F358260
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 134 | 246 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300028653|Ga0265323_10020567|Ga0265323_100205673 |
| Length | 202 |
| Sequence | MSVVTKTGDSGTTALMYGRRVPKNHPRVEACGAVDELNAALGLARATATDKFVARNLPAIQKDLIVLMGELGVLRRDLPRYFRSGHSRVTPAMTATLDASVQEIESQNMTFKGWAMPGATLHSAALDVARTVCRRAERRVCALKESGGLVNVEIIIYLNRLSDLLWLFARRVETAEVRPPNSPPKIKTRAGRFILRVSSAGK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 25 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 29 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 35 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 49 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 68 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 69 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 70 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 71 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 72 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 74 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 76 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 77 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 78 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 79 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 81 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 82 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 86 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 87 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 88 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 90 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 91 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 92 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 93 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 94 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 96 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 97 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 98 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 99 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 100 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 127 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 128 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 131 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 132 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.44 |
| Nodule | 0 |
| Rhizoplane | 1.22 |
| Rhizosphere | 95.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055530_10013004 | 3300003791 | Bacteria | 2865 |
| 2 | Ga0070658_10129310 | 3300005327 | Unclassified | 2104 |
| 3 | Ga0070658_10252623 | 3300005327 | Bacteria | 1496 |
| 4 | Ga0070670_100054488 | 3300005331 | Unclassified | 3434 |
| 5 | Ga0070660_100140510 | 3300005339 | Bacteria | 1937 |
| 6 | Ga0070689_100311530 | 3300005340 | Unclassified | 1312 |
| 7 | Ga0070691_10013855 | 3300005341 | Unclassified | 3700 |
| 8 | Ga0070691_10270596 | 3300005341 | Bacteria | 918 |
| 9 | Ga0070669_100604058 | 3300005353 | Bacteria | 919 |
| 10 | Ga0070714_100001788 | 3300005435 | Bacteria | 15659 |
