F358196

General Info

Members Datasets Scaffolds Average Seq Length
246 170 492 143

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1000139|Ga0182006_100013931
Length 162
Sequence MTTVGIFLKFAATNTTNMPAISFFTESVSYNLPQKLKVKKWIKATIEKEGFKLQELNFIFCSDEYLLSINQQYLKHDTYTDIITFDNSEEEKQIVSDIFISIERVKENAKTFKTIEFDEVCRIMIHGTLHLLGYKDKGKAAKNLMTQKEDEYLSYRAEAGLI

Samples

Sample ID Description Type Environment
1 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
64 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
95 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
111 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
126 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
127 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
133 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
134 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
135 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
144 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
145 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
146 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
147 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
148 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
149 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
150 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
151 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
152 2738541302 Pedobacter sp. CF074 Isolate Unclassified
153 2739367651 Pedobacter sp. OK291 Isolate Unclassified
154 2739367656 Pedobacter sp. CF523 Isolate Unclassified
155 2739367663 Pedobacter sp. YR510 Isolate Unclassified
156 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
157 2818991437 Pedobacter terrae 518 Isolate Unclassified
158 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
159 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
160 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
161 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
162 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
163 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
164 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
165 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
166 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
167 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
168 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
169 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
170 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.06
Metatranscriptomes 0.81
Isolates 8.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.38
Nodule 0
Rhizoplane 0
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 4.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182006_1000139 3300015261 Bacteria 77918
2 JGI24737J22298_10002398 3300001990 Bacteria 6689
3 JGI24735J21928_10031796 3300002067 Unclassified 1563
4 JGI24744J21845_10004932 3300002077 Bacteria 2763
5 JGI25152J39213_1000337 3300002773 Bacteria 29791
6 JGI25150J39212_1000006 3300002774 Bacteria 257228
7 JGI25151J46595_10000024 3300003187 Bacteria 217596
8 JGI25153J46596_10000026 3300003215 Bacteria 217245
9 rootH1_10000946 3300003316 Bacteria 10781
10 rootH2_10017766 3300003320 Bacteria 41125
11 rootH2_10047223 3300003320 Bacteria 1504
12 rootH1_10006208 3300003323 Bacteria 16415
13 Ga0055536_1000002 3300003781 Bacteria 605605
14 Ga0055530_10004245 3300003791 Bacteria 7510
15 Ga0065714_10007905 3300005288 Bacteria 4064
16 Ga0065714_10064535 3300005288 Bacteria 40118
17 Ga0065704_10149533 3300005289 Bacteria 1441
18 Ga0070676_10006605 3300005328 Bacteria 6204
