F358200

General Info

Members Datasets Scaffolds Average Seq Length
246 166 492 300

Family's Representative Sequence

Representative Sequence 3300015690|Ga0183363_1015|Ga0183363_101559
Length 302
Sequence VATLGLSPADKQAVEDFRRDVVEPSMTSLVIIDFWAEWCGPCKALGPVLDKVAAAYADKGVVLAKVDTDKNQFIAAQFQIKSIPTVYAMFQGQLVADLTSARTESQLRTILDQLLKQLPIQSEAADAAAEIEPLIAMGEDVLASGDAERALSIFDQLFEMAPDNPAILSGRIRALVAAGQTDAAQAAIDALPADIKDAGIERAKAALALAQSAPQGEDTAGLAAEVAAHPDDHERRFALANAQMAAGDRDAAADNLLHIIAAERDWNEGAARQQLLKLFEVVGLMDPWVSTQRRRLSAILFG

Samples

Sample ID Description Type Environment
1 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
108 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
109 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
114 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
115 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
122 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
123 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
138 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
139 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
140 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
141 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
142 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
143 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
144 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
145 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
146 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
147 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
148 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
149 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
150 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
151 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
152 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
153 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
154 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
155 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
156 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
157 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
158 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
159 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
160 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
161 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
162 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
163 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
164 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
165 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
166 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.28
Metatranscriptomes 0.41
Isolates 7.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.81
Bulb 0
Endosphere 14.23
Nodule 0
Rhizoplane 0.81
Rhizosphere 71.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0183363_1015 3300015690 Bacteria 74376
2 SwRhRL2b_contig_335976 2162886007 Bacteria 7116
3 Ga0055536_1001850 3300003781 Bacteria 12368
4 Ga0055536_1006124 3300003781 Bacteria 5691
5 Ga0055536_1007381 3300003781 Bacteria 4934
6 Ga0055530_10000314 3300003791 Bacteria 44028
7 Ga0055531_10006136 3300003794 Bacteria 6878
8 Ga0055531_10014641 3300003794 Bacteria 3517
9 Ga0055531_10027872 3300003794 Bacteria 1965
10 Ga0065704_10071887 3300005289 Bacteria 9673