| 11 | Ga0070713_101187894 | 3300005436 | Unclassified | 738 |
| 12 | Ga0070711_100019884 | 3300005439 | Bacteria | 4318 |
| 13 | Ga0070694_100011974 | 3300005444 | Bacteria | 5383 |
| 14 | Ga0070708_100209518 | 3300005445 | Unclassified | 1826 |
| 15 | Ga0070708_100522658 | 3300005445 | Unclassified | 1119 |
| 16 | Ga0070681_10012431 | 3300005458 | Bacteria | 8445 |
| 17 | Ga0070681_10331961 | 3300005458 | Bacteria | 1430 |
| 18 | Ga0070685_10533077 | 3300005466 | Unclassified | 835 |
| 19 | Ga0070707_100000444 | 3300005468 | Archaea | 41019 |
| 20 | Ga0070707_100016755 | 3300005468 | Bacteria | 6879 |
| 21 | Ga0070707_100251667 | 3300005468 | Unclassified | 1719 |
| 22 | Ga0070707_100252892 | 3300005468 | Unclassified | 1715 |
| 23 | Ga0070707_100936731 | 3300005468 | Archaea | 831 |
| 24 | Ga0070699_100006022 | 3300005518 | Archaea | 10601 |
| 25 | Ga0070699_100478535 | 3300005518 | Unclassified | 1130 |
| 26 | Ga0070679_100072798 | 3300005530 | Bacteria | 3429 |
| 27 | Ga0070684_100622220 | 3300005535 | Bacteria | 1004 |
| 28 | Ga0070697_100022193 | 3300005536 | Archaea | 5037 |
| 29 | Ga0070697_100107749 | 3300005536 | Archaea | 2318 |
| 30 | Ga0070697_100213949 | 3300005536 | Bacteria | 1642 |
| 31 | Ga0068853_100000006 | 3300005539 | Bacteria | 295921 |
| 32 | Ga0070686_100199864 | 3300005544 | Bacteria | 1432 |
| 33 | Ga0068855_100073708 | 3300005563 | Bacteria | 3966 |
| 34 | Ga0068855_100094428 | 3300005563 | Bacteria | 3449 |
| 35 | Ga0068855_100122993 | 3300005563 | Bacteria | 2969 |
| 36 | Ga0068855_100653534 | 3300005563 | Unclassified | 1129 |
| 37 | Ga0070664_100788640 | 3300005564 | Unclassified | 888 |
| 38 | Ga0068857_100535180 | 3300005577 | Unclassified | 1102 |
| 39 | Ga0068857_100898166 | 3300005577 | Unclassified | 849 |
| 40 | Ga0068854_100855680 | 3300005578 | Bacteria | 796 |
| 41 | Ga0068856_100675310 | 3300005614 | Bacteria | 1053 |
| 42 | Ga0068858_100014879 | 3300005842 | Bacteria | 7318 |
| 43 | Ga0068858_100243832 | 3300005842 | Bacteria | 1705 |
| 44 | Ga0068862_100451181 | 3300005844 | Bacteria | 1212 |
| 45 | Ga0070712_100164467 | 3300006175 | Bacteria | 1716 |
| 46 | Ga0075366_10051266 | 3300006195 | Bacteria | 2452 |
| 47 | Ga0097621_100303207 | 3300006237 | Bacteria | 1411 |
| 48 | Ga0075428_100008693 | 3300006844 | Bacteria | 11266 |
| 49 | Ga0075436_100489642 | 3300006914 | Unclassified | 899 |
| 50 | Ga0075435_100390545 | 3300007076 | Unclassified | 1196 |
| 51 | Ga0099794_10002757 | 3300007265 | Archaea | 6558 |
| 52 | Ga0099794_10006370 | 3300007265 | Unclassified | 4776 |
| 53 | Ga0099794_10015987 | 3300007265 | Bacteria | 3320 |
| 54 | Ga0099794_10074601 | 3300007265 | Unclassified | 1666 |
| 55 | Ga0099794_10109110 | 3300007265 | Bacteria | 1385 |
| 56 | Ga0105240_10019053 | 3300009093 | Bacteria | 9178 |
| 57 | Ga0105240_10110316 | 3300009093 | Bacteria | 3330 |
| 58 | Ga0105240_10327995 | 3300009093 | Unclassified | 1743 |
| 59 | Ga0105240_10970742 | 3300009093 | Bacteria | 910 |
| 60 | Ga0111539_10027890 | 3300009094 | Bacteria | 6895 |
| 61 | Ga0114129_10525833 | 3300009147 | Bacteria | 1542 |
