F358104

General Info

Members Datasets Scaffolds Average Seq Length
246 180 236 213

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10508777|Ga0105240_105087772
Length 246
Sequence VIFTRYAQKSRKEIDMPKPWEGLIPQQDEAAFLAGFGSASRPMEVGSRPALIIVDMTRAFVDSAYPTGWSETGYPAAAANQRLLAAARDAGIPVFFTKSRAESAPAPTAAERGLWKHRAPRPPVDPDLPPGDVIVDQLTPVDGEVVINKGGKPSAFFGTPLSSLLTYHKIDTTIVTGMVTSGCVRATALDAFQSNYYVLVPYECCADRSQISHKVSLFDLHMKYADVVEMDETLDYLARVKAGEPD

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
3 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
4 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
5 2849560528 Caulobacter zeae 410 Isolate Unclassified
6 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
7 2851153111 Caulobacter radicis 736 Isolate Unclassified
8 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
9 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
75 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
76 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
81 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
118 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
123 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
139 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
147 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
150 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
162 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
163 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
169 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
170 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
171 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
172 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
173 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
176 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
177 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
178 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
179 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
180 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0.41
Isolates 4.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.79
Nodule 0
Rhizoplane 3.25
Rhizosphere 71.95
Stem 0
Stem Tuber 0
Unclassified 13.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10459429 3300005327 Bacteria 1098
2 Ga0070670_100100335 3300005331 Bacteria 2492
3 Ga0070682_100947373 3300005337 Bacteria 711
4 Ga0068868_100042550 3300005338 Bacteria 3546
5 Ga0070668_100007293 3300005347 Bacteria 8203
6 Ga0070669_100001821 3300005353 Bacteria 15344
7 Ga0070671_100000550 3300005355 Bacteria 26544
8 Ga0070671_100293223 3300005355 Bacteria 1384
9 Ga0070673_100052228 3300005364 Bacteria 3206
10 Ga0070659_100286952 3300005366 Bacteria 1370
11 Ga0070667_100370640 3300005367 Bacteria 1299
12 Ga0070667_100376672 3300005367 Bacteria 1289
13 Ga0070714_101224561 3300005435 Bacteria 732
14 Ga0070663_100108103 3300005455 Bacteria 2086
15 Ga0070663_100218882 3300005455 Bacteria 1494
16 Ga0070678_100414932 3300005456 Unclassified 1172
17 Ga0070662_100161446 3300005457 Bacteria 1753
18 Ga0070681_10000746 3300005458 Bacteria 27005
19 Ga0070681_10056390 3300005458 Bacteria 3910
20 Ga0070679_100003249 3300005530 Bacteria 14856
21 Ga0070679_100042305 3300005530 Bacteria 4536
22 Ga0070679_100208229 3300005530 Bacteria 1920
23 Ga0070665_100001419 3300005548 Bacteria 28085
24 Ga0070665_100216789 3300005548 Bacteria 1915
25 Ga0070665_100229816 3300005548 Bacteria 1855
26 Ga0070664_100243136 3300005564 Bacteria 1616
27 Ga0068864_100009601 3300005618 Bacteria 7979
28 Ga0068863_100216298 3300005841 Bacteria 1845
29 Ga0068858_100160667 3300005842 Bacteria 2115
30 Ga0068858_100470593 3300005842 Bacteria 1212
31 Ga0068858_100834800 3300005842 Bacteria 900
32 Ga0068860_100000075 3300005843 Bacteria 172873