11 Ga0070658_10000003 3300005327 Bacteria 465963
12 Ga0070658_10000252 3300005327 Bacteria 47079
13 Ga0070658_10000304 3300005327 Bacteria 42569
14 Ga0070670_100001211 3300005331 Bacteria 20488
15 Ga0070666_10002955 3300005335 Bacteria 10299
16 Ga0070666_10056773 3300005335 Bacteria 2645
17 Ga0070660_100000348 3300005339 Bacteria 30900
18 Ga0070660_100018322 3300005339 Bacteria 5114
19 Ga0070692_10000249 3300005345 Bacteria 14903
20 Ga0070668_100000030 3300005347 Bacteria 87912
21 Ga0070668_100121105 3300005347 Bacteria 2091
22 Ga0070669_100000008 3300005353 Bacteria 226764
23 Ga0070669_100111085 3300005353 Bacteria 2080
24 Ga0070669_100145198 3300005353 Bacteria 1833
25 Ga0070671_100000010 3300005355 Bacteria 202799
26 Ga0070671_100001177 3300005355 Bacteria 19551
27 Ga0070667_100000071 3300005367 Bacteria 125713
28 Ga0070662_100051119 3300005457 Bacteria 2983
29 Ga0068853_100142729 3300005539 Bacteria 2150
30 Ga0070665_100051178 3300005548 Bacteria 4143
31 Ga0068855_100043171 3300005563 Bacteria 5342
32 Ga0068855_100199429 3300005563 Bacteria 2254
33 Ga0068854_100001776 3300005578 Bacteria 13129
34 Ga0068856_100005689 3300005614 Bacteria 12276
35 Ga0068852_100000183 3300005616 Bacteria 42580
36 Ga0068852_100000357 3300005616 Bacteria 30774
37 Ga0068864_100000851 3300005618 Bacteria 25734
38 Ga0068864_100002171 3300005618 Bacteria 16197
39 Ga0068861_100001538 3300005719 Bacteria 14628
40 Ga0068863_100004481 3300005841 Bacteria 13774
41 Ga0068863_100125707 3300005841 Bacteria 2446
42 Ga0068858_100015704 3300005842 Bacteria 7123
43 Ga0068860_100000049 3300005843 Bacteria 208782
44 Ga0068862_100000334 3300005844 Bacteria 51308
45 Ga0068862_100006425 3300005844 Bacteria 9771
46 Ga0075367_10001708 3300006178 Bacteria 9606
47 Ga0097620_100004236 3300006931 Bacteria 14649
48 Ga0105251_10014937 3300009011 Bacteria 4264
49 Ga0105240_10008858 3300009093 Bacteria 14330
50 Ga0105240_10028140 3300009093 Bacteria 7347
51 Ga0105240_10066732 3300009093 Bacteria 4462
52 Ga0105247_10001269 3300009101 Bacteria 18684
53 Ga0105237_10002109 3300009545 Bacteria 25103
54 Ga0105239_10000266 3300010375 Bacteria 77602
55 Ga0157371_10015280 3300013102 Bacteria 5764
56 Ga0157371_10037288 3300013102 Bacteria 3479
57 Ga0157370_10061123 3300013104 Bacteria 3575
58 Ga0163162_10045865 3300013306 Bacteria 4380
59 Ga0163161_10006712 3300017792 Bacteria 7964
60 Ga0206353_11828632 3300020082 Bacteria 4343
61 Ga0213873_10000016 3300021358 Bacteria 124829
62 Ga0213876_10000056 3300021384 Bacteria 135017
63 Ga0213876_10000250 3300021384 Bacteria 51059
64 Ga0209675_1000429 3300025291 Bacteria 33769
65 Ga0209676_1000146 3300025292 Bacteria 174095
66 Ga0209676_1000412 3300025292 Bacteria 77067
67 Ga0209676_1000599 3300025292 Bacteria 53258
68 Ga0209025_1005998 3300025294 Bacteria 9647
69 Ga0209050_1000254 3300025298 Bacteria 114395
70 Ga0209050_1000841 3300025298 Bacteria 42345
71 Ga0209050_1003926 3300025298 Bacteria 10520
72 Ga0209050_1027383 3300025298 Bacteria 1879
73 Ga0209257_1000267 3300025304 Bacteria 119949
74 Ga0209257_1000277 3300025304 Bacteria 114825
75 Ga0209257_1013867 3300025304 Bacteria 3528
76 Ga0207697_10000036 3300025315 Bacteria 49927
77 Ga0207680_10000044 3300025903 Bacteria 64236
78 Ga0207647_10017370 3300025904 Bacteria 4891
79 Ga0207705_10000005 3300025909 Bacteria 673478
80 Ga0207705_10000007 3300025909 Bacteria 597387