| 62 | Ga0105237_10519570 | 3300009545 | Unclassified | 1197 |
| 63 | Ga0105238_10008615 | 3300009551 | Bacteria | 10206 |
| 64 | Ga0105238_10293441 | 3300009551 | Bacteria | 1609 |
| 65 | Ga0105249_10466721 | 3300009553 | Bacteria | 1303 |
| 66 | Ga0105239_10390727 | 3300010375 | Bacteria | 1574 |
| 67 | Ga0105239_10792687 | 3300010375 | Bacteria | 1085 |
| 68 | Ga0157370_10271009 | 3300013104 | Bacteria | 1568 |
| 69 | Ga0157369_10938492 | 3300013105 | Bacteria | 887 |
| 70 | Ga0157374_10272476 | 3300013296 | Bacteria | 1669 |
| 71 | Ga0157372_10129903 | 3300013307 | Bacteria | 2898 |
| 72 | Ga0157372_12390886 | 3300013307 | Unclassified | 607 |
| 73 | Ga0157375_10803709 | 3300013308 | Bacteria | 1089 |
| 74 | Ga0213876_10197040 | 3300021384 | Bacteria | 1071 |
| 75 | Ga0209050_1002655 | 3300025298 | Bacteria | 14633 |
| 76 | Ga0207705_10252357 | 3300025909 | Unclassified | 1345 |
| 77 | Ga0207707_10166094 | 3300025912 | Bacteria | 1929 |
| 78 | Ga0207695_10047287 | 3300025913 | Unclassified | 4554 |
| 79 | Ga0207695_10293532 | 3300025913 | Bacteria | 1518 |
| 80 | Ga0207693_10181770 | 3300025915 | Bacteria | 1655 |
| 81 | Ga0207663_10013953 | 3300025916 | Bacteria | 4384 |
| 82 | Ga0207646_10000028 | 3300025922 | Bacteria | 227768 |
| 83 | Ga0207646_10004778 | 3300025922 | Unclassified | 14551 |
| 84 | Ga0207646_10006464 | 3300025922 | Archaea | 12099 |
| 85 | Ga0207646_10124604 | 3300025922 | Unclassified | 2316 |
| 86 | Ga0207646_10802763 | 3300025922 | Archaea | 838 |
| 87 | Ga0207694_10057283 | 3300025924 | Bacteria | 3029 |
| 88 | Ga0207664_10010158 | 3300025929 | Bacteria | 6643 |
| 89 | Ga0207661_11333830 | 3300025944 | Bacteria | 659 |
| 90 | Ga0207679_10916190 | 3300025945 | Unclassified | 802 |
| 91 | Ga0207667_10019439 | 3300025949 | Bacteria | 7584 |
| 92 | Ga0207667_10089764 | 3300025949 | Bacteria | 3176 |
| 93 | Ga0207667_10382294 | 3300025949 | Bacteria | 1434 |
| 94 | Ga0207703_10005916 | 3300026035 | Bacteria | 9804 |
| 95 | Ga0207703_10249250 | 3300026035 | Unclassified | 1600 |
| 96 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 97 | Ga0207639_10235466 | 3300026041 | Unclassified | 1589 |
| 98 | Ga0207702_10684575 | 3300026078 | Unclassified | 1010 |
| 99 | Ga0207641_10582938 | 3300026088 | Bacteria | 1093 |
| 100 | Ga0209588_1000728 | 3300027671 | Bacteria | 8305 |
| 101 | Ga0209588_1002822 | 3300027671 | Archaea | 4758 |
| 102 | Ga0209588_1012446 | 3300027671 | Unclassified | 2583 |
| 103 | Ga0268264_10931157 | 3300028381 | Bacteria | 873 |
| 104 | Ga0265337_1001501 | 3300028556 | Bacteria | 11453 |
| 105 | Ga0265337_1156549 | 3300028556 | Unclassified | 617 |
| 106 | Ga0265326_10005542 | 3300028558 | Bacteria | 3980 |
| 107 | Ga0265326_10017107 | 3300028558 | Bacteria | 2094 |
| 108 | Ga0265319_1045579 | 3300028563 | Bacteria | 1464 |
| 109 | Ga0265334_10051833 | 3300028573 | Bacteria | 1572 |
| 110 | Ga0265334_10097299 | 3300028573 | Bacteria | 1068 |
| 111 | Ga0265334_10157087 | 3300028573 | Unclassified | 800 |
| 112 | Ga0265334_10157886 | 3300028573 | Bacteria | 798 |