33 Ga0068860_100050909 3300005843 Bacteria 3942
34 Ga0068862_100006986 3300005844 Bacteria 9368
35 Ga0081538_10001550 3300005981 Bacteria 23554
36 Ga0068871_100181035 3300006358 Unclassified 1811
37 Ga0105251_10005755 3300009011 Bacteria 8042
38 Ga0105240_10508777 3300009093 Bacteria 1338
39 Ga0105248_10030354 3300009177 Bacteria 6034
40 Ga0105248_10086491 3300009177 Bacteria 3527
41 Ga0157370_10286902 3300013104 Bacteria 1520
42 Ga0157370_10314663 3300013104 Unclassified 1444
43 Ga0157369_10072340 3300013105 Bacteria 3700
44 Ga0157369_10196954 3300013105 Bacteria 2115
45 Ga0157375_11198096 3300013308 Bacteria 891
46 Ga0163163_10009363 3300014325 Bacteria 8743
47 Ga0157376_10114696 3300014969 Bacteria 2378
48 Ga0163161_10003074 3300017792 Bacteria 11772
49 Ga0163161_10136976 3300017792 Bacteria 1851
50 Ga0224712_10021196 3300022467 Bacteria 2219
51 Ga0207713_1001366 3300025735 Bacteria 19848
52 Ga0207680_10091683 3300025903 Bacteria 1934
53 Ga0207707_10066555 3300025912 Bacteria 3138
54 Ga0207707_10234426 3300025912 Unclassified 1597
55 Ga0207707_10583173 3300025912 Bacteria 948
56 Ga0207657_10141955 3300025919 Bacteria 1962
57 Ga0207652_10023944 3300025921 Bacteria 5064
58 Ga0207652_10064592 3300025921 Bacteria 3167
59 Ga0207652_10255100 3300025921 Bacteria 1582
60 Ga0207681_10000328 3300025923 Bacteria 34223
61 Ga0207644_10000238 3300025931 Bacteria 37789
62 Ga0207644_10305819 3300025931 Bacteria 1282
63 Ga0207706_10137142 3300025933 Bacteria 2152
64 Ga0207679_10204927 3300025945 Bacteria 1650
65 Ga0207651_10070355 3300025960 Bacteria 2475
66 Ga0207668_10028805 3300025972 Bacteria 3635
67 Ga0207658_10006916 3300025986 Bacteria 7723
68 Ga0207658_10528651 3300025986 Bacteria 1053
69 Ga0207703_10282116 3300026035 Bacteria 1509
70 Ga0207703_10302770 3300026035 Bacteria 1458
71 Ga0207703_10565245 3300026035 Unclassified 1073
72 Ga0207678_10064740 3300026067 Bacteria 3141
73 Ga0207702_11014297 3300026078 Bacteria 823
74 Ga0207641_10009548 3300026088 Bacteria 7993
75 Ga0207641_10025621 3300026088 Bacteria 4862
76 Ga0207676_10198572 3300026095 Unclassified 1770
77 Ga0207674_10126193 3300026116 Bacteria 2525
78 Ga0268266_10000576 3300028379 Bacteria 50660
79 Ga0268266_10286130 3300028379 Bacteria 1534
80 Ga0268266_10489768 3300028379 Unclassified 1173
81 Ga0268265_10004716 3300028380 Bacteria 9413
82 Ga0268265_10093214 3300028380 Bacteria 2412
83 Ga0268264_10000136 3300028381 Bacteria 177180
84 Ga0268264_10005249 3300028381 Bacteria 10965
85 Ga0307517_10038047 3300028786 Bacteria 5347
86 Ga0307515_10000621 3300028794 Bacteria 82840
87 Ga0307511_10000585 3300030521 Bacteria 38993
88 Ga0307509_10012322 3300031507 Bacteria 10239
89 Ga0307509_10022839 3300031507 Bacteria 7038
90 Ga0307509_10049248 3300031507 Bacteria 4519
91 Ga0307508_10041035 3300031616 Bacteria 4154
92 Ga0307516_10124977 3300031730 Bacteria 2358
93 Ga0307518_10035510 3300031838 Bacteria 3620
94 Ga0307414_10004927 3300032004 Bacteria 7301
95 Ga0307507_10010947 3300033179 Bacteria 11555
96 Ga0307507_10020536 3300033179 Bacteria 7392
97 Ga0307510_10036960 3300033180 Bacteria 5427
98 Ga0373938_0055852 3300034957 Bacteria 912
99 Ga0373947_0090151 3300035725 Bacteria 1911
100 Ga0395898_0077376 3300037466 Bacteria 3212
101 Ga0395901_0820922 3300038443 Unclassified 917
102 Ga0439456_004332 3300042013 Bacteria 2872
103 Ga0439444_0055760 3300042437 Bacteria 814
104 Ga0451577_0482363 3300042876 Bacteria 1126
105 Ga0466968_0000008 3300044735 Bacteria 73540
106 Ga0466967_0000031 3300045976 Bacteria 56567
107 Ga0495627_000010 3300046453 Bacteria 381168
108 Ga0495627_000139 3300046453 Bacteria 86240
109 Ga0495627_000148 3300046453 Bacteria 84235
110 Ga0495592_0026217 3300046454 Bacteria 4421
111 Ga0495603_0044684 3300046455 Bacteria 2643