81 Ga0207705_10000265 3300025909 Bacteria 50412
82 Ga0207695_10004035 3300025913 Bacteria 20196
83 Ga0207695_10049012 3300025913 Bacteria 4456
84 Ga0207671_10017597 3300025914 Bacteria 5504
85 Ga0207657_10003426 3300025919 Bacteria 16933
86 Ga0207657_10016311 3300025919 Bacteria 7168
87 Ga0207681_10000002 3300025923 Bacteria 985597
88 Ga0207681_10008827 3300025923 Bacteria 6159
89 Ga0207694_10021237 3300025924 Bacteria 4918
90 Ga0207650_10001217 3300025925 Bacteria 18888
91 Ga0207644_10000002 3300025931 Bacteria 942221
92 Ga0207644_10000791 3300025931 Bacteria 20086
93 Ga0207690_10007990 3300025932 Bacteria 6281
94 Ga0207706_10299632 3300025933 Bacteria 1401
95 Ga0207667_10000038 3300025949 Bacteria 280720
96 Ga0207667_10009368 3300025949 Bacteria 11544
97 Ga0207667_10048955 3300025949 Bacteria 4466
98 Ga0207667_10171498 3300025949 Bacteria 2230
99 Ga0207667_10214829 3300025949 Bacteria 1971
100 Ga0207668_10000011 3300025972 Bacteria 184484
101 Ga0207668_10043269 3300025972 Bacteria 3055
102 Ga0207640_10000279 3300025981 Bacteria 34340
103 Ga0207658_10000014 3300025986 Bacteria 218248
104 Ga0207703_10001718 3300026035 Bacteria 19672
105 Ga0207639_10009382 3300026041 Bacteria 6747
106 Ga0207639_10076416 3300026041 Bacteria 2637
107 Ga0207678_10358621 3300026067 Bacteria 1258
108 Ga0207702_10005841 3300026078 Bacteria 10703
109 Ga0207702_10012369 3300026078 Bacteria 7106
110 Ga0207641_10000545 3300026088 Bacteria 42249
111 Ga0207641_10002975 3300026088 Bacteria 15333
112 Ga0207641_10375344 3300026088 Bacteria 1360
113 Ga0207676_10000489 3300026095 Bacteria 33247
114 Ga0207676_10004187 3300026095 Bacteria 10195
115 Ga0207674_10095817 3300026116 Bacteria 2953
116 Ga0207674_10159960 3300026116 Bacteria 2207
117 Ga0207675_100002191 3300026118 Bacteria 19409
118 Ga0207675_100114363 3300026118 Bacteria 2549
119 Ga0207698_10000120 3300026142 Bacteria 49131
120 Ga0207698_10000919 3300026142 Bacteria 17125
121 Ga0207698_10004603 3300026142 Bacteria 8423
122 Ga0209813_10000345 3300027866 Bacteria 11916
123 Ga0268266_10047748 3300028379 Bacteria 3669
124 Ga0268265_10001056 3300028380 Bacteria 24713
125 Ga0268265_10002184 3300028380 Bacteria 15120
126 Ga0268264_10000121 3300028381 Bacteria 190368
127 Ga0316183_1179489 3300030742 Bacteria 1518
128 Ga0307513_10024230 3300031456 Bacteria 7065
129 Ga0307408_100010846 3300031548 Bacteria 6012
130 Ga0307408_100045362 3300031548 Bacteria 3139
131 Ga0307405_10015300 3300031731 Bacteria 4152
132 Ga0307405_10028929 3300031731 Bacteria 3233
133 Ga0307413_10133788 3300031824 Bacteria 1701
134 Ga0307410_10043320 3300031852 Bacteria 2982
135 Ga0307406_10022321 3300031901 Bacteria 3753
136 Ga0307406_10291517 3300031901 Bacteria 1249
137 Ga0307407_10073443 3300031903 Bacteria 2044
138 Ga0307412_10005431 3300031911 Bacteria 7152
139 Ga0307412_10017372 3300031911 Bacteria 4306
140 Ga0307412_10037889 3300031911 Bacteria 3100
141 Ga0307412_10191129 3300031911 Bacteria 1548
142 Ga0307409_100194171 3300031995 Bacteria 1810
143 Ga0307416_100056218 3300032002 Bacteria 3174
144 Ga0307416_100108446 3300032002 Bacteria 2439
145 Ga0307414_10000122 3300032004 Bacteria 55018
146 Ga0307414_10069075 3300032004 Bacteria 2538
147 Ga0307414_10097843 3300032004 Bacteria 2200
148 Ga0307414_10337390 3300032004 Bacteria 1289
149 Ga0307411_10076536 3300032005 Bacteria 2288