| 113 | Ga0265323_10005993 | 3300028653 | Bacteria | 5140 |
| 114 | Ga0265323_10020567 | 3300028653 | Bacteria | 2540 |
| 115 | Ga0265323_10039762 | 3300028653 | Unclassified | 1714 |
| 116 | Ga0265323_10117585 | 3300028653 | Bacteria | 868 |
| 117 | Ga0265322_10059879 | 3300028654 | Bacteria | 1080 |
| 118 | Ga0265336_10017103 | 3300028666 | Unclassified | 2363 |
| 119 | Ga0265336_10049834 | 3300028666 | Bacteria | 1268 |
| 120 | Ga0265338_10000038 | 3300028800 | Bacteria | 237195 |
| 121 | Ga0265338_10000214 | 3300028800 | Bacteria | 106870 |
| 122 | Ga0265338_10000843 | 3300028800 | Bacteria | 51673 |
| 123 | Ga0265338_10001139 | 3300028800 | Bacteria | 43978 |
| 124 | Ga0265338_10002771 | 3300028800 | Bacteria | 25646 |
| 125 | Ga0265338_10003168 | 3300028800 | Bacteria | 23481 |
| 126 | Ga0265338_10004557 | 3300028800 | Bacteria | 18651 |
| 127 | Ga0265338_10004765 | 3300028800 | Bacteria | 18132 |
| 128 | Ga0265338_10088813 | 3300028800 | Unclassified | 2563 |
| 129 | Ga0265338_10090095 | 3300028800 | Bacteria | 2539 |
| 130 | Ga0265338_10134715 | 3300028800 | Bacteria | 1944 |
| 131 | Ga0265338_10176582 | 3300028800 | Bacteria | 1632 |
| 132 | Ga0265338_10205872 | 3300028800 | Unclassified | 1480 |
| 133 | Ga0265338_10282794 | 3300028800 | Bacteria | 1211 |
| 134 | Ga0265338_10530988 | 3300028800 | Bacteria | 825 |
| 135 | Ga0265338_10650252 | 3300028800 | Bacteria | 731 |
| 136 | Ga0265324_10000911 | 3300029957 | Bacteria | 18695 |
| 137 | Ga0265324_10099967 | 3300029957 | Bacteria | 986 |
| 138 | Ga0265324_10138123 | 3300029957 | Unclassified | 828 |
| 139 | Ga0265320_10000364 | 3300031240 | Bacteria | 36776 |
| 140 | Ga0265320_10011935 | 3300031240 | Bacteria | 5086 |
| 141 | Ga0265320_10049178 | 3300031240 | Bacteria | 2053 |
| 142 | Ga0265320_10114131 | 3300031240 | Unclassified | 1236 |
| 143 | Ga0265320_10229417 | 3300031240 | Bacteria | 826 |
| 144 | Ga0265325_10006938 | 3300031241 | Bacteria | 6834 |
| 145 | Ga0265325_10012831 | 3300031241 | Bacteria | 4781 |
| 146 | Ga0265325_10025853 | 3300031241 | Bacteria | 3185 |
| 147 | Ga0265340_10000246 | 3300031247 | Bacteria | 28156 |
| 148 | Ga0265340_10058414 | 3300031247 | Bacteria | 1852 |
| 149 | Ga0265340_10109176 | 3300031247 | Unclassified | 1280 |
| 150 | Ga0265340_10147411 | 3300031247 | Unclassified | 1074 |
| 151 | Ga0265339_10011911 | 3300031249 | Bacteria | 5331 |
| 152 | Ga0265339_10083331 | 3300031249 | Bacteria | 1686 |
| 153 | Ga0265327_10001745 | 3300031251 | Bacteria | 25747 |
| 154 | Ga0265327_10002967 | 3300031251 | Bacteria | 16924 |
| 155 | Ga0265327_10025339 | 3300031251 | Bacteria | 3461 |
| 156 | Ga0265316_10008385 | 3300031344 | Bacteria | 9599 |
| 157 | Ga0265316_10014755 | 3300031344 | Bacteria | 6859 |
| 158 | Ga0265316_10136913 | 3300031344 | Unclassified | 1842 |
| 159 | Ga0265316_10316481 | 3300031344 | Bacteria | 1134 |
| 160 | Ga0265316_10344602 | 3300031344 | Bacteria | 1079 |
| 161 | Ga0265316_10413337 | 3300031344 | Unclassified | 970 |
| 162 | Ga0265316_10478586 | 3300031344 | Bacteria | 891 |
