F358196
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 170 | 492 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300015261|Ga0182006_1000139|Ga0182006_100013931 |
| Length | 162 |
| Sequence | MTTVGIFLKFAATNTTNMPAISFFTESVSYNLPQKLKVKKWIKATIEKEGFKLQELNFIFCSDEYLLSINQQYLKHDTYTDIITFDNSEEEKQIVSDIFISIERVKENAKTFKTIEFDEVCRIMIHGTLHLLGYKDKGKAAKNLMTQKEDEYLSYRAEAGLI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 38 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 62 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 64 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 95 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 96 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 97 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 98 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 105 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 106 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 107 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 111 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 112 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 113 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 126 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 127 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 133 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 134 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 135 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 136 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 138 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 139 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 140 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 141 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 142 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 143 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 144 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 145 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 146 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 147 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 148 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 149 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 150 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 151 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 152 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 153 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 154 | 2739367656 | Pedobacter sp. CF523 | Isolate | Unclassified |
| 155 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 156 | 2775506987 | Pedobacter ginsengisoli T01R-27 | Isolate | Unclassified |
| 157 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 158 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 159 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 160 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 161 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 162 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 163 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 164 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 165 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 166 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 167 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 168 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 169 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 170 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.06 |
| Metatranscriptomes | 0.81 |