112 Ga0495591_000002 3300046458 Bacteria 455013
113 Ga0495629_0002429 3300046459 Bacteria 14302
114 Ga0495629_0016368 3300046459 Bacteria 5322
115 Ga0495638_0000024 3300046460 Bacteria 362116
116 Ga0495638_0015518 3300046460 Bacteria 5114
117 Ga0495638_0132424 3300046460 Bacteria 1463
118 Ga0495651_0004359 3300046462 Bacteria 10827
119 Ga0495653_0000142 3300046463 Bacteria 59557
120 Ga0495650_0001117 3300046471 Bacteria 29317
121 Ga0495650_0127102 3300046471 Bacteria 933
122 Ga0495582_0067251 3300046473 Bacteria 1980
123 Ga0495605_0004020 3300046474 Bacteria 8684
124 Ga0495585_0124518 3300046492 Bacteria 1361
125 Ga0495607_0000025 3300046501 Bacteria 159379
126 Ga0495607_0001882 3300046501 Bacteria 17812
127 Ga0495583_0000107 3300046506 Bacteria 139964
128 Ga0495606_0000468 3300046507 Bacteria 66350
129 Ga0495610_0000034 3300046512 Bacteria 201408
130 Ga0495616_0039747 3300046513 Bacteria 2407
131 Ga0495618_0392514 3300046514 Bacteria 850
132 Ga0495620_0027022 3300046515 Bacteria 2691
133 Ga0495630_0018906 3300046517 Bacteria 5065
134 Ga0495632_0000895 3300046519 Bacteria 26182
135 Ga0495632_0004279 3300046519 Bacteria 9747
136 Ga0495637_0000074 3300046520 Bacteria 80233
137 Ga0495637_0016780 3300046520 Bacteria 3421
138 Ga0495648_0000005 3300046524 Bacteria 362116
139 Ga0495648_0004256 3300046524 Bacteria 12280
140 Ga0495648_0046149 3300046524 Bacteria 2703
141 Ga0495642_0023379 3300046528 Bacteria 2439
142 Ga0495652_0074191 3300046529 Bacteria 2830
143 Ga0495654_0035649 3300046530 Bacteria 2503
144 Ga0495587_0164113 3300046536 Bacteria 1263
145 Ga0495597_0000011 3300046542 Bacteria 221377
146 Ga0495645_0044251 3300046543 Bacteria 3248
147 Ga0495633_0011649 3300046558 Bacteria 4726
148 Ga0495634_0000745 3300046642 Bacteria 31538
149 Ga0495635_0010791 3300046663 Bacteria 6400
150 Ga0495657_0007665 3300046675 Bacteria 8310
151 Ga0495646_0000930 3300046680 Bacteria 16647
152 Ga0495658_0132231 3300046683 Bacteria 1520
153 Ga0495669_0110245 3300046684 Bacteria 1285
154 Ga0495613_0000656 3300046689 Bacteria 27445
155 Ga0495671_0000051 3300046692 Bacteria 137094
156 Ga0495649_0000258 3300046694 Bacteria 47324
157 Ga0495600_0066277 3300046809 Bacteria 2360
158 Ga0495660_0003106 3300046810 Bacteria 10357
159 Ga0495660_0021847 3300046810 Bacteria 3660
160 Ga0495604_0000558 3300047317 Bacteria 32740
161 Ga0495636_0031547 3300047318 Bacteria 2173
162 Ga0495672_0009160 3300047320 Bacteria 7210
163 Ga0495676_0047114 3300047321 Bacteria 3490
164 Ga0495676_0050144 3300047321 Bacteria 3349
165 Ga0495683_0000213 3300047323 Bacteria 54740
166 Ga0495687_000466 3300047443 Bacteria 48926
167 Ga0495675_0064229 3300047444 Bacteria 2322
168 Ga0495679_004738 3300047446 Bacteria 6175
169 Ga0495673_0000134 3300047469 Bacteria 137094
170 Ga0495673_0001395 3300047469 Bacteria 19424
171 Ga0495681_0001635 3300047470 Bacteria 16638
172 Ga0495681_0024849 3300047470 Bacteria 3144
173 Ga0495686_0002236 3300047472 Bacteria 18709
174 Ga0495686_0093566 3300047472 Bacteria 1822
175 Ga0495593_0096538 3300047673 Bacteria 1518
176 Ga0495614_0000340 3300048089 Bacteria 18522
177 Ga0495615_0000099 3300048090 Bacteria 23891
178 Ga0496100_0161457 3300048903 Bacteria 1607
179 Ga0496101_0022211 3300048904 Bacteria 4367
180 Ga0496105_0050542 3300048908 Bacteria 3434
181 Ga0496108_0002879 3300048911 Bacteria 13805
182 Ga0496108_0014160 3300048911 Bacteria 6507
183 Ga0496108_0058562 3300048911 Bacteria 3238
184 Ga0496108_0579291 3300048911 Bacteria 978
185 Ga0496110_0576477 3300048913 Unclassified 1022
186 Ga0496116_0072812 3300048919 Bacteria 2170
187 Ga0496118_0035471 3300048921 Bacteria 4048
188 Ga0496120_0190138 3300048923 Bacteria 1001
189 Ga0496121_0005805 3300048924 Bacteria 15651
190 Ga0496122_0017522 3300048925 Bacteria 6690