| 163 | Ga0265313_10002951 | 3300031595 | Bacteria | 14195 |
| 164 | Ga0265314_10025645 | 3300031711 | Bacteria | 4442 |
| 165 | Ga0265314_10086445 | 3300031711 | Bacteria | 2053 |
| 166 | Ga0265314_10224204 | 3300031711 | Unclassified | 1095 |
| 167 | Ga0265342_10262107 | 3300031712 | Bacteria | 919 |
| 168 | Ga0373934_0259017 | 3300035086 | Unclassified | 720 |
| 169 | Ga0373953_0003541 | 3300035117 | Bacteria | 4878 |
| 170 | Ga0373954_0052687 | 3300035118 | Bacteria | 1912 |
| 171 | Ga0373956_0007923 | 3300035119 | Bacteria | 4288 |
| 172 | Ga0373957_0299444 | 3300035120 | Bacteria | 682 |
| 173 | Ga0373924_0457251 | 3300035410 | Unclassified | 572 |
| 174 | Ga0373935_0633908 | 3300035692 | Bacteria | 783 |
| 175 | Ga0373933_0017506 | 3300035724 | Bacteria | 4020 |
| 176 | Ga0373933_0036232 | 3300035724 | Bacteria | 2886 |
| 177 | Ga0373937_0001257 | 3300036401 | Bacteria | 21283 |
| 178 | Ga0373937_0344507 | 3300036401 | Unclassified | 1411 |
| 179 | Ga0373937_0878432 | 3300036401 | Bacteria | 845 |
| 180 | Ga0373937_1249683 | 3300036401 | Bacteria | 691 |
| 181 | Ga0373925_0417556 | 3300037068 | Bacteria | 1096 |
| 182 | Ga0436365_1796911 | 3300039437 | Bacteria | 2110 |
| 183 | Ga0451787_043969 | 3300041441 | Bacteria | 1136 |
| 184 | Ga0451577_0172310 | 3300042876 | Bacteria | 1950 |
| 185 | Ga0453684_1361902 | 3300044712 | Unclassified | 738 |
| 186 | Ga0451576_0022881 | 3300045051 | Bacteria | 6772 |
| 187 | Ga0451576_0864391 | 3300045051 | Bacteria | 949 |
| 188 | Ga0451576_1257466 | 3300045051 | Bacteria | 772 |
| 189 | Ga0495592_0000101 | 3300046454 | Bacteria | 75856 |
| 190 | Ga0495592_0193281 | 3300046454 | Bacteria | 1378 |
| 191 | Ga0495651_0201433 | 3300046462 | Bacteria | 1393 |
| 192 | Ga0495662_0193347 | 3300046476 | Unclassified | 1003 |
| 193 | Ga0495662_0223357 | 3300046476 | Bacteria | 928 |
| 194 | Ga0495664_0009030 | 3300046477 | Bacteria | 5572 |
| 195 | Ga0495664_0373881 | 3300046477 | Unclassified | 857 |
| 196 | Ga0495608_0412360 | 3300046511 | Bacteria | 825 |
| 197 | Ga0495618_0002290 | 3300046514 | Bacteria | 12403 |
| 198 | Ga0495618_0013607 | 3300046514 | Bacteria | 4952 |
| 199 | Ga0495628_0093625 | 3300046516 | Bacteria | 2324 |
| 200 | Ga0495628_0108957 | 3300046516 | Bacteria | 2132 |
| 201 | Ga0495628_0618699 | 3300046516 | Unclassified | 772 |
| 202 | Ga0495630_0220150 | 3300046517 | Bacteria | 1449 |
| 203 | Ga0495630_0547473 | 3300046517 | Bacteria | 887 |
| 204 | Ga0495630_0859968 | 3300046517 | Bacteria | 691 |
| 205 | Ga0495643_0000057 | 3300046522 | Bacteria | 195145 |
| 206 | Ga0495666_0059534 | 3300046526 | Unclassified | 1826 |
| 207 | Ga0495652_0072480 | 3300046529 | Bacteria | 2871 |
| 208 | Ga0495652_0162970 | 3300046529 | Unclassified | 1729 |
| 209 | Ga0495586_0000348 | 3300046535 | Bacteria | 29056 |
| 210 | Ga0495586_0000548 | 3300046535 | Bacteria | 21893 |
| 211 | Ga0495586_0250058 | 3300046535 | Bacteria | 1011 |
| 212 | Ga0495587_0382076 | 3300046536 | Bacteria | 783 |
| 213 | Ga0495645_0011192 | 3300046543 | Bacteria | 6311 |
| 214 | Ga0495645_0448646 | 3300046543 | Bacteria | 814 |
