F358079

General Info

Members Datasets Scaffolds Average Seq Length
246 173 492 154

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100087271|Ga0075431_1000872714
Length 168
Sequence VAKVDVGDAAPDFELPGTGGKTYRLADYRGGSGVVLAFYPGDFTQVCTAQMCSYRDNAEQLDRLGVPVLGISPQSLDSHERFAEENRLNIPLLADEGMKVANDYGVRGWASPLAWLRERKAVTPGGFFTQRAIFVIDGEGIVRYRHVSFTGTSYQSADDIEQAVAALS

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
93 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
96 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
169 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
172 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 13.82
Rhizosphere 80.49
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100087271 3300006847 Bacteria 3219
2 JGI24748J21848_1000642 3300002074 Bacteria 3746
3 Ga0070683_100041673 3300005329 Bacteria 4226
4 Ga0070683_100841953 3300005329 Bacteria 880
5 Ga0070677_10000008 3300005333 Bacteria 74027
6 Ga0068869_100930801 3300005334 Bacteria 753
7 Ga0070682_100000090 3300005337 Bacteria 82642
8 Ga0070669_100672571 3300005353 Bacteria 872
9 Ga0070674_100000023 3300005356 Bacteria 84887
10 Ga0070688_100000137 3300005365 Bacteria 39585
11 Ga0070667_100000785 3300005367 Bacteria 29854
12 Ga0070701_10850354 3300005438 Bacteria 626
13 Ga0070663_100001051 3300005455 Bacteria 15108
14 Ga0070681_10062182 3300005458 Bacteria 3707
15 Ga0068867_101512405 3300005459 Bacteria 625
16 Ga0070685_10000118 3300005466 Bacteria 50597
17 Ga0070679_100016735 3300005530 Bacteria 7085
18 Ga0070684_100031616 3300005535 Bacteria 4508
19 Ga0070684_100459835 3300005535 Bacteria 1177
20 Ga0070686_100835678 3300005544 Bacteria 745
21 Ga0070696_100460411 3300005546 Bacteria 1005
22 Ga0070665_101846321 3300005548 Bacteria 610
23 Ga0070704_100098046 3300005549 Bacteria 2201
24 Ga0068857_101001519 3300005577 Unclassified 804
25 Ga0068854_100020687 3300005578 Bacteria 4458
26 Ga0068856_100192712 3300005614 Bacteria 2052
27 Ga0068856_100315672 3300005614 Bacteria 1580
28 Ga0068859_101261537 3300005617 Bacteria 814
29 Ga0068864_100000031 3300005618 Bacteria 215331
30 Ga0068866_10000008 3300005718 Bacteria 117658
31 Ga0068863_100000022 3300005841 Bacteria 188278
32 Ga0068863_100393806 3300005841 Bacteria 1354
33 Ga0068863_100559522 3300005841 Bacteria 1130
34 Ga0068858_100054344 3300005842 Bacteria 3703
35 Ga0068860_100741325 3300005843 Bacteria 993
36 Ga0068862_100004419 3300005844 Bacteria 11866
37 Ga0081455_10021651 3300005937 Bacteria 6024
38 Ga0081538_10002624 3300005981 Bacteria 17375
39 Ga0081539_10005142 3300005985 Bacteria 13633
40 Ga0081539_10233007 3300005985 Unclassified 830
41 Ga0075363_100819512 3300006048 Bacteria 567
42 Ga0075367_10787889 3300006178 Bacteria 605
43 Ga0097621_100658666 3300006237 Bacteria 961
44 Ga0068871_100116960 3300006358 Bacteria 2248
45 Ga0075433_10000055 3300006852 Bacteria 48950
46 Ga0068865_100000069 3300006881 Bacteria 53927
47 Ga0097620_101261197 3300006931 Bacteria 814
48 Ga0105240_10373791 3300009093 Bacteria 1611
49 Ga0105245_10000130 3300009098 Bacteria 72166
50 Ga0105245_10000141 3300009098 Bacteria 68413
51 Ga0105247_10000305 3300009101 Bacteria 44071
52 Ga0105243_10519557 3300009148 Bacteria 1132
53 Ga0105242_10000054 3300009176 Bacteria 77765
54 Ga0105242_10000810 3300009176 Bacteria 24262