150 Ga0307411_10204845 3300032005 Bacteria 1518
151 Ga0307415_100053207 3300032126 Bacteria 2757
152 Ga0436365_0062931 3300039437 Bacteria 52276
153 Ga0436365_0869628 3300039437 Bacteria 66366
154 Ga0436362_0580304 3300039453 Bacteria 124869
155 Ga0439445_0017270 3300042004 Bacteria 1783
156 Ga0439435_0024562 3300042436 Bacteria 1591
157 Ga0466972_0021601 3300044658 Bacteria 3207
158 Ga0466966_0177909 3300044684 Bacteria 1291
159 Ga0466961_0027358 3300044693 Bacteria 3667
160 Ga0466964_0093781 3300044706 Bacteria 1311
161 Ga0466971_0136455 3300044719 Bacteria 1141
162 Ga0466970_0026510 3300044765 Bacteria 3037
163 Ga0466960_0144126 3300044901 Bacteria 1267
164 Ga0466958_0233673 3300045836 Bacteria 1174
165 Ga0495627_000024 3300046453 Bacteria 250480
166 Ga0495627_009569 3300046453 Bacteria 3560
167 Ga0495584_0066955 3300046491 Bacteria 1806
168 Ga0495596_0002823 3300046500 Bacteria 9077
169 Ga0495606_0110972 3300046507 Bacteria 1654
170 Ga0495610_0000053 3300046512 Bacteria 142545
171 Ga0495610_0004173 3300046512 Bacteria 10803
172 Ga0495632_0000075 3300046519 Bacteria 102051
173 Ga0495632_0000306 3300046519 Bacteria 47401
174 Ga0495637_0000123 3300046520 Bacteria 57717
175 Ga0495643_0000009 3300046522 Bacteria 344767
176 Ga0495643_0000042 3300046522 Bacteria 229665
177 Ga0495643_0018114 3300046522 Bacteria 4101
178 Ga0495648_0052088 3300046524 Bacteria 2489
179 Ga0495663_0000003 3300046525 Bacteria 362694
180 Ga0495654_0041881 3300046530 Bacteria 2276
181 Ga0495598_0001924 3300046537 Bacteria 4207
182 Ga0495633_0005135 3300046558 Bacteria 8116
183 Ga0495633_0049138 3300046558 Bacteria 1991
184 Ga0495633_0100369 3300046558 Bacteria 1344
185 Ga0495668_0000015 3300046616 Bacteria 441932
186 Ga0495625_0000190 3300046660 Bacteria 97529
187 Ga0495661_0014114 3300046665 Bacteria 5353
188 Ga0495671_0000013 3300046692 Bacteria 344767
189 Ga0495681_0000099 3300047470 Bacteria 75808
190 Ga0495681_0001560 3300047470 Bacteria 17078
191 Ga0495686_0000091 3300047472 Bacteria 190563
192 Ga0495626_0000139 3300048091 Bacteria 92719
193 Ga0496108_0001530 3300048911 Bacteria 18310
194 Ga0496110_0060615 3300048913 Bacteria 3338
195 Ga0496116_0000045 3300048919 Bacteria 324307
196 Ga0496117_0057895 3300048920 Bacteria 2688
197 Ga0496118_0011213 3300048921 Bacteria 8776
198 Ga0496121_0000190 3300048924 Bacteria 136607
199 Ga0496121_0000930 3300048924 Bacteria 52952
200 Ga0496121_0005432 3300048924 Bacteria 16336
201 Ga0496121_0012164 3300048924 Bacteria 9442
202 Ga0496122_0005345 3300048925 Bacteria 15345
203 Ga0496122_0196950 3300048925 Bacteria 1182
204 Ga0496123_0001952 3300048926 Bacteria 26806
205 Ga0496124_0003632 3300048927 Bacteria 18723
206 Ga0496124_0013710 3300048927 Bacteria 7893
207 Ga0496125_0010180 3300048928 Bacteria 9531
208 Ga0496125_0016914 3300048928 Bacteria 6979
209 Ga0496126_0000519 3300048929 Bacteria 74968
210 Ga0496126_0002859 3300048929 Bacteria 22569
211 Ga0496126_0032193 3300048929 Bacteria 4943
212 Ga0496126_0062457 3300048929 Bacteria 3342
213 Ga0495678_011003 3300049459 Bacteria 4354
214 Ga0501034_0493524 3300049571 Bacteria 1139
215 nmdc:mga06z11_348_c1 3300050494 Bacteria 17434
216 nmdc:mga04h51_137_c1 3300050495 Bacteria 21470
217 nmdc:mga07m45_38630_c1 3300050496 Bacteria 2664
218 nmdc:mga0sz30_37694_c1 3300050516 Bacteria 1203
219 Ga0500592_003700 3300053116 Bacteria 2437