| Isolates | 8.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.38 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 82.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182006_1000139 | 3300015261 | Bacteria | 77918 |
| 2 | JGI24737J22298_10002398 | 3300001990 | Bacteria | 6689 |
| 3 | JGI24735J21928_10031796 | 3300002067 | Unclassified | 1563 |
| 4 | JGI24744J21845_10004932 | 3300002077 | Bacteria | 2763 |
| 5 | JGI25152J39213_1000337 | 3300002773 | Bacteria | 29791 |
| 6 | JGI25150J39212_1000006 | 3300002774 | Bacteria | 257228 |
| 7 | JGI25151J46595_10000024 | 3300003187 | Bacteria | 217596 |
| 8 | JGI25153J46596_10000026 | 3300003215 | Bacteria | 217245 |
| 9 | rootH1_10000946 | 3300003316 | Bacteria | 10781 |
| 10 | rootH2_10017766 | 3300003320 | Bacteria | 41125 |
| 11 | rootH2_10047223 | 3300003320 | Bacteria | 1504 |
| 12 | rootH1_10006208 | 3300003323 | Bacteria | 16415 |
| 13 | Ga0055536_1000002 | 3300003781 | Bacteria | 605605 |
| 14 | Ga0055530_10004245 | 3300003791 | Bacteria | 7510 |
| 15 | Ga0065714_10007905 | 3300005288 | Bacteria | 4064 |
| 16 | Ga0065714_10064535 | 3300005288 | Bacteria | 40118 |
| 17 | Ga0065704_10149533 | 3300005289 | Bacteria | 1441 |
| 18 | Ga0070676_10006605 | 3300005328 | Bacteria | 6204 |
| 19 | Ga0070683_100008640 | 3300005329 | Bacteria | 8657 |
| 20 | Ga0070680_100880382 | 3300005336 | Bacteria | 772 |
| 21 | Ga0068868_100399752 | 3300005338 | Bacteria | 1185 |
| 22 | Ga0070660_100014745 | 3300005339 | Bacteria | 5638 |
| 23 | Ga0070674_100683874 | 3300005356 | Bacteria | 875 |
| 24 | Ga0070673_100002030 | 3300005364 | Bacteria | 12219 |
| 25 | Ga0070688_101546003 | 3300005365 | Unclassified | 541 |
| 26 | Ga0070659_100018457 | 3300005366 | Bacteria | 5265 |
| 27 | Ga0070678_100001909 | 3300005456 | Bacteria | 11234 |
| 28 | Ga0068867_100000088 | 3300005459 | Bacteria | 58016 |
| 29 | Ga0070684_100235266 | 3300005535 | Bacteria | 1673 |
| 30 | Ga0068853_100016429 | 3300005539 | Bacteria | 6091 |
| 31 | Ga0068853_100148550 | 3300005539 | Bacteria | 2108 |
| 32 | Ga0070672_100124256 | 3300005543 | Bacteria | 2115 |
| 33 | Ga0068855_100003038 | 3300005563 | Bacteria | 20548 |
| 34 | Ga0068855_100219607 | 3300005563 | Bacteria | 2132 |
| 35 | Ga0068855_100609274 | 3300005563 | Bacteria | 1177 |
| 36 | Ga0068857_100028153 | 3300005577 | Bacteria | 4957 |
| 37 | Ga0068857_102035455 | 3300005577 | Bacteria | 563 |
| 38 | Ga0068854_100352340 | 3300005578 | Bacteria | 1205 |
| 39 | Ga0068856_100137981 | 3300005614 | Bacteria | 2445 |
| 40 | Ga0068856_100183320 | 3300005614 | Bacteria | 2107 |
| 41 | Ga0068852_100000711 | 3300005616 | Bacteria | 21776 |
| 42 | Ga0068852_100100018 | 3300005616 | Bacteria | 2615 |
| 43 | Ga0068852_101710592 | 3300005616 | Bacteria | 651 |
| 44 | Ga0068866_10010478 | 3300005718 | Bacteria | 3977 |
| 45 | Ga0068858_100148737 | 3300005842 | Bacteria | 2201 |
| 46 | Ga0081539_10150075 | 3300005985 | Bacteria | 1122 |
| 47 | Ga0097621_100000403 | 3300006237 | Bacteria | 30084 |
| 48 | Ga0068871_100000458 | 3300006358 | Bacteria | 28019 |
| 49 | Ga0068865_100000213 | 3300006881 | Bacteria | 32484 |
| 50 | Ga0068865_100431759 | 3300006881 | Bacteria | 1085 |
| 51 | Ga0105244_10003440 | 3300009036 | Bacteria | 11286 |
| 52 | Ga0105240_10118733 | 3300009093 | Bacteria | 3187 |
| 53 | Ga0105240_10210278 | 3300009093 | Bacteria | 2274 |
| 54 | Ga0105240_10293305 | 3300009093 | Bacteria | 1863 |
| 55 | Ga0105240_11239679 | 3300009093 | Bacteria | 788 |