55 Ga0105249_10000143 3300009553 Bacteria 92539
56 Ga0105249_10038261 3300009553 Bacteria 4353
57 Ga0105249_10475601 3300009553 Bacteria 1291
58 Ga0105249_12171917 3300009553 Bacteria 628
59 Ga0157371_10012052 3300013102 Bacteria 6627
60 Ga0157370_10026165 3300013104 Bacteria 5764
61 Ga0157369_10000074 3300013105 Bacteria 136668
62 Ga0157369_10843338 3300013105 Bacteria 941
63 Ga0163162_11204406 3300013306 Bacteria 859
64 Ga0157375_10000127 3300013308 Bacteria 75142
65 Ga0157375_11886176 3300013308 Unclassified 709
66 Ga0163163_11233094 3300014325 Bacteria 810
67 Ga0157379_10007345 3300014968 Bacteria 9534
68 Ga0157379_10031518 3300014968 Bacteria 4723
69 Ga0157376_10032333 3300014969 Bacteria 4200
70 Ga0163161_10385365 3300017792 Bacteria 1121
71 Ga0206356_10628584 3300020070 Bacteria 2002
72 Ga0213876_10132563 3300021384 Bacteria 1325
73 Ga0207682_10000022 3300025893 Bacteria 62630
74 Ga0207642_10000002 3300025899 Bacteria 658166
75 Ga0207710_10000157 3300025900 Bacteria 72764
76 Ga0207707_10044629 3300025912 Bacteria 3864
77 Ga0207707_10049152 3300025912 Bacteria 3674
78 Ga0207671_10030872 3300025914 Bacteria 3995
79 Ga0207652_10002832 3300025921 Bacteria 14548
80 Ga0207687_10000032 3300025927 Bacteria 143196
81 Ga0207687_10000036 3300025927 Bacteria 121934
82 Ga0207706_10704803 3300025933 Unclassified 862
83 Ga0207686_10000073 3300025934 Bacteria 92009
84 Ga0207686_10001363 3300025934 Bacteria 13897
85 Ga0207686_11554273 3300025934 Unclassified 546
86 Ga0207709_10910072 3300025935 Unclassified 715
87 Ga0207669_10000026 3300025937 Bacteria 92199
88 Ga0207704_10000049 3300025938 Bacteria 83173
89 Ga0207661_10029272 3300025944 Bacteria 4228
90 Ga0207661_10125351 3300025944 Bacteria 2193
91 Ga0207712_10000058 3300025961 Bacteria 140948
92 Ga0207712_10019175 3300025961 Bacteria 4463
93 Ga0207712_10624494 3300025961 Unclassified 934
94 Ga0207668_10014194 3300025972 Bacteria 4928
95 Ga0207640_10021634 3300025981 Bacteria 3837
96 Ga0207658_10046028 3300025986 Bacteria 3183
97 Ga0207703_10914073 3300026035 Bacteria 840
98 Ga0207678_10004187 3300026067 Bacteria 12947
99 Ga0207702_10000368 3300026078 Bacteria 51559
100 Ga0207702_10296413 3300026078 Bacteria 1533
101 Ga0207702_10404915 3300026078 Bacteria 1316
102 Ga0207641_10000016 3300026088 Bacteria 307363
103 Ga0207641_10195444 3300026088 Bacteria 1862
104 Ga0207641_10467331 3300026088 Bacteria 1221
105 Ga0207676_10000031 3300026095 Bacteria 215877
106 Ga0207698_10757515 3300026142 Bacteria 970
107 Ga0268266_12103229 3300028379 Bacteria 537
108 Ga0268264_10262025 3300028381 Bacteria 1611
109 Ga0307513_10827920 3300031456 Bacteria 632
110 Ga0395900_0947152 3300037418 Unclassified 783
111 Ga0436365_1339040 3300039437 Bacteria 5010
112 Ga0436362_0165801 3300039453 Bacteria 835
113 Ga0466963_0000008 3300044694 Bacteria 74916
114 Ga0466963_0006811 3300044694 Bacteria 6797
115 Ga0466963_0598067 3300044694 Unclassified 779
116 Ga0466957_0342051 3300044842 Bacteria 1013
117 Ga0466967_0000001 3300045976 Bacteria 229823
118 Ga0466967_1199531 3300045976 Bacteria 756
119 Ga0495629_0003930 3300046459 Bacteria 11175
120 Ga0495639_0106736 3300046475 Bacteria 1326
121 Ga0495662_0001913 3300046476 Bacteria 10453
122 Ga0495594_0000030 3300046499 Bacteria 66443
123 Ga0495596_0137399 3300046500 Bacteria 949