191 Ga0496122_0128250 3300048925 Bacteria 1619
192 Ga0496122_0308475 3300048925 Unclassified 849
193 Ga0496123_0003903 3300048926 Bacteria 16209
194 Ga0496123_0005778 3300048926 Bacteria 12292
195 Ga0496124_0001757 3300048927 Bacteria 30268
196 Ga0496124_0106534 3300048927 Bacteria 2263
197 Ga0496124_0158323 3300048927 Bacteria 1768
198 Ga0496125_0004398 3300048928 Bacteria 16310
199 Ga0496125_0070053 3300048928 Bacteria 2748
200 Ga0496126_0139216 3300048929 Bacteria 2091
201 Ga0495678_000008 3300049459 Bacteria 445926
202 Ga0495678_046476 3300049459 Bacteria 1706
203 Ga0501034_0197564 3300049571 Bacteria 1971
204 Ga0500610_0256050 3300053079 Bacteria 803
205 Ga0495619_0043213 3300053085 Bacteria 2954
206 Ga0500643_000182 3300053087 Bacteria 60945
207 Ga0500644_0018563 3300053088 Bacteria 2040
208 Ga0500646_0022416 3300053090 Bacteria 1689
209 Ga0500650_0014569 3300053098 Bacteria 3329
210 Ga0500560_017967 3300053107 Bacteria 1963
211 Ga0500572_143443 3300053111 Bacteria 778
212 Ga0500595_112451 3300053119 Bacteria 773
213 Ga0500618_000102 3300053125 Bacteria 69637
214 Ga0500618_000588 3300053125 Bacteria 22454
215 Ga0500618_002389 3300053125 Bacteria 7158
216 Ga0500559_0000028 3300053136 Bacteria 117844
217 Ga0500559_0001414 3300053136 Bacteria 13623
218 Ga0500559_0006535 3300053136 Bacteria 5262
219 Ga0500568_0127040 3300053139 Bacteria 949
220 Ga0500573_0019620 3300053140 Bacteria 3868
221 Ga0500573_0027727 3300053140 Bacteria 3258
222 Ga0500573_0118103 3300053140 Unclassified 1479
223 Ga0500573_0176905 3300053140 Bacteria 1150
224 Ga0500573_0238734 3300053140 Bacteria 943
225 Ga0500573_0260666 3300053140 Unclassified 888
226 Ga0500577_0004185 3300053142 Bacteria 3795
227 Ga0500586_023272 3300053145 Bacteria 1975
228 Ga0500588_0083561 3300053146 Bacteria 1073
229 Ga0500590_308868 3300053148 Bacteria 590
230 Ga0500616_0082924 3300053153 Bacteria 1607
231 Ga0500622_0106332 3300053156 Bacteria 1376
232 Ga0500645_008282 3300053730 Bacteria 3559
233 Ga0500661_000106 3300055283 Bacteria 13514
234 Ga0590071_020160 3300059421 Bacteria 1570
235 Ga0590075_001038 3300059424 Bacteria 7175
236 Ga0590077_002509 3300059426 Bacteria 3902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053148 Ga0500590_308868 Ga0500590_308868_16_561 180
2 3300053156 Ga0500622_0106332 Ga0500622_0106332_811_1362 180
3 3300053153 Ga0500616_0082924 Ga0500616_0082924_669_1229 185
4 3300042876 Ga0451577_0482363 Ga0451577_0482363_413_1072 199
5 3300047318 Ga0495636_0031547 Ga0495636_0031547_155_757 199
6 3300046460 Ga0495638_0015518 Ga0495638_0015518_2599_3216 202
7 3300017792 Ga0163161_10003074 Ga0163161_100030749 204
8 3300048090 Ga0495615_0000099 Ga0495615_0000099_179_799 204
9 3300048925 Ga0496122_0017522 Ga0496122_0017522_5094_5714 204
10 3300048926 Ga0496123_0003903 Ga0496123_0003903_15451_16071 204
11 3300048928 Ga0496125_0070053 Ga0496125_0070053_1557_2177 204
12 3300053139 Ga0500568_0127040 Ga0500568_0127040_86_709 204
13 3300053146 Ga0500588_0083561 Ga0500588_0083561_352_975 204
14 iso_pu_bacteria 2738543034 2739366058 204
15 3300005347 Ga0070668_100007293 Ga0070668_1000072934 205
16 3300005353 Ga0070669_100001821 Ga0070669_1000018214 205
17 3300005355 Ga0070671_100000550 Ga0070671_10000055024 205
18 3300005548 Ga0070665_100001419 Ga0070665_1000014194 205
19 3300005842 Ga0068858_100160667 Ga0068858_1001606672 205
20 3300005843 Ga0068860_100050909 Ga0068860_1000509092 205
21 3300009011 Ga0105251_10005755 Ga0105251_100057552 205
22 3300009177 Ga0105248_10030354 Ga0105248_100303543 205
23 3300013105 Ga0157369_10196954 Ga0157369_101969543 205
24 3300017792 Ga0163161_10136976 Ga0163161_101369762 205
25 3300025735 Ga0207713_1001366 Ga0207713_10013666 205
26 3300025903 Ga0207680_10091683 Ga0207680_100916832 205