| 56 | Ga0105243_12193107 | 3300009148 | Bacteria | 589 |
| 57 | Ga0105241_10024185 | 3300009174 | Bacteria | 4511 |
| 58 | Ga0105241_10058405 | 3300009174 | Bacteria | 2963 |
| 59 | Ga0105241_10245918 | 3300009174 | Bacteria | 1514 |
| 60 | Ga0105242_10138131 | 3300009176 | Bacteria | 2112 |
| 61 | Ga0105242_12079145 | 3300009176 | Unclassified | 611 |
| 62 | Ga0105237_10003860 | 3300009545 | Bacteria | 17616 |
| 63 | Ga0105237_10005599 | 3300009545 | Bacteria | 14157 |
| 64 | Ga0105237_10014056 | 3300009545 | Bacteria | 8376 |
| 65 | Ga0105238_10002163 | 3300009551 | Bacteria | 19861 |
| 66 | Ga0105238_10348346 | 3300009551 | Unclassified | 1470 |
| 67 | Ga0105239_10000014 | 3300010375 | Bacteria | 325391 |
| 68 | Ga0105239_10003284 | 3300010375 | Bacteria | 19951 |
| 69 | Ga0105239_10006938 | 3300010375 | Bacteria | 13065 |
| 70 | Ga0157373_10000140 | 3300013100 | Bacteria | 57694 |
| 71 | Ga0157373_10000951 | 3300013100 | Bacteria | 22467 |
| 72 | Ga0157373_10836319 | 3300013100 | Bacteria | 680 |
| 73 | Ga0157371_10000257 | 3300013102 | Bacteria | 73583 |
| 74 | Ga0157371_10000367 | 3300013102 | Bacteria | 56890 |
| 75 | Ga0157371_10189654 | 3300013102 | Bacteria | 1472 |
| 76 | Ga0157370_10001916 | 3300013104 | Bacteria | 25589 |
| 77 | Ga0157370_10018002 | 3300013104 | Bacteria | 7110 |
| 78 | Ga0157370_10049020 | 3300013104 | Unclassified | 4045 |
| 79 | Ga0157370_10104400 | 3300013104 | Bacteria | 2653 |
| 80 | Ga0157370_10108330 | 3300013104 | Bacteria | 2598 |
| 81 | Ga0157370_10118785 | 3300013104 | Bacteria | 2469 |
| 82 | Ga0157369_10000152 | 3300013105 | Bacteria | 98031 |
| 83 | Ga0157369_10026213 | 3300013105 | Bacteria | 6468 |
| 84 | Ga0157374_10000861 | 3300013296 | Bacteria | 26521 |
| 85 | Ga0157374_10003748 | 3300013296 | Bacteria | 12773 |
| 86 | Ga0157374_10174019 | 3300013296 | Bacteria | 2101 |
| 87 | Ga0157374_11131908 | 3300013296 | Bacteria | 803 |
| 88 | Ga0157378_10011024 | 3300013297 | Bacteria | 7910 |
| 89 | Ga0163162_10000011 | 3300013306 | Bacteria | 299877 |
| 90 | Ga0163162_10140381 | 3300013306 | Unclassified | 2529 |
| 91 | Ga0157372_10001036 | 3300013307 | Bacteria | 30412 |
| 92 | Ga0157372_10003187 | 3300013307 | Bacteria | 17701 |
| 93 | Ga0157372_10007564 | 3300013307 | Bacteria | 11552 |
| 94 | Ga0157372_10037273 | 3300013307 | Bacteria | 5362 |
| 95 | Ga0157372_10320592 | 3300013307 | Bacteria | 1804 |
| 96 | Ga0157372_10364639 | 3300013307 | Bacteria | 1683 |
| 97 | Ga0157375_10040101 | 3300013308 | Bacteria | 4512 |
| 98 | Ga0157375_10372998 | 3300013308 | Bacteria | 1593 |
| 99 | Ga0157375_12048024 | 3300013308 | Bacteria | 681 |
| 100 | Ga0182008_10000046 | 3300014497 | Bacteria | 111777 |
| 101 | Ga0157377_11112003 | 3300014745 | Bacteria | 606 |
| 102 | Ga0182006_1000289 | 3300015261 | Bacteria | 44305 |
| 103 | Ga0182006_1036670 | 3300015261 | Bacteria | 1948 |
| 104 | Ga0182007_10000008 | 3300015262 | Bacteria | 332953 |
| 105 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 106 | Ga0163161_10000355 | 3300017792 | Bacteria | 38658 |
| 107 | Ga0163161_10000746 | 3300017792 | Bacteria | 25608 |
| 108 | Ga0163161_10048931 | 3300017792 | Bacteria | 3054 |
| 109 | Ga0163161_10079697 | 3300017792 | Bacteria | 2408 |
| 110 | Ga0163161_10081219 | 3300017792 | Bacteria | 2387 |
| 111 | Ga0163161_10373461 | 3300017792 | Bacteria | 1138 |
| 112 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 113 | Ga0209129_1000022 | 3300025258 | Bacteria | 440876 |
| 114 | Ga0209233_1002854 | 3300025261 | Bacteria | 6191 |