19 Ga0070683_100008640 3300005329 Bacteria 8657
20 Ga0070680_100880382 3300005336 Bacteria 772
21 Ga0068868_100399752 3300005338 Bacteria 1185
22 Ga0070660_100014745 3300005339 Bacteria 5638
23 Ga0070674_100683874 3300005356 Bacteria 875
24 Ga0070673_100002030 3300005364 Bacteria 12219
25 Ga0070688_101546003 3300005365 Unclassified 541
26 Ga0070659_100018457 3300005366 Bacteria 5265
27 Ga0070678_100001909 3300005456 Bacteria 11234
28 Ga0068867_100000088 3300005459 Bacteria 58016
29 Ga0070684_100235266 3300005535 Bacteria 1673
30 Ga0068853_100016429 3300005539 Bacteria 6091
31 Ga0068853_100148550 3300005539 Bacteria 2108
32 Ga0070672_100124256 3300005543 Bacteria 2115
33 Ga0068855_100003038 3300005563 Bacteria 20548
34 Ga0068855_100219607 3300005563 Bacteria 2132
35 Ga0068855_100609274 3300005563 Bacteria 1177
36 Ga0068857_100028153 3300005577 Bacteria 4957
37 Ga0068857_102035455 3300005577 Bacteria 563
38 Ga0068854_100352340 3300005578 Bacteria 1205
39 Ga0068856_100137981 3300005614 Bacteria 2445
40 Ga0068856_100183320 3300005614 Bacteria 2107
41 Ga0068852_100000711 3300005616 Bacteria 21776
42 Ga0068852_100100018 3300005616 Bacteria 2615
43 Ga0068852_101710592 3300005616 Bacteria 651
44 Ga0068866_10010478 3300005718 Bacteria 3977
45 Ga0068858_100148737 3300005842 Bacteria 2201
46 Ga0081539_10150075 3300005985 Bacteria 1122
47 Ga0097621_100000403 3300006237 Bacteria 30084
48 Ga0068871_100000458 3300006358 Bacteria 28019
49 Ga0068865_100000213 3300006881 Bacteria 32484
50 Ga0068865_100431759 3300006881 Bacteria 1085
51 Ga0105244_10003440 3300009036 Bacteria 11286
52 Ga0105240_10118733 3300009093 Bacteria 3187
53 Ga0105240_10210278 3300009093 Bacteria 2274
54 Ga0105240_10293305 3300009093 Bacteria 1863
55 Ga0105240_11239679 3300009093 Bacteria 788
56 Ga0105243_12193107 3300009148 Bacteria 589
57 Ga0105241_10024185 3300009174 Bacteria 4511
58 Ga0105241_10058405 3300009174 Bacteria 2963
59 Ga0105241_10245918 3300009174 Bacteria 1514
60 Ga0105242_10138131 3300009176 Bacteria 2112
61 Ga0105242_12079145 3300009176 Unclassified 611
62 Ga0105237_10003860 3300009545 Bacteria 17616
63 Ga0105237_10005599 3300009545 Bacteria 14157
64 Ga0105237_10014056 3300009545 Bacteria 8376
65 Ga0105238_10002163 3300009551 Bacteria 19861
66 Ga0105238_10348346 3300009551 Unclassified 1470
67 Ga0105239_10000014 3300010375 Bacteria 325391
68 Ga0105239_10003284 3300010375 Bacteria 19951
69 Ga0105239_10006938 3300010375 Bacteria 13065
70 Ga0157373_10000140 3300013100 Bacteria 57694
71 Ga0157373_10000951 3300013100 Bacteria 22467
72 Ga0157373_10836319 3300013100 Bacteria 680
73 Ga0157371_10000257 3300013102 Bacteria 73583
74 Ga0157371_10000367 3300013102 Bacteria 56890
75 Ga0157371_10189654 3300013102 Bacteria 1472
76 Ga0157370_10001916 3300013104 Bacteria 25589
77 Ga0157370_10018002 3300013104 Bacteria 7110
78 Ga0157370_10049020 3300013104 Unclassified 4045
79 Ga0157370_10104400 3300013104 Bacteria 2653
80 Ga0157370_10108330 3300013104 Bacteria 2598
81 Ga0157370_10118785 3300013104 Bacteria 2469
82 Ga0157369_10000152 3300013105 Bacteria 98031
83 Ga0157369_10026213 3300013105 Bacteria 6468
84 Ga0157374_10000861 3300013296 Bacteria 26521
85 Ga0157374_10003748 3300013296 Bacteria 12773
86 Ga0157374_10174019 3300013296 Bacteria 2101
87 Ga0157374_11131908 3300013296 Bacteria 803
88 Ga0157378_10011024 3300013297 Bacteria 7910
89 Ga0163162_10000011 3300013306 Bacteria 299877
90 Ga0163162_10140381 3300013306 Unclassified 2529
91 Ga0157372_10001036 3300013307 Bacteria 30412
92 Ga0157372_10003187 3300013307 Bacteria 17701
