ga0105240_10206459
312 Ga0105240_10309094
313 Ga0105240_11085876
314 Ga0105243_10644712
315 Ga0105241_10000282
316 Ga0105241_10003510
317 Ga0105241_10012866
318 Ga0105241_10509462
319 Ga0105242_10021950
320 Ga0105237_10000779
321 Ga0105237_10003619
322 Ga0105237_10003760
323 Ga0105237_10348675
324 Ga0105237_10580486
325 Ga0105238_10157342
326 Ga0105238_10251974
327 Ga0105238_10387722
328 Ga0105239_10000015
329 Ga0105239_10001703
330 Ga0105239_10067313
331 Ga0105239_10491254
332 Ga0105246_10125840
333 Ga0157373_10000303
334 Ga0157373_10001282
335 Ga0157373_10003127
336 Ga0157373_10005432
337 Ga0157373_10033027
338 Ga0157373_10082757
339 Ga0157371_10002904
340 Ga0157371_10005552
341 Ga0157371_10025739
342 Ga0157371_10060784
343 Ga0157371_10060954
344 Ga0157371_10153236
345 Ga0157370_10008546
346 Ga0157370_10037461
347 Ga0157370_10043261
348 Ga0157370_10123047
349 Ga0157370_10165789
350 Ga0157370_10253362
351 Ga0157370_10381570
352 Ga0157369_10000101
353 Ga0157369_10069401
354 Ga0157369_10073483
355 Ga0157369_10158847
356 Ga0157374_10000848
357 Ga0157374_10001470
358 Ga0157374_10001936
359 Ga0157374_10303780
360 Ga0157374_10705150
361 Ga0157378_10011640
362 Ga0163162_10000051
363 Ga0157372_10000041
364 Ga0157372_10000472
365 Ga0157372_10001084
366 Ga0157372_10006390
367 Ga0157372_10821031
368 Ga0157375_10004963
369 Ga0182008_10000002
370 Ga0182008_10021124
371 Ga0182008_10197416
372 Ga0182008_10246393
373 Ga0157377_10028149
374 Ga0157376_10485460
375 Ga0182006_1002342
376 Ga0182006_1010547
377 Ga0182007_10008830
378 Ga0182007_10051790
379 Ga0163161_10040371
380 Ga0163161_10042863
381 Ga0213872_10002931
382 Ga0207427_100060
383 Ga0209437_100021
384 Ga0209026_1000251
385 Ga0209026_1002177
386 Ga0209233_1000035
387 Ga0209233_1003692
388 Ga0209233_1043932
389 Ga0207647_10000012
390 Ga0207647_10000411
391 Ga0207645_10000398
392 Ga0207643_10120399
393 Ga0207705_10152505
394 Ga0207705_10182859
395 Ga0207705_10805517
396 Ga0207654_10023384
397 Ga0207654_10579602
398 Ga0207707_10035752
399 Ga0207695_10000267
400 Ga0207695_10011047
401 Ga0207695_10011189
402 Ga0207695_10057992
403 Ga0207695_10722615
404 Ga0207671_10000244
405 Ga0207671_10003548
406 Ga0207671_10128562
407 Ga0207671_10505430
408 Ga0207657_10017942
409 Ga0207657_10077402
410 Ga0207652_10003347
411 Ga0207694_10348576
412 Ga0207694_10419097
413 Ga0207644_10004264
414 Ga0207690_10021299
415 Ga0207706_10000430
416 Ga0207686_10385065
417 Ga0207704_10000065
418 Ga0207691_10444360
419 Ga0207661_10053752
420 Ga0207667_10000014
421 Ga0207667_10029021
422 Ga0207667_10029435
423 Ga0207651_10649231
424 Ga0207677_10015448
425 Ga0207677_10172970
426 Ga0207639_10094638
427 Ga0207639_10364294
428 Ga0207702_10011651
429 Ga0207702_10062085
430 Ga0207702_10339089
431 Ga0207648_10000886
432 Ga0207674_10022392
433 Ga0207683_10029073
434 Ga0207698_10313013
435 Ga0268266_10000037
436 Ga0307515_10033601
437 Ga0265338_10016385
438 Ga0265338_10621665
439 Ga0307412_10000001
440 Ga0307412_10229635
441 Ga0307414_10003776
442 Ga0307510_10000249
443 Ga0395899_0000024
444 Ga0395899_0043390
445 Ga0395899_0255338
446 Ga0395899_0518147
447 Ga0395900_0006199
448 Ga0395900_0014405
449 Ga0395900_0299518
450 Ga0395898_0027357
451 Ga0395898_0125499
452 Ga0395905_0000327
453 Ga0395905_0006989
454 Ga0395901_0000895
455 Ga0395901_0006084
456 Ga0395901_0017514
457 Ga0436361_0762305
458 Ga0466969_0011366
459 Ga0466966_0004510
460 Ga0466961_0447790
461 Ga0495606_0007729
462 Ga0495644_0003385
463 Ga0495609_0034619
464 Ga0495625_0011030
465 Ga0495625_0021388
466 Ga0495625_0661454
467 Ga0495661_0001677
468 Ga0495661_0008391
469 Ga0495670_0102495
470 Ga0495687_001569
471 Ga0495677_0023588
472 Ga0495686_0000249
473 Ga0495686_0001285
474 Ga0495686_0022635
475 Ga0495686_0146686
476 Ga0495678_008994
477 Ga0501077_0301799
478 Ga0501079_0055598
479 Ga0501241_005962
480 Ga0500651_0027633
481 Ga0500608_000883
482 Ga0501084_0136337
483 2939668933
484 2738761690
485 2739304298
486 2776615661
487 2852627911
488 2919190856
489 2919439510
490 2977235070

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04973

NMN_transporter

Nicotinamide mononucleotide transporter

38

218

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8121 8 201
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.7726 8 201
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.4838 102 195
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.4672 102 195
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.4339 98 199
ID Description Score Start End Superfamily
af_A0A0R4IUP1_1_92_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6204 106 188 1.25.40.10
af_Q9UJX4_254_354_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5463 110 189 1.25.40.10
af_A0A0R4IUP1_1_92_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5347 106 188 1.25.40.10
af_O60087_19_449_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.5281 110 194 1.50.10.10
af_G2J646_1_138_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.511 102 204 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A0R2U3Z5-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9633 95 203 GO:0005886
GO:0034257
AF-A0A7C2J9G3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9626 93 202 GO:0005886
GO:0034257
AF-A0A355U8K9-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9586 19 198 GO:0005886
GO:0034257
AF-A0A1S2WWC6-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9586 95 200 GO:0005886
GO:0034257
AF-A0A3D2S9P9-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9524 90 203 GO:0005886
GO:0034257

Map