| 115 | Ga0209676_1000022 | 3300025292 | Bacteria | 605659 |
| 116 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 117 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 118 | Ga0209050_1000020 | 3300025298 | Bacteria | 605671 |
| 119 | Ga0207655_1027654 | 3300025728 | Bacteria | 2696 |
| 120 | Ga0207642_10043586 | 3300025899 | Bacteria | 1980 |
| 121 | Ga0207647_10000041 | 3300025904 | Bacteria | 92367 |
| 122 | Ga0207645_10000910 | 3300025907 | Bacteria | 24550 |
| 123 | Ga0207705_10000032 | 3300025909 | Bacteria | 224376 |
| 124 | Ga0207654_10011486 | 3300025911 | Bacteria | 4519 |
| 125 | Ga0207654_10131751 | 3300025911 | Bacteria | 1583 |
| 126 | Ga0207695_10167022 | 3300025913 | Bacteria | 2128 |
| 127 | Ga0207695_10218938 | 3300025913 | Bacteria | 1812 |
| 128 | Ga0207695_10227083 | 3300025913 | Bacteria | 1773 |
| 129 | Ga0207695_10847179 | 3300025913 | Bacteria | 794 |
| 130 | Ga0207671_10000979 | 3300025914 | Bacteria | 35379 |
| 131 | Ga0207671_10029420 | 3300025914 | Bacteria | 4101 |
| 132 | Ga0207671_10078999 | 3300025914 | Bacteria | 2465 |
| 133 | Ga0207657_10024086 | 3300025919 | Bacteria | 5651 |
| 134 | Ga0207694_10047867 | 3300025924 | Bacteria | 3307 |
| 135 | Ga0207690_10018553 | 3300025932 | Bacteria | 4268 |
| 136 | Ga0207686_10039401 | 3300025934 | Bacteria | 2867 |
| 137 | Ga0207704_10000272 | 3300025938 | Bacteria | 24862 |
| 138 | Ga0207691_10076412 | 3300025940 | Bacteria | 3018 |
| 139 | Ga0207661_10467337 | 3300025944 | Bacteria | 1150 |
| 140 | Ga0207667_10439166 | 3300025949 | Bacteria | 1327 |
| 141 | Ga0207651_10002710 | 3300025960 | Bacteria | 8490 |
| 142 | Ga0207703_10122048 | 3300026035 | Bacteria | 2238 |
| 143 | Ga0207639_10001292 | 3300026041 | Bacteria | 16904 |
| 144 | Ga0207639_10139652 | 3300026041 | Bacteria | 2017 |
| 145 | Ga0207702_10041869 | 3300026078 | Bacteria | 3840 |
| 146 | Ga0207702_10173205 | 3300026078 | Bacteria | 1981 |
| 147 | Ga0207648_10000075 | 3300026089 | Bacteria | 93756 |
| 148 | Ga0207674_10038705 | 3300026116 | Bacteria | 4945 |
| 149 | Ga0207683_10092591 | 3300026121 | Bacteria | 2693 |
| 150 | Ga0207698_10013366 | 3300026142 | Bacteria | 5414 |
| 151 | Ga0316176_1138145 | 3300030732 | Bacteria | 6542 |
| 152 | Ga0316181_1188028 | 3300030744 | Bacteria | 2221 |
| 153 | Ga0307408_100000164 | 3300031548 | Bacteria | 73855 |
| 154 | Ga0307408_100001486 | 3300031548 | Bacteria | 17405 |
| 155 | Ga0307408_100002065 | 3300031548 | Bacteria | 14449 |
| 156 | Ga0307405_10000045 | 3300031731 | Bacteria | 71537 |
| 157 | Ga0307413_10336803 | 3300031824 | Bacteria | 1159 |
| 158 | Ga0307410_10737793 | 3300031852 | Bacteria | 833 |
| 159 | Ga0307407_10000002 | 3300031903 | Bacteria | 323084 |
| 160 | Ga0307412_10000697 | 3300031911 | Bacteria | 19377 |
| 161 | Ga0307412_11781771 | 3300031911 | Unclassified | 566 |
| 162 | Ga0307409_100256071 | 3300031995 | Bacteria | 1603 |
| 163 | Ga0307416_100000005 | 3300032002 | Bacteria | 477728 |
| 164 | Ga0307416_100207635 | 3300032002 | Bacteria | 1865 |
| 165 | Ga0307416_101774448 | 3300032002 | Bacteria | 721 |
| 166 | Ga0307414_10000109 | 3300032004 | Bacteria | 58307 |
| 167 | Ga0307414_10001249 | 3300032004 | Bacteria | 13113 |
| 168 | Ga0307414_10014884 | 3300032004 | Bacteria | 4681 |
| 169 | Ga0307414_10268548 | 3300032004 | Bacteria | 1427 |
| 170 | Ga0307414_10482499 | 3300032004 | Bacteria | 1093 |
| 171 | Ga0307411_11579440 | 3300032005 | Bacteria | 605 |
| 172 | Ga0395900_0000288 | 3300037418 | Bacteria | 75715 |