27 3300025923 Ga0207681_10000328 Ga0207681_1000032829 205
28 3300025931 Ga0207644_10000238 Ga0207644_1000023817 205
29 3300025972 Ga0207668_10028805 Ga0207668_100288052 205
30 3300025986 Ga0207658_10006916 Ga0207658_100069163 205
31 3300026035 Ga0207703_10302770 Ga0207703_103027702 205
32 3300026088 Ga0207641_10009548 Ga0207641_100095482 205
33 3300028379 Ga0268266_10000576 Ga0268266_1000057633 205
34 3300028380 Ga0268265_10093214 Ga0268265_100932142 205
35 3300028381 Ga0268264_10005249 Ga0268264_100052492 205
36 3300038443 Ga0395901_0820922 Ga0395901_0820922_80_700 205
37 3300046460 Ga0495638_0000024 Ga0495638_0000024_247996_248619 205
38 3300046506 Ga0495583_0000107 Ga0495583_0000107_116761_117384 205
39 3300046519 Ga0495632_0000895 Ga0495632_0000895_15548_16171 205
40 3300046524 Ga0495648_0000005 Ga0495648_0000005_247996_248619 205
41 3300046558 Ga0495633_0011649 Ga0495633_0011649_1238_1861 205
42 3300046692 Ga0495671_0000051 Ga0495671_0000051_22581_23204 205
43 3300047469 Ga0495673_0000134 Ga0495673_0000134_22581_23204 205
44 3300048919 Ga0496116_0072812 Ga0496116_0072812_373_996 205
45 3300048921 Ga0496118_0035471 Ga0496118_0035471_3196_3819 205
46 3300048923 Ga0496120_0190138 Ga0496120_0190138_345_968 205
47 3300048924 Ga0496121_0005805 Ga0496121_0005805_14144_14767 205
48 3300048925 Ga0496122_0128250 Ga0496122_0128250_304_927 205
49 3300048925 Ga0496122_0308475 Ga0496122_0308475_214_837 205
50 3300048927 Ga0496124_0106534 Ga0496124_0106534_1226_1849 205
51 3300048927 Ga0496124_0158323 Ga0496124_0158323_272_895 205
52 3300048928 Ga0496125_0004398 Ga0496125_0004398_5334_5957 205
53 3300053125 Ga0500618_002389 Ga0500618_002389_6395_7015 205
54 3300053119 Ga0500595_112451 Ga0500595_112451_76_699 206
55 3300005337 Ga0070682_100947373 Ga0070682_1009473731 207
56 3300005981 Ga0081538_10001550 Ga0081538_1000155020 207
57 3300042013 Ga0439456_004332 Ga0439456_004332_626_1252 207
58 3300042437 Ga0439444_0055760 Ga0439444_0055760_148_774 207
59 3300044735 Ga0466968_0000008 Ga0466968_0000008_18603_19232 207
60 3300046492 Ga0495585_0124518 Ga0495585_0124518_457_1086 207
61 3300047472 Ga0495686_0093566 Ga0495686_0093566_872_1498 207
62 3300048929 Ga0496126_0139216 Ga0496126_0139216_737_1366 207
63 3300053090 Ga0500646_0022416 Ga0500646_0022416_310_936 207
64 3300059421 Ga0590071_020160 Ga0590071_020160_547_1173 207
65 3300059424 Ga0590075_001038 Ga0590075_001038_4043_4669 207
66 3300059426 Ga0590077_002509 Ga0590077_002509_3051_3677 207
67 3300005367 Ga0070667_100370640 Ga0070667_1003706401 208
68 3300005367 Ga0070667_100376672 Ga0070667_1003766722 208
69 3300005548 Ga0070665_100216789 Ga0070665_1002167893 208
70 3300013308 Ga0157375_11198096 Ga0157375_111980961 208
71 3300025986 Ga0207658_10528651 Ga0207658_105286511 208
72 3300028379 Ga0268266_10489768 Ga0268266_104897682 208
73 3300028786 Ga0307517_10038047 Ga0307517_100380472 208
74 3300028794 Ga0307515_10000621 Ga0307515_100006219 208
75 3300031507 Ga0307509_10049248 Ga0307509_100492482 208
76 3300031616 Ga0307508_10041035 Ga0307508_100410353 208
77 3300033179 Ga0307507_10010947 Ga0307507_100109475 208
78 3300033179 Ga0307507_10020536 Ga0307507_100205362 208
79 3300034957 Ga0373938_0055852 Ga0373938_0055852_64_690 208
80 3300046453 Ga0495627_000148 Ga0495627_000148_10966_11595 208
81 3300046454 Ga0495592_0026217 Ga0495592_0026217_3490_4119 208
82 3300046459 Ga0495629_0002429 Ga0495629_0002429_8609_9238 208
83 3300046459 Ga0495629_0016368 Ga0495629_0016368_1399_2028 208
84 3300046460 Ga0495638_0132424 Ga0495638_0132424_478_1107 208
85 3300046462 Ga0495651_0004359 Ga0495651_0004359_3500_4129 208
86 3300046471 Ga0495650_0001117 Ga0495650_0001117_17745_18374 208
87 3300046471 Ga0495650_0127102 Ga0495650_0127102_11_640 208