93 Ga0157372_10007564 3300013307 Bacteria 11552
94 Ga0157372_10037273 3300013307 Bacteria 5362
95 Ga0157372_10320592 3300013307 Bacteria 1804
96 Ga0157372_10364639 3300013307 Bacteria 1683
97 Ga0157375_10040101 3300013308 Bacteria 4512
98 Ga0157375_10372998 3300013308 Bacteria 1593
99 Ga0157375_12048024 3300013308 Bacteria 681
100 Ga0182008_10000046 3300014497 Bacteria 111777
101 Ga0157377_11112003 3300014745 Bacteria 606
102 Ga0182006_1000289 3300015261 Bacteria 44305
103 Ga0182006_1036670 3300015261 Bacteria 1948
104 Ga0182007_10000008 3300015262 Bacteria 332953
105 Ga0183373_1002 3300015682 Bacteria 990153
106 Ga0163161_10000355 3300017792 Bacteria 38658
107 Ga0163161_10000746 3300017792 Bacteria 25608
108 Ga0163161_10048931 3300017792 Bacteria 3054
109 Ga0163161_10079697 3300017792 Bacteria 2408
110 Ga0163161_10081219 3300017792 Bacteria 2387
111 Ga0163161_10373461 3300017792 Bacteria 1138
112 Ga0207425_1000003 3300025245 Bacteria 1145342
113 Ga0209129_1000022 3300025258 Bacteria 440876
114 Ga0209233_1002854 3300025261 Bacteria 6191
115 Ga0209676_1000022 3300025292 Bacteria 605659
116 Ga0209025_1000007 3300025294 Bacteria 1145109
117 Ga0209758_1000012 3300025297 Bacteria 949866
118 Ga0209050_1000020 3300025298 Bacteria 605671
119 Ga0207655_1027654 3300025728 Bacteria 2696
120 Ga0207642_10043586 3300025899 Bacteria 1980
121 Ga0207647_10000041 3300025904 Bacteria 92367
122 Ga0207645_10000910 3300025907 Bacteria 24550
123 Ga0207705_10000032 3300025909 Bacteria 224376
124 Ga0207654_10011486 3300025911 Bacteria 4519
125 Ga0207654_10131751 3300025911 Bacteria 1583
126 Ga0207695_10167022 3300025913 Bacteria 2128
127 Ga0207695_10218938 3300025913 Bacteria 1812
128 Ga0207695_10227083 3300025913 Bacteria 1773
129 Ga0207695_10847179 3300025913 Bacteria 794
130 Ga0207671_10000979 3300025914 Bacteria 35379
131 Ga0207671_10029420 3300025914 Bacteria 4101
132 Ga0207671_10078999 3300025914 Bacteria 2465
133 Ga0207657_10024086 3300025919 Bacteria 5651
134 Ga0207694_10047867 3300025924 Bacteria 3307
135 Ga0207690_10018553 3300025932 Bacteria 4268
136 Ga0207686_10039401 3300025934 Bacteria 2867
137 Ga0207704_10000272 3300025938 Bacteria 24862
138 Ga0207691_10076412 3300025940 Bacteria 3018
139 Ga0207661_10467337 3300025944 Bacteria 1150
140 Ga0207667_10439166 3300025949 Bacteria 1327
141 Ga0207651_10002710 3300025960 Bacteria 8490
142 Ga0207703_10122048 3300026035 Bacteria 2238
143 Ga0207639_10001292 3300026041 Bacteria 16904
144 Ga0207639_10139652 3300026041 Bacteria 2017
145 Ga0207702_10041869 3300026078 Bacteria 3840
146 Ga0207702_10173205 3300026078 Bacteria 1981
147 Ga0207648_10000075 3300026089 Bacteria 93756
148 Ga0207674_10038705 3300026116 Bacteria 4945
149 Ga0207683_10092591 3300026121 Bacteria 2693
150 Ga0207698_10013366 3300026142 Bacteria 5414
151 Ga0316176_1138145 3300030732 Bacteria 6542
152 Ga0316181_1188028 3300030744 Bacteria 2221
153 Ga0307408_100000164 3300031548 Bacteria 73855
154 Ga0307408_100001486 3300031548 Bacteria 17405
155 Ga0307408_100002065 3300031548 Bacteria 14449
156 Ga0307405_10000045 3300031731 Bacteria 71537
157 Ga0307413_10336803 3300031824 Bacteria 1159
158 Ga0307410_10737793 3300031852 Bacteria 833
159 Ga0307407_10000002 3300031903 Bacteria 323084
160 Ga0307412_10000697 3300031911 Bacteria 19377
161 Ga0307412_11781771 3300031911 Unclassified 566
162 Ga0307409_100256071 3300031995 Bacteria 1603
163 Ga0307416_100000005 3300032002 Bacteria 477728
164 Ga0307416_100207635 3300032002 Bacteria 1865
165 Ga0307416_101774448 3300032002 Bacteria 721
166 Ga0307414_10000109 3300032004 Bacteria 58307