| 173 | Ga0395898_1007044 | 3300037466 | Unclassified | 769 |
| 174 | Ga0395901_0386729 | 3300038443 | Bacteria | 1439 |
| 175 | Ga0451577_0001838 | 3300042876 | Bacteria | 27064 |
| 176 | Ga0451577_0008882 | 3300042876 | Bacteria | 9728 |
| 177 | Ga0453683_0275217 | 3300044673 | Bacteria | 1075 |
| 178 | Ga0453684_0001177 | 3300044712 | Bacteria | 81167 |
| 179 | Ga0453684_0003225 | 3300044712 | Bacteria | 37348 |
| 180 | Ga0453684_1298432 | 3300044712 | Bacteria | 759 |
| 181 | Ga0451576_0047577 | 3300045051 | Bacteria | 4508 |
| 182 | Ga0495627_082056 | 3300046453 | Bacteria | 933 |
| 183 | Ga0495583_0345983 | 3300046506 | Bacteria | 587 |
| 184 | Ga0495606_0297873 | 3300046507 | Bacteria | 875 |
| 185 | Ga0495610_0000084 | 3300046512 | Bacteria | 112459 |
| 186 | Ga0495610_0000284 | 3300046512 | Bacteria | 52953 |
| 187 | Ga0495637_0011821 | 3300046520 | Bacteria | 4184 |
| 188 | Ga0495644_0005745 | 3300046523 | Bacteria | 4845 |
| 189 | Ga0495642_0057953 | 3300046528 | Bacteria | 1603 |
| 190 | Ga0495633_0098913 | 3300046558 | Bacteria | 1354 |
| 191 | Ga0495633_0485141 | 3300046558 | Bacteria | 557 |
| 192 | Ga0495668_0220015 | 3300046616 | Bacteria | 1040 |
| 193 | Ga0495677_0015339 | 3300047445 | Bacteria | 2784 |
| 194 | Ga0495681_0300671 | 3300047470 | Bacteria | 621 |
| 195 | Ga0495686_0053164 | 3300047472 | Bacteria | 2539 |
| 196 | Ga0496119_0527691 | 3300048922 | Bacteria | 546 |
| 197 | Ga0501303_044635 | 3300049526 | Bacteria | 565 |
| 198 | Ga0501317_063842 | 3300049533 | Unclassified | 609 |
| 199 | Ga0501335_051263 | 3300049551 | Bacteria | 503 |
| 200 | Ga0501033_0092935 | 3300049570 | Bacteria | 2206 |
| 201 | Ga0501034_0003965 | 3300049571 | Bacteria | 16631 |
| 202 | Ga0501034_0013701 | 3300049571 | Bacteria | 8338 |
| 203 | Ga0501034_0123845 | 3300049571 | Bacteria | 2571 |
| 204 | Ga0501038_0211858 | 3300049574 | Bacteria | 1550 |
| 205 | Ga0501198_017974 | 3300049649 | Bacteria | 1103 |
| 206 | Ga0501243_137398 | 3300049675 | Unclassified | 514 |
| 207 | Ga0501249_036498 | 3300049679 | Bacteria | 1107 |
| 208 | Ga0501241_005053 | 3300049758 | Bacteria | 2467 |
| 209 | Ga0501044_0047831 | 3300049823 | Bacteria | 4423 |
| 210 | Ga0501044_0110877 | 3300049823 | Bacteria | 2752 |
| 211 | Ga0501212_106703 | 3300049851 | Bacteria | 531 |
| 212 | nmdc:mga07m45_186439_c1 | 3300050496 | Bacteria | 1206 |
| 213 | Ga0500635_0010665 | 3300053080 | Bacteria | 2589 |
| 214 | Ga0500643_015233 | 3300053087 | Bacteria | 2642 |
| 215 | Ga0500583_0030761 | 3300053092 | Bacteria | 2353 |
| 216 | Ga0500651_0016452 | 3300053093 | Bacteria | 4550 |
| 217 | Ga0500651_0095616 | 3300053093 | Bacteria | 1826 |
| 218 | Ga0500650_0220624 | 3300053098 | Bacteria | 858 |
| 219 | Ga0500555_002056 | 3300053103 | Bacteria | 5917 |
| 220 | Ga0500557_001194 | 3300053105 | Bacteria | 4065 |
| 221 | Ga0500594_0026367 | 3300053118 | Bacteria | 1497 |
| 222 | Ga0500608_146983 | 3300053122 | Unclassified | 1038 |
| 223 | Ga0500642_0064415 | 3300053130 | Bacteria | 1654 |
| 224 | Ga0500642_0151190 | 3300053130 | Bacteria | 1089 |
| 225 | Ga0500588_0158269 | 3300053146 | Bacteria | 823 |
| 226 | Ga0500604_0004131 | 3300053151 | Bacteria | 3872 |
| 227 | 2586207177 | 2585427687 | Bacteria | 5544917 |
| 228 | 2738852760 | 2738541302 | Bacteria | 5944758 |
| 229 | 2739586685 | 2739367651 | Bacteria | 6359826 |
| 230 | 2739615023 | 2739367656 | Bacteria | 5152243 |
| 231 | 2739645854 | 2739367663 | Bacteria | 5040914 |