88 3300046473 Ga0495582_0067251 Ga0495582_0067251_1216_1845 208
89 3300046512 Ga0495610_0000034 Ga0495610_0000034_188494_189123 208
90 3300046514 Ga0495618_0392514 Ga0495618_0392514_19_648 208
91 3300046515 Ga0495620_0027022 Ga0495620_0027022_724_1353 208
92 3300046517 Ga0495630_0018906 Ga0495630_0018906_810_1439 208
93 3300046519 Ga0495632_0004279 Ga0495632_0004279_8207_8836 208
94 3300046529 Ga0495652_0074191 Ga0495652_0074191_2083_2712 208
95 3300046536 Ga0495587_0164113 Ga0495587_0164113_352_981 208
96 3300046543 Ga0495645_0044251 Ga0495645_0044251_2200_2829 208
97 3300046642 Ga0495634_0000745 Ga0495634_0000745_13925_14554 208
98 3300046663 Ga0495635_0010791 Ga0495635_0010791_579_1208 208
99 3300046675 Ga0495657_0007665 Ga0495657_0007665_238_867 208
100 3300046680 Ga0495646_0000930 Ga0495646_0000930_15144_15773 208
101 3300046683 Ga0495658_0132231 Ga0495658_0132231_648_1277 208
102 3300046689 Ga0495613_0000656 Ga0495613_0000656_7630_8259 208
103 3300046809 Ga0495600_0066277 Ga0495600_0066277_1594_2223 208
104 3300047317 Ga0495604_0000558 Ga0495604_0000558_12475_13104 208
105 3300047321 Ga0495676_0047114 Ga0495676_0047114_2056_2685 208
106 3300047444 Ga0495675_0064229 Ga0495675_0064229_1491_2120 208
107 3300047470 Ga0495681_0001635 Ga0495681_0001635_5030_5659 208
108 3300047470 Ga0495681_0024849 Ga0495681_0024849_607_1236 208
109 3300047673 Ga0495593_0096538 Ga0495593_0096538_530_1159 208
110 3300048089 Ga0495614_0000340 Ga0495614_0000340_14568_15197 208
111 3300049571 Ga0501034_0197564 Ga0501034_0197564_1195_1824 208
112 3300053079 Ga0500610_0256050 Ga0500610_0256050_59_688 208
113 3300053088 Ga0500644_0018563 Ga0500644_0018563_598_1227 208
114 3300053107 Ga0500560_017967 Ga0500560_017967_1181_1810 208
115 3300053111 Ga0500572_143443 Ga0500572_143443_84_713 208
116 iso_pu_bacteria 2791355048 2792459688 208
117 iso_pu_bacteria 2843744320 2843747344 208
118 iso_pu_bacteria 2849560528 2849563240 208
119 iso_pu_bacteria 2849573788 2849576792 208
120 iso_pu_bacteria 2851153111 2851157976 208
121 iso_pu_bacteria 2898329390 2898333736 208
122 3300005435 Ga0070714_101224561 Ga0070714_1012245611 209
123 3300030521 Ga0307511_10000585 Ga0307511_1000058522 209
124 3300031507 Ga0307509_10012322 Ga0307509_100123222 209
125 3300031730 Ga0307516_10124977 Ga0307516_101249772 209
126 3300031838 Ga0307518_10035510 Ga0307518_100355103 209
127 3300033180 Ga0307510_10036960 Ga0307510_100369602 209
128 3300046455 Ga0495603_0044684 Ga0495603_0044684_1167_1799 209
129 3300046463 Ga0495653_0000142 Ga0495653_0000142_50414_51046 209
130 3300046507 Ga0495606_0000468 Ga0495606_0000468_8566_9198 209
131 3300046520 Ga0495637_0016780 Ga0495637_0016780_33_665 209
132 3300046524 Ga0495648_0046149 Ga0495648_0046149_1976_2608 209
133 3300047321 Ga0495676_0050144 Ga0495676_0050144_2497_3129 209
134 3300047443 Ga0495687_000466 Ga0495687_000466_46028_46660 209
135 3300049459 Ga0495678_046476 Ga0495678_046476_78_710 209
136 3300053140 Ga0500573_0176905 Ga0500573_0176905_384_1055 209
137 3300053145 Ga0500586_023272 Ga0500586_023272_95_727 209
138 3300005458 Ga0070681_10000746 Ga0070681_1000074611 210
139 3300005530 Ga0070679_100003249 Ga0070679_1000032493 210
140 3300005530 Ga0070679_100208229 Ga0070679_1002082292 210
141 3300025912 Ga0207707_10234426 Ga0207707_102344262 210
142 3300025921 Ga0207652_10023944 Ga0207652_100239444 210
143 3300046501 Ga0495607_0001882 Ga0495607_0001882_219_854 210
144 3300046513 Ga0495616_0039747 Ga0495616_0039747_1065_1700 210
145 3300046694 Ga0495649_0000258 Ga0495649_0000258_24730_25365 210
146 3300047323 Ga0495683_0000213 Ga0495683_0000213_8739_9374 210
147 3300053125 Ga0500618_000588 Ga0500618_000588_65_700 210
148 3300053140 Ga0500573_0118103 Ga0500573_0118103_458_1159 210
149 iso_pu_bacteria 8054302542 8054305174 210