| 215 | Ga0495622_0011971 | 3300046557 | Bacteria | 4013 |
| 216 | Ga0495667_0028593 | 3300046559 | Bacteria | 3755 |
| 217 | Ga0495667_0187539 | 3300046559 | Bacteria | 1326 |
| 218 | Ga0495667_0517428 | 3300046559 | Bacteria | 747 |
| 219 | Ga0495635_0030671 | 3300046663 | Bacteria | 3735 |
| 220 | Ga0495599_0211314 | 3300046678 | Unclassified | 1189 |
| 221 | Ga0495669_0254843 | 3300046684 | Unclassified | 843 |
| 222 | Ga0495613_0003977 | 3300046689 | Bacteria | 11062 |
| 223 | Ga0495613_0166327 | 3300046689 | Bacteria | 1567 |
| 224 | Ga0495600_0362769 | 3300046809 | Bacteria | 906 |
| 225 | Ga0495600_0584656 | 3300046809 | Bacteria | 680 |
| 226 | Ga0495581_0121361 | 3300047315 | Unclassified | 1521 |
| 227 | Ga0495674_0022746 | 3300047319 | Bacteria | 5778 |
| 228 | Ga0495674_0052043 | 3300047319 | Bacteria | 3606 |
| 229 | Ga0495680_0006547 | 3300047322 | Bacteria | 10810 |
| 230 | Ga0495680_0458224 | 3300047322 | Unclassified | 872 |
| 231 | Ga0495680_0501734 | 3300047322 | Unclassified | 824 |
| 232 | Ga0495680_0507531 | 3300047322 | Bacteria | 818 |
| 233 | Ga0495675_0188982 | 3300047444 | Unclassified | 1258 |
| 234 | Ga0495675_0342040 | 3300047444 | Unclassified | 881 |
| 235 | Ga0495684_0109209 | 3300047471 | Unclassified | 2089 |
| 236 | Ga0495684_1015570 | 3300047471 | Unclassified | 526 |
| 237 | Ga0496115_0065661 | 3300048918 | Bacteria | 2931 |
| 238 | Ga0496115_0873011 | 3300048918 | Bacteria | 695 |
| 239 | Ga0501033_0052641 | 3300049570 | Bacteria | 3017 |
| 240 | Ga0501047_0482033 | 3300049581 | Bacteria | 1068 |
| 241 | Ga0501035_0127979 | 3300049822 | Bacteria | 2216 |
| 242 | nmdc:mga03683_17945_c1 | 3300050489 | Bacteria | 2684 |
| 243 | nmdc:mga0k408_548533_c1 | 3300050493 | Unclassified | 683 |
| 244 | nmdc:mga08y16_26211_c1 | 3300050511 | Bacteria | 6147 |
| 245 | Ga0495601_0047531 | 3300053077 | Unclassified | 2702 |
| 246 | Ga0500645_029124 | 3300053730 | Bacteria | 1668 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100311530 | Ga0070689_1003115302 | 155 |
| 2 | 3300005466 | Ga0070685_10533077 | Ga0070685_105330771 | 155 |
| 3 | 3300005578 | Ga0068854_100855680 | Ga0068854_1008556801 | 155 |
| 4 | 3300013104 | Ga0157370_10271009 | Ga0157370_102710093 | 155 |
| 5 | 3300026078 | Ga0207702_10684575 | Ga0207702_106845752 | 155 |
| 6 | 3300028800 | Ga0265338_10282794 | Ga0265338_102827942 | 155 |
| 7 | 3300028556 | Ga0265337_1001501 | Ga0265337_100150111 | 156 |
| 8 | 3300028654 | Ga0265322_10059879 | Ga0265322_100598792 | 156 |
| 9 | 3300028800 | Ga0265338_10000214 | Ga0265338_1000021437 | 156 |
| 10 | 3300028800 | Ga0265338_10003168 | Ga0265338_100031688 | 156 |
| 11 | 3300028800 | Ga0265338_10004557 | Ga0265338_1000455716 | 156 |
| 12 | 3300029957 | Ga0265324_10099967 | Ga0265324_100999672 | 156 |
| 13 | 3300046543 | Ga0495645_0448646 | Ga0495645_0448646_277_777 | 156 |
| 14 | 3300005577 | Ga0068857_100898166 | Ga0068857_1008981661 | 157 |
| 15 | 3300046526 | Ga0495666_0059534 | Ga0495666_0059534_1322_1816 | 158 |
| 16 | 3300047315 | Ga0495581_0121361 | Ga0495581_0121361_12_506 | 158 |