| 232 | 2776615816 | 2775506987 | Bacteria | 5373360 |
| 233 | 2819547122 | 2818991437 | Bacteria | 5805520 |
| 234 | 2842727129 | 2842722452 | Bacteria | 6263924 |
| 235 | 2842905098 | 2842903701 | Bacteria | 6986368 |
| 236 | 2842910869 | 2842909656 | Bacteria | 6185908 |
| 237 | 2849284080 | 2849281842 | Bacteria | 6065644 |
| 238 | 2857628039 | 2857627736 | Bacteria | 5625397 |
| 239 | 2895504274 | 2895498888 | Bacteria | 5283788 |
| 240 | 2902050571 | 2902048731 | Bacteria | 4976191 |
| 241 | 2904449728 | 2904445276 | Bacteria | 5310396 |
| 242 | 2919693479 | 2919692658 | Bacteria | 5943958 |
| 243 | 2945998028 | 2945997725 | Bacteria | 6404843 |
| 244 | 2954020489 | 2954016120 | Bacteria | 6446024 |
| 245 | 2977234790 | 2977232053 | Bacteria | 5485925 |
| 246 | 8055592105 | 8055588893 | Bacteria | 3619545 |
| 247 | Ga0182006_1000139 | |||
| 248 | JGI24737J22298_10002398 | |||
| 249 | JGI24735J21928_10031796 | |||
| 250 | JGI24744J21845_10004932 | |||
| 251 | JGI25152J39213_1000337 | |||
| 252 | JGI25150J39212_1000006 | |||
| 253 | JGI25151J46595_10000024 | |||
| 254 | JGI25153J46596_10000026 | |||
| 255 | rootH1_10000946 | |||
| 256 | rootH2_10017766 | |||
| 257 | rootH2_10047223 | |||
| 258 | rootH1_10006208 | |||
| 259 | Ga0055536_1000002 | |||
| 260 | Ga0055530_10004245 | |||
| 261 | Ga0065714_10007905 | |||
| 262 | Ga0065714_10064535 | |||
| 263 | Ga0065704_10149533 | |||
| 264 | Ga0070676_10006605 | |||
| 265 | Ga0070683_100008640 | |||
| 266 | Ga0070680_100880382 | |||
| 267 | Ga0068868_100399752 | |||
| 268 | Ga0070660_100014745 | |||
| 269 | Ga0070674_100683874 | |||
| 270 | Ga0070673_100002030 | |||
| 271 | Ga0070688_101546003 | |||
| 272 | Ga0070659_100018457 | |||
| 273 | Ga0070678_100001909 | |||
| 274 | Ga0068867_100000088 | |||
| 275 | Ga0070684_100235266 | |||
| 276 | Ga0068853_100016429 | |||
| 277 | Ga0068853_100148550 | |||
| 278 | Ga0070672_100124256 | |||
| 279 | Ga0068855_100003038 | |||
| 280 | Ga0068855_100219607 | |||
| 281 | Ga0068855_100609274 | |||
| 282 | Ga0068857_100028153 | |||
| 283 | Ga0068857_102035455 | |||
| 284 | Ga0068854_100352340 | |||
| 285 | Ga0068856_100137981 | |||
| 286 | Ga0068856_100183320 | |||
| 287 | Ga0068852_100000711 | |||
| 288 | Ga0068852_100100018 | |||
| 289 | Ga0068852_101710592 | |||
| 290 | Ga0068866_10010478 | |||
| 291 | Ga0068858_100148737 | |||
| 292 | Ga0081539_10150075 | |||
| 293 | Ga0097621_100000403 | |||
| 294 | Ga0068871_100000458 | |||
| 295 | Ga0068865_100000213 | |||
| 296 | Ga0068865_100431759 | |||
| 297 | Ga0105244_10003440 | |||
| 298 | Ga0105240_10118733 | |||
| 299 | Ga0105240_10210278 | |||
| 300 | Ga0105240_10293305 | |||
| 301 | Ga0105240_11239679 | |||
| 302 | Ga0105243_12193107 | |||
| 303 | Ga0105241_10024185 | |||
| 304 | Ga0105241_10058405 | |||
| 305 | Ga0105241_10245918 | |||
| 306 | Ga0105242_10138131 | |||
| 307 | Ga0105242_12079145 | |||
| 308 | Ga0105237_10003860 | |||
| 309 | Ga0105237_10005599 | |||
| 310 | Ga0105237_10014056 | |||
| 311 | Ga0105238_10002163 | |||
| 312 | Ga0105238_10348346 | |||
| 313 | Ga0105239_10000014 | |||
| 314 | Ga0105239_10003284 | |||
| 315 | Ga0105239_10006938 | |||
| 316 | Ga0157373_10000140 | |||
| 317 | Ga0157373_10000951 | |||
| 318 | Ga0157373_10836319 | |||
| 319 | Ga0157371_10000257 | |||
| 320 | Ga0157371_10000367 | |||
| 321 | Ga0157371_10189654 | |||
| 322 | Ga0157370_10001916 | |||
| 323 | Ga0157370_10018002 | |||
| 324 | Ga0157370_10049020 | |||
| 325 | Ga0157370_10104400 | |||
| 326 | Ga0157370_10108330 | |||