167 Ga0307414_10001249 3300032004 Bacteria 13113
168 Ga0307414_10014884 3300032004 Bacteria 4681
169 Ga0307414_10268548 3300032004 Bacteria 1427
170 Ga0307414_10482499 3300032004 Bacteria 1093
171 Ga0307411_11579440 3300032005 Bacteria 605
172 Ga0395900_0000288 3300037418 Bacteria 75715
173 Ga0395898_1007044 3300037466 Unclassified 769
174 Ga0395901_0386729 3300038443 Bacteria 1439
175 Ga0451577_0001838 3300042876 Bacteria 27064
176 Ga0451577_0008882 3300042876 Bacteria 9728
177 Ga0453683_0275217 3300044673 Bacteria 1075
178 Ga0453684_0001177 3300044712 Bacteria 81167
179 Ga0453684_0003225 3300044712 Bacteria 37348
180 Ga0453684_1298432 3300044712 Bacteria 759
181 Ga0451576_0047577 3300045051 Bacteria 4508
182 Ga0495627_082056 3300046453 Bacteria 933
183 Ga0495583_0345983 3300046506 Bacteria 587
184 Ga0495606_0297873 3300046507 Bacteria 875
185 Ga0495610_0000084 3300046512 Bacteria 112459
186 Ga0495610_0000284 3300046512 Bacteria 52953
187 Ga0495637_0011821 3300046520 Bacteria 4184
188 Ga0495644_0005745 3300046523 Bacteria 4845
189 Ga0495642_0057953 3300046528 Bacteria 1603
190 Ga0495633_0098913 3300046558 Bacteria 1354
191 Ga0495633_0485141 3300046558 Bacteria 557
192 Ga0495668_0220015 3300046616 Bacteria 1040
193 Ga0495677_0015339 3300047445 Bacteria 2784
194 Ga0495681_0300671 3300047470 Bacteria 621
195 Ga0495686_0053164 3300047472 Bacteria 2539
196 Ga0496119_0527691 3300048922 Bacteria 546
197 Ga0501303_044635 3300049526 Bacteria 565
198 Ga0501317_063842 3300049533 Unclassified 609
199 Ga0501335_051263 3300049551 Bacteria 503
200 Ga0501033_0092935 3300049570 Bacteria 2206
201 Ga0501034_0003965 3300049571 Bacteria 16631
202 Ga0501034_0013701 3300049571 Bacteria 8338
203 Ga0501034_0123845 3300049571 Bacteria 2571
204 Ga0501038_0211858 3300049574 Bacteria 1550
205 Ga0501198_017974 3300049649 Bacteria 1103
206 Ga0501243_137398 3300049675 Unclassified 514
207 Ga0501249_036498 3300049679 Bacteria 1107
208 Ga0501241_005053 3300049758 Bacteria 2467
209 Ga0501044_0047831 3300049823 Bacteria 4423
210 Ga0501044_0110877 3300049823 Bacteria 2752
211 Ga0501212_106703 3300049851 Bacteria 531
212 nmdc:mga07m45_186439_c1 3300050496 Bacteria 1206
213 Ga0500635_0010665 3300053080 Bacteria 2589
214 Ga0500643_015233 3300053087 Bacteria 2642
215 Ga0500583_0030761 3300053092 Bacteria 2353
216 Ga0500651_0016452 3300053093 Bacteria 4550
217 Ga0500651_0095616 3300053093 Bacteria 1826
218 Ga0500650_0220624 3300053098 Bacteria 858
219 Ga0500555_002056 3300053103 Bacteria 5917
220 Ga0500557_001194 3300053105 Bacteria 4065
221 Ga0500594_0026367 3300053118 Bacteria 1497
222 Ga0500608_146983 3300053122 Unclassified 1038
223 Ga0500642_0064415 3300053130 Bacteria 1654
224 Ga0500642_0151190 3300053130 Bacteria 1089
225 Ga0500588_0158269 3300053146 Bacteria 823
226 Ga0500604_0004131 3300053151 Bacteria 3872
227 2586207177 2585427687 Bacteria 5544917
228 2738852760 2738541302 Bacteria 5944758
229 2739586685 2739367651 Bacteria 6359826
230 2739615023 2739367656 Bacteria 5152243
231 2739645854 2739367663 Bacteria 5040914
232 2776615816 2775506987 Bacteria 5373360
233 2819547122 2818991437 Bacteria 5805520
234 2842727129 2842722452 Bacteria 6263924
235 2842905098 2842903701 Bacteria 6986368
236 2842910869 2842909656 Bacteria 6185908
237 2849284080 2849281842 Bacteria 6065644
238 2857628039 2857627736 Bacteria 5625397
239 2895504274 2895498888 Bacteria 5283788
240 2902050571 2902048731 Bacteria 4976191
241 2904449728 2904445276 Bacteria 5310396
242 2919693479 2919692658 Bacteria 5943958
243 2945998028 2945997725 Bacteria 6404843