220 Ga0500618_012816 3300053125 Bacteria 2185
221 Ga0500568_0000634 3300053139 Bacteria 25303
222 Ga0500604_0038873 3300053151 Bacteria 1429
223 Ga0500624_000003 3300053157 Bacteria 253364
224 Ga0500624_000042 3300053157 Bacteria 90289
225 Ga0500624_000173 3300053157 Bacteria 25864
226 Ga0500627_0000008 3300053158 Bacteria 161914
227 Ga0500636_0007644 3300053177 Bacteria 6252
228 Ga0500637_0000073 3300053178 Bacteria 35884
229 2512645617 2512564014 Bacteria 4639632
230 2643820414 2643221560 Bacteria 4801179
231 2643834835 2643221563 Bacteria 4726935
232 2643951676 2643221588 Bacteria 3692460
233 2644055762 2643221608 Bacteria 4724829
234 2739651107 2739367664 Bacteria 4114334
235 2740029580 2739367865 Bacteria 4114482
236 2809062598 2808606401 Bacteria 4586670
237 2809078718 2808606404 Bacteria 4652788
238 2809082987 2808606405 Bacteria 4586632
239 2819551419 2818991438 Bacteria 5793701
240 2852656110 2852653556 Bacteria 4050083
241 2852682837 2852680915 Bacteria 4100189
242 2880521596 2880518877 Bacteria 5012590
243 2919709530 2919709256 Bacteria 4318106
244 2990268163 2990265787 Bacteria 3943888
245 2993696812 2993693658 Bacteria 4040749
246 8054305104 8054302542 Bacteria 5698134
247 Ga0183363_1015
248 SwRhRL2b_contig_335976
249 Ga0055536_1001850
250 Ga0055536_1006124
251 Ga0055536_1007381
252 Ga0055530_10000314
253 Ga0055531_10006136
254 Ga0055531_10014641
255 Ga0055531_10027872
256 Ga0065704_10071887
257 Ga0070658_10000003
258 Ga0070658_10000252
259 Ga0070658_10000304
260 Ga0070670_100001211
261 Ga0070666_10002955
262 Ga0070666_10056773
263 Ga0070660_100000348
264 Ga0070660_100018322
265 Ga0070692_10000249
266 Ga0070668_100000030
267 Ga0070668_100121105
268 Ga0070669_100000008
269 Ga0070669_100111085
270 Ga0070669_100145198
271 Ga0070671_100000010
272 Ga0070671_100001177
273 Ga0070667_100000071
274 Ga0070662_100051119
275 Ga0068853_100142729
276 Ga0070665_100051178
277 Ga0068855_100043171
278 Ga0068855_100199429
279 Ga0068854_100001776
280 Ga0068856_100005689
281 Ga0068852_100000183
282 Ga0068852_100000357
283 Ga0068864_100000851
284 Ga0068864_100002171
285 Ga0068861_100001538
286 Ga0068863_100004481
287 Ga0068863_100125707
288 Ga0068858_100015704
289 Ga0068860_100000049
290 Ga0068862_100000334
291 Ga0068862_100006425
292 Ga0075367_10001708
293 Ga0097620_100004236
294 Ga0105251_10014937
295 Ga0105240_10008858
296 Ga0105240_10028140
297 Ga0105240_10066732
298 Ga0105247_10001269
299 Ga0105237_10002109
300 Ga0105239_10000266
301 Ga0157371_10015280
302 Ga0157371_10037288
303 Ga0157370_10061123
304 Ga0163162_10045865
305 Ga0163161_10006712
306 Ga0206353_11828632
307 Ga0213873_10000016
308 Ga0213876_10000056
309 Ga0213876_10000250
310 Ga0209675_1000429
311 Ga0209676_1000146
312 Ga0209676_1000412
313 Ga0209676_1000599
314 Ga0209025_1005998
315 Ga0209050_1000254
316 Ga0209050_1000841
317 Ga0209050_1003926
318 Ga0209050_1027383
319 Ga0209257_1000267
320 Ga0209257_1000277
321 Ga0209257_1013867
322 Ga0207697_10000036
323 Ga0207680_10000044
324 Ga0207647_10017370
325 Ga0207705_10000005
326 Ga0207705_10000007
327 Ga0207705_10000265
328 Ga0207695_10004035
329 Ga0207695_10049012
330 Ga0207671_10017597
331 Ga0207657_10003426
332 Ga0207657_10016311
333 Ga0207681_10000002
334 Ga0207681_10008827
335 Ga0207694_10021237
336 Ga0207650_10001217
337 Ga0207644_10000002
338 Ga0207644_10000791