124 Ga0495620_0000139 3300046515 Bacteria 59244
125 Ga0495628_0001264 3300046516 Bacteria 23154
126 Ga0495652_0000037 3300046529 Bacteria 133232
127 Ga0495652_0004607 3300046529 Bacteria 13143
128 Ga0495640_0024479 3300046533 Bacteria 4391
129 Ga0495586_0001547 3300046535 Bacteria 12691
130 Ga0495587_0064237 3300046536 Bacteria 2145
131 Ga0495645_0546049 3300046543 Bacteria 719
132 Ga0495622_0000080 3300046557 Bacteria 85557
133 Ga0495656_0002960 3300046615 Bacteria 5700
134 Ga0495634_0010707 3300046642 Bacteria 6712
135 Ga0495599_0639824 3300046678 Bacteria 617
136 Ga0495623_0142749 3300046679 Bacteria 1422
137 Ga0495623_0490958 3300046679 Bacteria 649
138 Ga0495669_0000904 3300046684 Bacteria 12495
139 Ga0495613_0377206 3300046689 Bacteria 970
140 Ga0495624_0000242 3300046690 Bacteria 42945
141 Ga0495674_0000030 3300047319 Bacteria 115975
142 Ga0495676_0000131 3300047321 Bacteria 56689
143 Ga0495676_0267240 3300047321 Bacteria 1162
144 Ga0495680_0000241 3300047322 Bacteria 60168
145 Ga0495675_0062703 3300047444 Bacteria 2353
146 Ga0495593_0051787 3300047673 Bacteria 2171
147 Ga0495593_0097469 3300047673 Bacteria 1510
148 Ga0495593_0279048 3300047673 Unclassified 836
149 Ga0495602_0000571 3300048088 Bacteria 34252
150 Ga0495602_0169399 3300048088 Bacteria 1696
151 Ga0495602_0287328 3300048088 Bacteria 1209
152 Ga0496100_0000013 3300048903 Bacteria 177476
153 Ga0496101_0000035 3300048904 Bacteria 177237
154 Ga0496102_0662117 3300048905 Bacteria 967
155 Ga0496102_1038166 3300048905 Bacteria 740
156 Ga0496103_0227852 3300048906 Bacteria 1198
157 Ga0496103_0406110 3300048906 Bacteria 875
158 Ga0496104_0000015 3300048907 Bacteria 374530
159 Ga0496104_0000052 3300048907 Bacteria 137286
160 Ga0496104_1092154 3300048907 Bacteria 701
161 Ga0496105_0000004 3300048908 Bacteria 475798
162 Ga0496105_0000030 3300048908 Bacteria 137325
163 Ga0496105_0505928 3300048908 Bacteria 948
164 Ga0496106_0000062 3300048909 Bacteria 85769
165 Ga0496107_0000020 3300048910 Bacteria 148990
166 Ga0496108_0000006 3300048911 Bacteria 469473
167 Ga0496108_0000137 3300048911 Bacteria 70783
168 Ga0496108_0749695 3300048911 Bacteria 845
169 Ga0496109_0000009 3300048912 Bacteria 236561
170 Ga0496109_0000088 3300048912 Bacteria 94877
171 Ga0496109_0036242 3300048912 Bacteria 4453
172 Ga0496109_0161114 3300048912 Bacteria 2102
173 Ga0496109_0743415 3300048912 Bacteria 919
174 Ga0496110_0018456 3300048913 Bacteria 5851
175 Ga0496110_0033211 3300048913 Bacteria 4462
176 Ga0496111_0020004 3300048914 Bacteria 4657
177 Ga0496111_0065904 3300048914 Bacteria 2629
178 Ga0496111_0203413 3300048914 Unclassified 1472
179 Ga0496112_0000025 3300048915 Bacteria 146197
180 Ga0496112_0545934 3300048915 Unclassified 1093
181 Ga0496112_0901522 3300048915 Bacteria 806
182 Ga0496113_0002454 3300048916 Bacteria 10798
183 Ga0496113_0185467 3300048916 Bacteria 1650
184 Ga0496114_0000039 3300048917 Bacteria 138486
185 Ga0496115_0000011 3300048918 Bacteria 222529
186 Ga0496117_0138593 3300048920 Bacteria 1461
187 Ga0496119_0012335 3300048922 Bacteria 6952
188 Ga0496120_0121172 3300048923 Bacteria 1352
189 Ga0496124_0351400 3300048927 Bacteria 1043
190 Ga0496126_0028478 3300048929 Bacteria 5322
191 Ga0496126_0134856 3300048929 Unclassified 2130