244 2954020489 2954016120 Bacteria 6446024
245 2977234790 2977232053 Bacteria 5485925
246 8055592105 8055588893 Bacteria 3619545
247 Ga0182006_1000139
248 JGI24737J22298_10002398
249 JGI24735J21928_10031796
250 JGI24744J21845_10004932
251 JGI25152J39213_1000337
252 JGI25150J39212_1000006
253 JGI25151J46595_10000024
254 JGI25153J46596_10000026
255 rootH1_10000946
256 rootH2_10017766
257 rootH2_10047223
258 rootH1_10006208
259 Ga0055536_1000002
260 Ga0055530_10004245
261 Ga0065714_10007905
262 Ga0065714_10064535
263 Ga0065704_10149533
264 Ga0070676_10006605
265 Ga0070683_100008640
266 Ga0070680_100880382
267 Ga0068868_100399752
268 Ga0070660_100014745
269 Ga0070674_100683874
270 Ga0070673_100002030
271 Ga0070688_101546003
272 Ga0070659_100018457
273 Ga0070678_100001909
274 Ga0068867_100000088
275 Ga0070684_100235266
276 Ga0068853_100016429
277 Ga0068853_100148550
278 Ga0070672_100124256
279 Ga0068855_100003038
280 Ga0068855_100219607
281 Ga0068855_100609274
282 Ga0068857_100028153
283 Ga0068857_102035455
284 Ga0068854_100352340
285 Ga0068856_100137981
286 Ga0068856_100183320
287 Ga0068852_100000711
288 Ga0068852_100100018
289 Ga0068852_101710592
290 Ga0068866_10010478
291 Ga0068858_100148737
292 Ga0081539_10150075
293 Ga0097621_100000403
294 Ga0068871_100000458
295 Ga0068865_100000213
296 Ga0068865_100431759
297 Ga0105244_10003440
298 Ga0105240_10118733
299 Ga0105240_10210278
300 Ga0105240_10293305
301 Ga0105240_11239679
302 Ga0105243_12193107
303 Ga0105241_10024185
304 Ga0105241_10058405
305 Ga0105241_10245918
306 Ga0105242_10138131
307 Ga0105242_12079145
308 Ga0105237_10003860
309 Ga0105237_10005599
310 Ga0105237_10014056
311 Ga0105238_10002163
312 Ga0105238_10348346
313 Ga0105239_10000014
314 Ga0105239_10003284
315 Ga0105239_10006938
316 Ga0157373_10000140
317 Ga0157373_10000951
318 Ga0157373_10836319
319 Ga0157371_10000257
320 Ga0157371_10000367
321 Ga0157371_10189654
322 Ga0157370_10001916
323 Ga0157370_10018002
324 Ga0157370_10049020
325 Ga0157370_10104400
326 Ga0157370_10108330
327 Ga0157370_10118785
328 Ga0157369_10000152
329 Ga0157369_10026213
330 Ga0157374_10000861
331 Ga0157374_10003748
332 Ga0157374_10174019
333 Ga0157374_11131908
334 Ga0157378_10011024
335 Ga0163162_10000011
336 Ga0163162_10140381
337 Ga0157372_10001036
338 Ga0157372_10003187
339 Ga0157372_10007564
340 Ga0157372_10037273
341 Ga0157372_10320592
342 Ga0157372_10364639
343 Ga0157375_10040101
344 Ga0157375_10372998
345 Ga0157375_12048024
346 Ga0182008_10000046
347 Ga0157377_11112003
348 Ga0182006_1000289
349 Ga0182006_1036670
350 Ga0182007_10000008
351 Ga0183373_1002
352 Ga0163161_10000355
353 Ga0163161_10000746
354 Ga0163161_10048931
355 Ga0163161_10079697
356 Ga0163161_10081219
357 Ga0163161_10373461
358 Ga0207425_1000003
359 Ga0209129_1000022
360 Ga0209233_1002854
361 Ga0209676_1000022
362 Ga0209025_1000007
363 Ga0209758_1000012
364 Ga0209050_1000020
365 Ga0207655_1027654
366 Ga0207642_10043586
367 Ga0207647_10000041
368 Ga0207645_10000910
369 Ga0207705_10000032
370 Ga0207654_10011486
371 Ga0207654_10131751
372 Ga0207695_10167022
373 Ga0207695_10218938
374 Ga0207695_10227083
375 Ga0207695_10847179
376 Ga0207671_10000979
377 Ga0207671_10029420
378 Ga0207671_10078999
379 Ga0207657_10024086
380 Ga0207694_10047867
381 Ga0207690_10018553
382 Ga0207686_10039401
383 Ga0207704_10000272
384 Ga0207691_10076412
385 Ga0207661_10467337
386 Ga0207667_10439166
387 Ga0207651_10002710
388 Ga0207703_10122048
389 Ga0207639_10001292
390 Ga0207639_10139652
391 Ga0207702_10041869
392 Ga0207702_10173205
393 Ga0207648_10000075