339 Ga0207690_10007990
340 Ga0207706_10299632
341 Ga0207667_10000038
342 Ga0207667_10009368
343 Ga0207667_10048955
344 Ga0207667_10171498
345 Ga0207667_10214829
346 Ga0207668_10000011
347 Ga0207668_10043269
348 Ga0207640_10000279
349 Ga0207658_10000014
350 Ga0207703_10001718
351 Ga0207639_10009382
352 Ga0207639_10076416
353 Ga0207678_10358621
354 Ga0207702_10005841
355 Ga0207702_10012369
356 Ga0207641_10000545
357 Ga0207641_10002975
358 Ga0207641_10375344
359 Ga0207676_10000489
360 Ga0207676_10004187
361 Ga0207674_10095817
362 Ga0207674_10159960
363 Ga0207675_100002191
364 Ga0207675_100114363
365 Ga0207698_10000120
366 Ga0207698_10000919
367 Ga0207698_10004603
368 Ga0209813_10000345
369 Ga0268266_10047748
370 Ga0268265_10001056
371 Ga0268265_10002184
372 Ga0268264_10000121
373 Ga0316183_1179489
374 Ga0307513_10024230
375 Ga0307408_100010846
376 Ga0307408_100045362
377 Ga0307405_10015300
378 Ga0307405_10028929
379 Ga0307413_10133788
380 Ga0307410_10043320
381 Ga0307406_10022321
382 Ga0307406_10291517
383 Ga0307407_10073443
384 Ga0307412_10005431
385 Ga0307412_10017372
386 Ga0307412_10037889
387 Ga0307412_10191129
388 Ga0307409_100194171
389 Ga0307416_100056218
390 Ga0307416_100108446
391 Ga0307414_10000122
392 Ga0307414_10069075
393 Ga0307414_10097843
394 Ga0307414_10337390
395 Ga0307411_10076536
396 Ga0307411_10204845
397 Ga0307415_100053207
398 Ga0436365_0062931
399 Ga0436365_0869628
400 Ga0436362_0580304
401 Ga0439445_0017270
402 Ga0439435_0024562
403 Ga0466972_0021601
404 Ga0466966_0177909
405 Ga0466961_0027358
406 Ga0466964_0093781
407 Ga0466971_0136455
408 Ga0466970_0026510
409 Ga0466960_0144126
410 Ga0466958_0233673
411 Ga0495627_000024
412 Ga0495627_009569
413 Ga0495584_0066955
414 Ga0495596_0002823
415 Ga0495606_0110972
416 Ga0495610_0000053
417 Ga0495610_0004173
418 Ga0495632_0000075
419 Ga0495632_0000306
420 Ga0495637_0000123
421 Ga0495643_0000009
422 Ga0495643_0000042
423 Ga0495643_0018114
424 Ga0495648_0052088
425 Ga0495663_0000003
426 Ga0495654_0041881
427 Ga0495598_0001924
428 Ga0495633_0005135
429 Ga0495633_0049138
430 Ga0495633_0100369
431 Ga0495668_0000015
432 Ga0495625_0000190
433 Ga0495661_0014114
434 Ga0495671_0000013
435 Ga0495681_0000099
436 Ga0495681_0001560
437 Ga0495686_0000091
438 Ga0495626_0000139
439 Ga0496108_0001530
440 Ga0496110_0060615
441 Ga0496116_0000045
442 Ga0496117_0057895
443 Ga0496118_0011213
444 Ga0496121_0000190
445 Ga0496121_0000930
446 Ga0496121_0005432
447 Ga0496121_0012164
448 Ga0496122_0005345
449 Ga0496122_0196950
450 Ga0496123_0001952
451 Ga0496124_0003632
452 Ga0496124_0013710
453 Ga0496125_0010180
454 Ga0496125_0016914
455 Ga0496126_0000519
456 Ga0496126_0002859
457 Ga0496126_0032193
458 Ga0496126_0062457
459 Ga0495678_011003
460 Ga0501034_0493524
461 nmdc:mga06z11_348_c1
462 nmdc:mga04h51_137_c1
463 nmdc:mga07m45_38630_c1
464 nmdc:mga0sz30_37694_c1
465 Ga0500592_003700
466 Ga0500618_012816
467 Ga0500568_0000634
468 Ga0500604_0038873
469 Ga0500624_000003
470 Ga0500624_000042
471 Ga0500624_000173
472 Ga0500627_0000008
473 Ga0500636_0007644
474 Ga0500637_0000073
475 2512645617
476 2643820414
477 2643834835
478 2643951676
479 2644055762
480 2739651107
481 2740029580
482 2809062598
483 2809078718
484 2809082987
485 2819551419
486 2852656110
487 2852682837
488 2880521596
489 2919709530
490 2990268163
491 2993696812
492 8054305104