192 Ga0501031_0001129 3300049568 Bacteria 16227
193 Ga0501032_0001889 3300049569 Bacteria 16548
194 Ga0501033_0001429 3300049570 Bacteria 21198
195 Ga0501034_0045739 3300049571 Bacteria 4421
196 Ga0501034_0072679 3300049571 Bacteria 3448
197 Ga0501034_0308286 3300049571 Unclassified 1518
198 Ga0501036_0001887 3300049572 Bacteria 16280
199 Ga0501037_0000985 3300049573 Bacteria 21110
200 Ga0501038_0002804 3300049574 Bacteria 16230
201 Ga0501039_0016006 3300049575 Bacteria 5743
202 Ga0501042_0016081 3300049578 Bacteria 5134
203 Ga0501042_0017416 3300049578 Bacteria 4955
204 Ga0501043_0002678 3300049579 Bacteria 14939
205 Ga0501043_0442812 3300049579 Bacteria 977
206 Ga0501046_0002843 3300049580 Bacteria 16106
207 Ga0501047_0000430 3300049581 Bacteria 46649
208 Ga0501047_0086233 3300049581 Bacteria 3017
209 Ga0501048_0001723 3300049582 Bacteria 16662
210 Ga0501048_0155568 3300049582 Bacteria 1617
211 Ga0501068_0216686 3300049584 Bacteria 1216
212 Ga0501068_0315036 3300049584 Bacteria 1002
213 Ga0501068_0458353 3300049584 Bacteria 825
214 Ga0501069_0009217 3300049585 Bacteria 5206
215 Ga0501069_0018141 3300049585 Bacteria 3795
216 Ga0501070_0000592 3300049586 Bacteria 33029
217 Ga0501070_0205921 3300049586 Bacteria 1615
218 Ga0501071_0224442 3300049587 Bacteria 1414
219 Ga0501071_0453345 3300049587 Unclassified 982
220 Ga0501072_0127673 3300049588 Bacteria 2026
221 Ga0501073_0005921 3300049589 Bacteria 9129
222 Ga0501073_0303074 3300049589 Unclassified 1102
223 Ga0501074_0030104 3300049590 Bacteria 3934
224 Ga0501074_0119980 3300049590 Bacteria 1880
225 Ga0501079_0006383 3300049741 Bacteria 8853
226 Ga0501079_0016857 3300049741 Bacteria 5578
227 Ga0501080_0017371 3300049742 Bacteria 6652
228 Ga0501080_0341788 3300049742 Bacteria 1352
229 Ga0501081_0039293 3300049743 Bacteria 3237
230 Ga0501083_0005790 3300049744 Bacteria 8752
231 Ga0501035_0001710 3300049822 Bacteria 22170
232 Ga0501035_0358492 3300049822 Bacteria 1219
233 Ga0501044_0002472 3300049823 Bacteria 21084
234 Ga0501044_0008570 3300049823 Bacteria 11202
235 nmdc:mga03n38_597086_c1 3300050490 Bacteria 628
236 nmdc:mga0qj67_56147_c1 3300050509 Bacteria 3121
237 nmdc:mga0a205_366_c1 3300050515 Bacteria 34091
238 Ga0495601_0000720 3300053077 Bacteria 17767
239 Ga0495601_0323621 3300053077 Bacteria 1004
240 Ga0495612_0069145 3300053078 Bacteria 1470
241 Ga0495655_0046554 3300053083 Bacteria 1131
242 Ga0495655_0053830 3300053083 Bacteria 1075
243 Ga0495619_0000010 3300053085 Bacteria 302390
244 Ga0500566_0013791 3300053094 Bacteria 4755
245 Ga0500641_0006256 3300053096 Bacteria 4224
246 Ga0501082_0010118 3300060353 Bacteria 8119
247 Ga0075431_100087271
248 JGI24748J21848_1000642
249 Ga0070683_100041673
250 Ga0070683_100841953
251 Ga0070677_10000008
252 Ga0068869_100930801
253 Ga0070682_100000090
254 Ga0070669_100672571
255 Ga0070674_100000023
256 Ga0070688_100000137
257 Ga0070667_100000785
258 Ga0070701_10850354
259 Ga0070663_100001051
260 Ga0070681_10062182
261 Ga0068867_101512405
262 Ga0070685_10000118
263 Ga0070679_100016735
264 Ga0070684_100031616
265 Ga0070684_100459835
266 Ga0070686_100835678
267 Ga0070696_100460411
268 Ga0070665_101846321
269 Ga0070704_100098046
270 Ga0068857_101001519
271 Ga0068854_100020687
272 Ga0068856_100192712
273 Ga0068856_100315672
274 Ga0068859_101261537