| 327 | Ga0157370_10118785 | |||
| 328 | Ga0157369_10000152 | |||
| 329 | Ga0157369_10026213 | |||
| 330 | Ga0157374_10000861 | |||
| 331 | Ga0157374_10003748 | |||
| 332 | Ga0157374_10174019 | |||
| 333 | Ga0157374_11131908 | |||
| 334 | Ga0157378_10011024 | |||
| 335 | Ga0163162_10000011 | |||
| 336 | Ga0163162_10140381 | |||
| 337 | Ga0157372_10001036 | |||
| 338 | Ga0157372_10003187 | |||
| 339 | Ga0157372_10007564 | |||
| 340 | Ga0157372_10037273 | |||
| 341 | Ga0157372_10320592 | |||
| 342 | Ga0157372_10364639 | |||
| 343 | Ga0157375_10040101 | |||
| 344 | Ga0157375_10372998 | |||
| 345 | Ga0157375_12048024 | |||
| 346 | Ga0182008_10000046 | |||
| 347 | Ga0157377_11112003 | |||
| 348 | Ga0182006_1000289 | |||
| 349 | Ga0182006_1036670 | |||
| 350 | Ga0182007_10000008 | |||
| 351 | Ga0183373_1002 | |||
| 352 | Ga0163161_10000355 | |||
| 353 | Ga0163161_10000746 | |||
| 354 | Ga0163161_10048931 | |||
| 355 | Ga0163161_10079697 | |||
| 356 | Ga0163161_10081219 | |||
| 357 | Ga0163161_10373461 | |||
| 358 | Ga0207425_1000003 | |||
| 359 | Ga0209129_1000022 | |||
| 360 | Ga0209233_1002854 | |||
| 361 | Ga0209676_1000022 | |||
| 362 | Ga0209025_1000007 | |||
| 363 | Ga0209758_1000012 | |||
| 364 | Ga0209050_1000020 | |||
| 365 | Ga0207655_1027654 | |||
| 366 | Ga0207642_10043586 | |||
| 367 | Ga0207647_10000041 | |||
| 368 | Ga0207645_10000910 | |||
| 369 | Ga0207705_10000032 | |||
| 370 | Ga0207654_10011486 | |||
| 371 | Ga0207654_10131751 | |||
| 372 | Ga0207695_10167022 | |||
| 373 | Ga0207695_10218938 | |||
| 374 | Ga0207695_10227083 | |||
| 375 | Ga0207695_10847179 | |||
| 376 | Ga0207671_10000979 | |||
| 377 | Ga0207671_10029420 | |||
| 378 | Ga0207671_10078999 | |||
| 379 | Ga0207657_10024086 | |||
| 380 | Ga0207694_10047867 | |||
| 381 | Ga0207690_10018553 | |||
| 382 | Ga0207686_10039401 | |||
| 383 | Ga0207704_10000272 | |||
| 384 | Ga0207691_10076412 | |||
| 385 | Ga0207661_10467337 | |||
| 386 | Ga0207667_10439166 | |||
| 387 | Ga0207651_10002710 | |||
| 388 | Ga0207703_10122048 | |||
| 389 | Ga0207639_10001292 | |||
| 390 | Ga0207639_10139652 | |||
| 391 | Ga0207702_10041869 | |||
| 392 | Ga0207702_10173205 | |||
| 393 | Ga0207648_10000075 | |||
| 394 | Ga0207674_10038705 | |||
| 395 | Ga0207683_10092591 | |||
| 396 | Ga0207698_10013366 | |||
| 397 | Ga0316176_1138145 | |||
| 398 | Ga0316181_1188028 | |||
| 399 | Ga0307408_100000164 | |||
| 400 | Ga0307408_100001486 | |||
| 401 | Ga0307408_100002065 | |||
| 402 | Ga0307405_10000045 | |||
| 403 | Ga0307413_10336803 | |||
| 404 | Ga0307410_10737793 | |||
| 405 | Ga0307407_10000002 | |||
| 406 | Ga0307412_10000697 | |||
| 407 | Ga0307412_11781771 | |||
| 408 | Ga0307409_100256071 | |||
| 409 | Ga0307416_100000005 | |||
| 410 | Ga0307416_100207635 | |||
| 411 | Ga0307416_101774448 | |||
| 412 | Ga0307414_10000109 | |||
| 413 | Ga0307414_10001249 | |||
| 414 | Ga0307414_10014884 | |||
| 415 | Ga0307414_10268548 | |||
| 416 | Ga0307414_10482499 | |||
| 417 | Ga0307411_11579440 | |||
| 418 | Ga0395900_0000288 | |||
| 419 | Ga0395898_1007044 | |||
| 420 | Ga0395901_0386729 | |||
| 421 | Ga0451577_0001838 | |||
| 422 | Ga0451577_0008882 | |||
| 423 | Ga0453683_0275217 | |||
| 424 | Ga0453684_0001177 | |||
| 425 | Ga0453684_0003225 | |||
| 426 | Ga0453684_1298432 | |||
| 427 | Ga0451576_0047577 | |||
| 428 | Ga0495627_082056 | |||
| 429 | Ga0495583_0345983 | |||
| 430 | Ga0495606_0297873 | |||
| 431 | Ga0495610_0000084 | |||
| 432 | Ga0495610_0000284 | |||
| 433 | Ga0495637_0011821 | |||