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14561

TPR_20

Tetratricopeptide repeat

212

301

0.97

PF00085

Thioredoxin

Thioredoxin

9

113

0.93

PF14559

TPR_19

Tetratricopeptide repeat

141

211

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.9498 126 182
7ysi-assembly1.cif.gz_A crystal structure of thioredoxin 2 0.9478 22 108
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9449 10 108
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.9435 127 182
1txx-assembly1.cif.gz_A active-site variant of e.coli thioredoxin 0.9405 10 110
ID Description Score Start End Superfamily
af_P9WG61_44_154_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9382 10 111 3.40.30.10
1uvzD00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9336 10 110 3.40.30.10
1thxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9323 10 110 3.40.30.10
af_O15050_4_90_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9296 122 182 1.25.40.10
af_Q9SEU7_68_173_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.922 10 111 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q2X321-F1-model_v4 deleted 0.9999 1 113
AF-A0A4Q2X321-F1-model_v4 deleted 0.9911 1 113
AF-A0A7C5S7A3-F1-model_v4 Thioredoxin 0.9461 10 111 GO:0005737
GO:0015035
AF-A0A497QSS7-F1-model_v4 Thioredoxin 0.9326 11 111 GO:0005737
GO:0015035
AF-A0A842VPL2-F1-model_v4 Thioredoxin domain-containing protein 0.9304 9 109 GO:0005737
GO:0015035

Map