394 Ga0207674_10038705
395 Ga0207683_10092591
396 Ga0207698_10013366
397 Ga0316176_1138145
398 Ga0316181_1188028
399 Ga0307408_100000164
400 Ga0307408_100001486
401 Ga0307408_100002065
402 Ga0307405_10000045
403 Ga0307413_10336803
404 Ga0307410_10737793
405 Ga0307407_10000002
406 Ga0307412_10000697
407 Ga0307412_11781771
408 Ga0307409_100256071
409 Ga0307416_100000005
410 Ga0307416_100207635
411 Ga0307416_101774448
412 Ga0307414_10000109
413 Ga0307414_10001249
414 Ga0307414_10014884
415 Ga0307414_10268548
416 Ga0307414_10482499
417 Ga0307411_11579440
418 Ga0395900_0000288
419 Ga0395898_1007044
420 Ga0395901_0386729
421 Ga0451577_0001838
422 Ga0451577_0008882
423 Ga0453683_0275217
424 Ga0453684_0001177
425 Ga0453684_0003225
426 Ga0453684_1298432
427 Ga0451576_0047577
428 Ga0495627_082056
429 Ga0495583_0345983
430 Ga0495606_0297873
431 Ga0495610_0000084
432 Ga0495610_0000284
433 Ga0495637_0011821
434 Ga0495644_0005745
435 Ga0495642_0057953
436 Ga0495633_0098913
437 Ga0495633_0485141
438 Ga0495668_0220015
439 Ga0495677_0015339
440 Ga0495681_0300671
441 Ga0495686_0053164
442 Ga0496119_0527691
443 Ga0501303_044635
444 Ga0501317_063842
445 Ga0501335_051263
446 Ga0501033_0092935
447 Ga0501034_0003965
448 Ga0501034_0013701
449 Ga0501034_0123845
450 Ga0501038_0211858
451 Ga0501198_017974
452 Ga0501243_137398
453 Ga0501249_036498
454 Ga0501241_005053
455 Ga0501044_0047831
456 Ga0501044_0110877
457 Ga0501212_106703
458 nmdc:mga07m45_186439_c1
459 Ga0500635_0010665
460 Ga0500643_015233
461 Ga0500583_0030761
462 Ga0500651_0016452
463 Ga0500651_0095616
464 Ga0500650_0220624
465 Ga0500555_002056
466 Ga0500557_001194
467 Ga0500594_0026367
468 Ga0500608_146983
469 Ga0500642_0064415
470 Ga0500642_0151190
471 Ga0500588_0158269
472 Ga0500604_0004131
473 2586207177
474 2738852760
475 2739586685
476 2739615023
477 2739645854
478 2776615816
479 2819547122
480 2842727129
481 2842905098
482 2842910869
483 2849284080
484 2857628039
485 2895504274
486 2902050571
487 2904449728
488 2919693479
489 2945998028
490 2954020489
491 2977234790
492 8055592105

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02130

YbeY

Endoribonuclease YbeY

29

155

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.7952 1 142
1xm5-assembly1.cif.gz_A crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 0.7901 1 142
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.786 3 138
7y7o-assembly1.cif.gz_A crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus 0.761 3 139
1oz9-assembly1.cif.gz_A crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus 0.7565 3 138
ID Description Score Start End Superfamily
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8526 3 137 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8398 7 138 3.40.390.30
af_P9WGX9_1_163_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.8083 3 137 3.40.390.30
1oz9A00 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.786 3 138 3.40.390.30
af_Q2FY02_5_155_3.40.390.30 "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" 0.78 7 138 3.40.390.30
ID Description Score Start End GO Terms
AF-A0A1I0TBN0-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 1 1 138 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-C6XXH9-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.9977 1 139 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270
AF-A0A519IPG5-F1-model_v4 deleted 0.9975 1 113
AF-A0A4U9KQZ0-F1-model_v4 deleted 0.9975 41 140
AF-A0A519UST6-F1-model_v4 Endoribonuclease YbeY (EC 3.1.-.-) 0.997 1 140 GO:0004222
GO:0004521
GO:0005737
GO:0006364
GO:0008270

Map