| 434 | Ga0495644_0005745 | |||
| 435 | Ga0495642_0057953 | |||
| 436 | Ga0495633_0098913 | |||
| 437 | Ga0495633_0485141 | |||
| 438 | Ga0495668_0220015 | |||
| 439 | Ga0495677_0015339 | |||
| 440 | Ga0495681_0300671 | |||
| 441 | Ga0495686_0053164 | |||
| 442 | Ga0496119_0527691 | |||
| 443 | Ga0501303_044635 | |||
| 444 | Ga0501317_063842 | |||
| 445 | Ga0501335_051263 | |||
| 446 | Ga0501033_0092935 | |||
| 447 | Ga0501034_0003965 | |||
| 448 | Ga0501034_0013701 | |||
| 449 | Ga0501034_0123845 | |||
| 450 | Ga0501038_0211858 | |||
| 451 | Ga0501198_017974 | |||
| 452 | Ga0501243_137398 | |||
| 453 | Ga0501249_036498 | |||
| 454 | Ga0501241_005053 | |||
| 455 | Ga0501044_0047831 | |||
| 456 | Ga0501044_0110877 | |||
| 457 | Ga0501212_106703 | |||
| 458 | nmdc:mga07m45_186439_c1 | |||
| 459 | Ga0500635_0010665 | |||
| 460 | Ga0500643_015233 | |||
| 461 | Ga0500583_0030761 | |||
| 462 | Ga0500651_0016452 | |||
| 463 | Ga0500651_0095616 | |||
| 464 | Ga0500650_0220624 | |||
| 465 | Ga0500555_002056 | |||
| 466 | Ga0500557_001194 | |||
| 467 | Ga0500594_0026367 | |||
| 468 | Ga0500608_146983 | |||
| 469 | Ga0500642_0064415 | |||
| 470 | Ga0500642_0151190 | |||
| 471 | Ga0500588_0158269 | |||
| 472 | Ga0500604_0004131 | |||
| 473 | 2586207177 | |||
| 474 | 2738852760 | |||
| 475 | 2739586685 | |||
| 476 | 2739615023 | |||
| 477 | 2739645854 | |||
| 478 | 2776615816 | |||
| 479 | 2819547122 | |||
| 480 | 2842727129 | |||
| 481 | 2842905098 | |||
| 482 | 2842910869 | |||
| 483 | 2849284080 | |||
| 484 | 2857628039 | |||
| 485 | 2895504274 | |||
| 486 | 2902050571 | |||
| 487 | 2904449728 | |||
| 488 | 2919693479 | |||
| 489 | 2945998028 | |||
| 490 | 2954020489 | |||
| 491 | 2977234790 | |||
| 492 | 8055592105 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xm5-assembly1.cif.gz_A | crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 | 0.7952 | 1 | 142 |
| 1xm5-assembly1.cif.gz_A | crystal structure of metal-dependent hydrolase ybey from e. coli, pfam upf0054 | 0.7901 | 1 | 142 |
| 1oz9-assembly1.cif.gz_A | crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus | 0.786 | 3 | 138 |
| 7y7o-assembly1.cif.gz_A | crystal structure of metallo-endoribonuclease ybey from staphylococcus aureus | 0.761 | 3 | 139 |
| 1oz9-assembly1.cif.gz_A | crystal structure of aq_1354, a hypothetical protein from aquifex aeolicus | 0.7565 | 3 | 138 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8526 | 3 | 137 | 3.40.390.30 |
| af_Q2FY02_5_155_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8398 | 7 | 138 | 3.40.390.30 |
| af_P9WGX9_1_163_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.8083 | 3 | 137 | 3.40.390.30 |
| 1oz9A00 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.786 | 3 | 138 | 3.40.390.30 |
| af_Q2FY02_5_155_3.40.390.30 | "Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Metalloproteases (""zincins""), catalytic domain" | 0.78 | 7 | 138 | 3.40.390.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I0TBN0-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 1 | 1 | 138 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-C6XXH9-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.9977 | 1 | 139 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |
| AF-A0A519IPG5-F1-model_v4 | deleted | 0.9975 | 1 | 113 |
|
| AF-A0A4U9KQZ0-F1-model_v4 | deleted | 0.9975 | 41 | 140 |
|
| AF-A0A519UST6-F1-model_v4 | Endoribonuclease YbeY (EC 3.1.-.-) | 0.997 | 1 | 140 |
GO:0004222
GO:0004521 GO:0005737 GO:0006364 GO:0008270 |