150 3300005331 Ga0070670_100100335 Ga0070670_1001003352 211
151 3300005338 Ga0068868_100042550 Ga0068868_1000425502 211
152 3300005355 Ga0070671_100293223 Ga0070671_1002932232 211
153 3300005364 Ga0070673_100052228 Ga0070673_1000522283 211
154 3300005456 Ga0070678_100414932 Ga0070678_1004149322 211
155 3300005457 Ga0070662_100161446 Ga0070662_1001614462 211
156 3300005564 Ga0070664_100243136 Ga0070664_1002431362 211
157 3300005618 Ga0068864_100009601 Ga0068864_1000096013 211
158 3300005841 Ga0068863_100216298 Ga0068863_1002162982 211
159 3300005842 Ga0068858_100834800 Ga0068858_1008348002 211
160 3300006358 Ga0068871_100181035 Ga0068871_1001810353 211
161 3300009177 Ga0105248_10086491 Ga0105248_100864912 211
162 3300014325 Ga0163163_10009363 Ga0163163_100093635 211
163 3300014969 Ga0157376_10114696 Ga0157376_101146962 211
164 3300025931 Ga0207644_10305819 Ga0207644_103058192 211
165 3300025933 Ga0207706_10137142 Ga0207706_101371422 211
166 3300025945 Ga0207679_10204927 Ga0207679_102049272 211
167 3300025960 Ga0207651_10070355 Ga0207651_100703552 211
168 3300026035 Ga0207703_10565245 Ga0207703_105652452 211
169 3300026088 Ga0207641_10025621 Ga0207641_100256218 211
170 3300026095 Ga0207676_10198572 Ga0207676_101985723 211
171 3300032004 Ga0307414_10004927 Ga0307414_100049275 211
172 3300046453 Ga0495627_000010 Ga0495627_000010_42617_43255 211
173 3300046453 Ga0495627_000139 Ga0495627_000139_52748_53386 211
174 3300046458 Ga0495591_000002 Ga0495591_000002_299298_299936 211
175 3300046474 Ga0495605_0004020 Ga0495605_0004020_6038_6676 211
176 3300046501 Ga0495607_0000025 Ga0495607_0000025_24272_24910 211
177 3300046520 Ga0495637_0000074 Ga0495637_0000074_70219_70857 211
178 3300046524 Ga0495648_0004256 Ga0495648_0004256_11531_12169 211
179 3300046528 Ga0495642_0023379 Ga0495642_0023379_1467_2105 211
180 3300046530 Ga0495654_0035649 Ga0495654_0035649_971_1609 211
181 3300046542 Ga0495597_0000011 Ga0495597_0000011_63074_63712 211
182 3300046684 Ga0495669_0110245 Ga0495669_0110245_479_1117 211
183 3300046810 Ga0495660_0003106 Ga0495660_0003106_4485_5123 211
184 3300046810 Ga0495660_0021847 Ga0495660_0021847_1245_1883 211
185 3300047320 Ga0495672_0009160 Ga0495672_0009160_66_704 211
186 3300047469 Ga0495673_0001395 Ga0495673_0001395_4757_5395 211
187 3300048903 Ga0496100_0161457 Ga0496100_0161457_621_1295 211
188 3300048904 Ga0496101_0022211 Ga0496101_0022211_3084_3722 211
189 3300048908 Ga0496105_0050542 Ga0496105_0050542_1939_2613 211
190 3300048911 Ga0496108_0014160 Ga0496108_0014160_4074_4712 211
191 3300048911 Ga0496108_0058562 Ga0496108_0058562_795_1433 211
192 3300048913 Ga0496110_0576477 Ga0496110_0576477_44_682 211
193 3300048927 Ga0496124_0001757 Ga0496124_0001757_25698_26336 211
194 3300049459 Ga0495678_000008 Ga0495678_000008_60908_61546 211
195 3300053085 Ga0495619_0043213 Ga0495619_0043213_2116_2790 211
196 3300053087 Ga0500643_000182 Ga0500643_000182_21535_22173 211
197 3300053136 Ga0500559_0001414 Ga0500559_0001414_6229_6867 211
198 3300053140 Ga0500573_0027727 Ga0500573_0027727_2126_2764 211
199 3300055283 Ga0500661_000106 Ga0500661_000106_10615_11253 211
200 iso_pu_bacteria 2582581314 2585316586 211
201 3300005843 Ga0068860_100000075 Ga0068860_10000007553 212
202 3300005844 Ga0068862_100006986 Ga0068862_1000069866 212
203 3300028380 Ga0268265_10004716 Ga0268265_100047166 212
204 3300028381 Ga0268264_10000136 Ga0268264_1000013653 212
205 3300053730 Ga0500645_008282 Ga0500645_008282_743_1396 212
206 3300031507 Ga0307509_10022839 Ga0307509_100228395 213
207 3300047472 Ga0495686_0002236 Ga0495686_0002236_17315_17959 213
208 3300053136 Ga0500559_0006535 Ga0500559_0006535_2473_3117 213
209 3300013104 Ga0157370_10314663 Ga0157370_103146632 214