275 Ga0068864_100000031
276 Ga0068866_10000008
277 Ga0068863_100000022
278 Ga0068863_100393806
279 Ga0068863_100559522
280 Ga0068858_100054344
281 Ga0068860_100741325
282 Ga0068862_100004419
283 Ga0081455_10021651
284 Ga0081538_10002624
285 Ga0081539_10005142
286 Ga0081539_10233007
287 Ga0075363_100819512
288 Ga0075367_10787889
289 Ga0097621_100658666
290 Ga0068871_100116960
291 Ga0075433_10000055
292 Ga0068865_100000069
293 Ga0097620_101261197
294 Ga0105240_10373791
295 Ga0105245_10000130
296 Ga0105245_10000141
297 Ga0105247_10000305
298 Ga0105243_10519557
299 Ga0105242_10000054
300 Ga0105242_10000810
301 Ga0105249_10000143
302 Ga0105249_10038261
303 Ga0105249_10475601
304 Ga0105249_12171917
305 Ga0157371_10012052
306 Ga0157370_10026165
307 Ga0157369_10000074
308 Ga0157369_10843338
309 Ga0163162_11204406
310 Ga0157375_10000127
311 Ga0157375_11886176
312 Ga0163163_11233094
313 Ga0157379_10007345
314 Ga0157379_10031518
315 Ga0157376_10032333
316 Ga0163161_10385365
317 Ga0206356_10628584
318 Ga0213876_10132563
319 Ga0207682_10000022
320 Ga0207642_10000002
321 Ga0207710_10000157
322 Ga0207707_10044629
323 Ga0207707_10049152
324 Ga0207671_10030872
325 Ga0207652_10002832
326 Ga0207687_10000032
327 Ga0207687_10000036
328 Ga0207706_10704803
329 Ga0207686_10000073
330 Ga0207686_10001363
331 Ga0207686_11554273
332 Ga0207709_10910072
333 Ga0207669_10000026
334 Ga0207704_10000049
335 Ga0207661_10029272
336 Ga0207661_10125351
337 Ga0207712_10000058
338 Ga0207712_10019175
339 Ga0207712_10624494
340 Ga0207668_10014194
341 Ga0207640_10021634
342 Ga0207658_10046028
343 Ga0207703_10914073
344 Ga0207678_10004187
345 Ga0207702_10000368
346 Ga0207702_10296413
347 Ga0207702_10404915
348 Ga0207641_10000016
349 Ga0207641_10195444
350 Ga0207641_10467331
351 Ga0207676_10000031
352 Ga0207698_10757515
353 Ga0268266_12103229
354 Ga0268264_10262025
355 Ga0307513_10827920
356 Ga0395900_0947152
357 Ga0436365_1339040
358 Ga0436362_0165801
359 Ga0466963_0000008
360 Ga0466963_0006811
361 Ga0466963_0598067
362 Ga0466957_0342051
363 Ga0466967_0000001
364 Ga0466967_1199531
365 Ga0495629_0003930
366 Ga0495639_0106736
367 Ga0495662_0001913
368 Ga0495594_0000030
369 Ga0495596_0137399
370 Ga0495620_0000139
371 Ga0495628_0001264
372 Ga0495652_0000037
373 Ga0495652_0004607
374 Ga0495640_0024479
375 Ga0495586_0001547
376 Ga0495587_0064237
377 Ga0495645_0546049
378 Ga0495622_0000080
379 Ga0495656_0002960
380 Ga0495634_0010707
381 Ga0495599_0639824
382 Ga0495623_0142749
383 Ga0495623_0490958
384 Ga0495669_0000904
385 Ga0495613_0377206
386 Ga0495624_0000242
387 Ga0495674_0000030
388 Ga0495676_0000131
389 Ga0495676_0267240
390 Ga0495680_0000241
391 Ga0495675_0062703
392 Ga0495593_0051787
393 Ga0495593_0097469
394 Ga0495593_0279048
395 Ga0495602_0000571
396 Ga0495602_0169399
397 Ga0495602_0287328
398 Ga0496100_0000013
399 Ga0496101_0000035
400 Ga0496102_0662117
401 Ga0496102_1038166
402 Ga0496103_0227852
403 Ga0496103_0406110
404 Ga0496104_0000015
405 Ga0496104_0000052
406 Ga0496104_1092154
407 Ga0496105_0000004
408 Ga0496105_0000030
409 Ga0496105_0505928
410 Ga0496106_0000062
411 Ga0496107_0000020
412 Ga0496108_0000006
413 Ga0496108_0000137
414 Ga0496108_0749695
415 Ga0496109_0000009
416 Ga0496109_0000088
417 Ga0496109_0036242
418 Ga0496109_0161114
419 Ga0496109_0743415
420 Ga0496110_0018456
421 Ga0496110_0033211
422 Ga0496111_0020004
423 Ga0496111_0065904
424 Ga0496111_0203413
425 Ga0496112_0000025
426 Ga0496112_0545934
427 Ga0496112_0901522
428 Ga0496113_0002454
429 Ga0496113_0185467
430 Ga0496114_0000039
431 Ga0496115_0000011
432 Ga0496117_0138593
433 Ga0496119_0012335
434 Ga0496120_0121172
435 Ga0496124_0351400
436 Ga0496126_0028478
437 Ga0496126_0134856
438 Ga0501031_0001129
439 Ga0501032_0001889
440 Ga0501033_0001429
441 Ga0501034_0045739
442 Ga0501034_0072679
443 Ga0501034_0308286
444 Ga0501036_0001887
445 Ga0501037_0000985
446 Ga0501038_0002804
447 Ga0501039_0016006
448 Ga0501042_0016081
449 Ga0501042_0017416
450 Ga0501043_0002678
451 Ga0501043_0442812
452 Ga0501046_0002843
453 Ga0501047_0000430
454 Ga0501047_0086233
455 Ga0501048_0001723
456 Ga0501048_0155568
457 Ga0501068_0216686
458 Ga0501068_0315036
459 Ga0501068_0458353
460 Ga0501069_0009217
461 Ga0501069_0018141
462 Ga0501070_0000592
463 Ga0501070_0205921
464 Ga0501071_0224442
465 Ga0501071_0453345
466 Ga0501072_0127673
467 Ga0501073_0005921
468 Ga0501073_0303074
469 Ga0501074_0030104
470 Ga0501074_0119980
471 Ga0501079_0006383
472 Ga0501079_0016857
473 Ga0501080_0017371
474 Ga0501080_0341788
475 Ga0501081_0039293
476 Ga0501083_0005790
477 Ga0501035_0001710
478 Ga0501035_0358492
479 Ga0501044_0002472
480 Ga0501044_0008570
481 nmdc:mga03n38_597086_c1
482 nmdc:mga0qj67_56147_c1
483 nmdc:mga0a205_366_c1
484 Ga0495601_0000720
485 Ga0495601_0323621
486 Ga0495612_0069145
487 Ga0495655_0046554
488 Ga0495655_0053830
489 Ga0495619_0000010
490 Ga0500566_0013791
491 Ga0500641_0006256
492 Ga0501082_0010118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

6

145

0.98

PF08534

Redoxin

Redoxin

5

164

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9229 4 165
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.8953 4 165
5c04-assembly1.cif.gz_B crystal structure of the f37h mutant ahpe from mycobacterium tuberculosis 0.8932 2 166
5id2-assembly1.cif.gz_B asymmetry in the active site of mycobacterium tuberculosis ahpe upon exposure to mycothiol 0.8919 1 166
2cx4-assembly4.cif.gz_H crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the aeropyrum pernix k1 (form-2 crystal) 0.8918 4 165
ID Description Score Start End Superfamily
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9158 5 162 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9041 5 162 3.40.30.10
5id2B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8939 1 166 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.892 6 101 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8884 4 165 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1Q7X1B5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9693 1 163 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A2V8NWZ3-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9588 2 166 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A524JBM4-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9579 1 164 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A2V8RSS9-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9562 1 164 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A4R6XG83-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9551 2 164 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454

Map