210 3300035725 Ga0373947_0090151 Ga0373947_0090151_386_1048 214
211 3300047446 Ga0495679_004738 Ga0495679_004738_5458_6105 214
212 3300048911 Ga0496108_0002879 Ga0496108_0002879_2018_2662 214
213 3300053098 Ga0500650_0014569 Ga0500650_0014569_775_1425 214
214 3300053125 Ga0500618_000102 Ga0500618_000102_35317_35964 214
215 3300053136 Ga0500559_0000028 Ga0500559_0000028_46134_46781 214
216 3300053140 Ga0500573_0238734 Ga0500573_0238734_200_847 214
217 3300053142 Ga0500577_0004185 Ga0500577_0004185_2029_2676 214
218 iso_pu_bacteria 2954002825 2954006700 215
219 3300045976 Ga0466967_0000031 Ga0466967_0000031_39200_39859 218
220 3300053140 Ga0500573_0260666 Ga0500573_0260666_200_877 218
221 3300005455 Ga0070663_100218882 Ga0070663_1002188822 219
222 3300053140 Ga0500573_0019620 Ga0500573_0019620_585_1253 221
223 3300048926 Ga0496123_0005778 Ga0496123_0005778_9447_10142 224
224 3300005455 Ga0070663_100108103 Ga0070663_1001081031 231
225 3300005458 Ga0070681_10056390 Ga0070681_100563904 231
226 3300005530 Ga0070679_100042305 Ga0070679_1000423053 231
227 3300005548 Ga0070665_100229816 Ga0070665_1002298161 231
228 3300022467 Ga0224712_10021196 Ga0224712_100211963 231
229 3300025912 Ga0207707_10066555 Ga0207707_100665554 231
230 3300025919 Ga0207657_10141955 Ga0207657_101419552 231
231 3300025921 Ga0207652_10064592 Ga0207652_100645922 231
232 3300026035 Ga0207703_10282116 Ga0207703_102821162 231
233 3300026067 Ga0207678_10064740 Ga0207678_100647402 231
234 3300026116 Ga0207674_10126193 Ga0207674_101261932 231
235 3300028379 Ga0268266_10286130 Ga0268266_102861302 231
236 3300037466 Ga0395898_0077376 Ga0395898_0077376_1797_2519 240
237 3300005327 Ga0070658_10459429 Ga0070658_104594291 241
238 3300005366 Ga0070659_100286952 Ga0070659_1002869521 241
239 3300005842 Ga0068858_100470593 Ga0068858_1004705932 241
240 3300009093 Ga0105240_10508777 Ga0105240_105087772 241
241 3300013104 Ga0157370_10286902 Ga0157370_102869021 241
242 3300013105 Ga0157369_10072340 Ga0157369_100723403 241
243 3300025912 Ga0207707_10583173 Ga0207707_105831731 241
244 3300025921 Ga0207652_10255100 Ga0207652_102551002 241
245 3300026078 Ga0207702_11014297 Ga0207702_110142971 241
246 3300048911 Ga0496108_0579291 Ga0496108_0579291_191_916 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

49

232

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hb7-assembly4.cif.gz_H the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.8858 43 231
1nf9-assembly1.cif.gz_A-2 crystal structure of phzd protein from pseudomonas aeruginosa 0.8789 42 229
1nf8-assembly1.cif.gz_A-2 crystal structure of phzd protein active site mutant with substrate 0.8787 42 229
3hb7-assembly1.cif.gz_E the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.8769 43 234
3hb7-assembly1.cif.gz_B the crystal structure of an isochorismatase-like hydrolase from alkaliphilus metalliredigens to 2.3a 0.8721 38 232
ID Description Score Start End Superfamily
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8785 43 231 3.40.50.850
3r77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8687 42 228 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8676 42 234 3.40.50.850
3hb7H00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8585 43 231 3.40.50.850
3irvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8579 42 235 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A6B1EHJ2-F1-model_v4 Isochorismatase family protein 0.9211 52 235 GO:0016787
AF-A0A6B1EHJ2-F1-model_v4 Isochorismatase family protein 0.9068 52 235 GO:0016787
AF-A0A117RNF7-F1-model_v4 Isochorismatase 0.9 40 235 GO:0016787
AF-A0A2E6VZI1-F1-model_v4 Hydrolase 0.8964 41 239 GO:0016787
AF-A0A7T8UMX8-F1-model_v4 deleted 0.8961 5 239

Feature Viewer

pLDDT pTM Quality
83.65 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map