| 17 | 3300047471 | Ga0495684_1015570 | Ga0495684_1015570_15_509 | 158 |
| 18 | 3300005444 | Ga0070694_100011974 | Ga0070694_1000119742 | 159 |
| 19 | 3300021384 | Ga0213876_10197040 | Ga0213876_101970402 | 159 |
| 20 | 3300035117 | Ga0373953_0003541 | Ga0373953_0003541_3286_3786 | 160 |
| 21 | 3300035119 | Ga0373956_0007923 | Ga0373956_0007923_1690_2190 | 160 |
| 22 | 3300035120 | Ga0373957_0299444 | Ga0373957_0299444_38_538 | 160 |
| 23 | 3300035724 | Ga0373933_0036232 | Ga0373933_0036232_2224_2724 | 160 |
| 24 | 3300036401 | Ga0373937_0001257 | Ga0373937_0001257_10927_11427 | 160 |
| 25 | 3300046511 | Ga0495608_0412360 | Ga0495608_0412360_302_802 | 160 |
| 26 | 3300046514 | Ga0495618_0002290 | Ga0495618_0002290_2522_3022 | 160 |
| 27 | 3300046517 | Ga0495630_0220150 | Ga0495630_0220150_680_1180 | 160 |
| 28 | 3300046535 | Ga0495586_0000548 | Ga0495586_0000548_14024_14524 | 160 |
| 29 | 3300046536 | Ga0495587_0382076 | Ga0495587_0382076_74_574 | 160 |
| 30 | 3300046559 | Ga0495667_0028593 | Ga0495667_0028593_2377_2877 | 160 |
| 31 | 3300046663 | Ga0495635_0030671 | Ga0495635_0030671_589_1089 | 160 |
| 32 | 3300046689 | Ga0495613_0003977 | Ga0495613_0003977_3579_4079 | 160 |
| 33 | 3300047322 | Ga0495680_0006547 | Ga0495680_0006547_2636_3136 | 160 |
| 34 | 3300005445 | Ga0070708_100209518 | Ga0070708_1002095182 | 169 |
| 35 | 3300005445 | Ga0070708_100522658 | Ga0070708_1005226582 | 169 |
| 36 | 3300005468 | Ga0070707_100000444 | Ga0070707_10000044413 | 169 |
| 37 | 3300005468 | Ga0070707_100016755 | Ga0070707_1000167552 | 169 |
| 38 | 3300005468 | Ga0070707_100251667 | Ga0070707_1002516672 | 169 |
| 39 | 3300005468 | Ga0070707_100252892 | Ga0070707_1002528922 | 169 |
| 40 | 3300005468 | Ga0070707_100936731 | Ga0070707_1009367312 | 169 |
| 41 | 3300005518 | Ga0070699_100006022 | Ga0070699_1000060221 | 169 |
| 42 | 3300005536 | Ga0070697_100022193 | Ga0070697_1000221935 | 169 |
| 43 | 3300005536 | Ga0070697_100107749 | Ga0070697_1001077493 | 169 |
| 44 | 3300005536 | Ga0070697_100213949 | Ga0070697_1002139492 | 169 |
| 45 | 3300007265 | Ga0099794_10002757 | Ga0099794_100027577 | 169 |
| 46 | 3300007265 | Ga0099794_10006370 | Ga0099794_100063703 | 169 |
| 47 | 3300007265 | Ga0099794_10015987 | Ga0099794_100159872 | 169 |
| 48 | 3300007265 | Ga0099794_10074601 | Ga0099794_100746011 | 169 |
| 49 | 3300007265 | Ga0099794_10109110 | Ga0099794_101091102 | 169 |
| 50 | 3300025922 | Ga0207646_10000028 | Ga0207646_10000028209 | 169 |
| 51 | 3300025922 | Ga0207646_10004778 | Ga0207646_100047782 | 169 |
| 52 | 3300025922 | Ga0207646_10006464 | Ga0207646_1000646412 | 169 |
| 53 | 3300025922 | Ga0207646_10124604 | Ga0207646_101246042 | 169 |
| 54 | 3300025922 | Ga0207646_10802763 | Ga0207646_108027632 | 169 |
| 55 | 3300027671 | Ga0209588_1000728 | Ga0209588_10007283 | 169 |
| 56 | 3300027671 | Ga0209588_1002822 | Ga0209588_10028225 | 169 |
| 57 | 3300027671 | Ga0209588_1012446 | Ga0209588_10124462 | 169 |
| 58 | 3300045051 | Ga0451576_0022881 | Ga0451576_0022881_36_590 | 169 |
| 59 | 3300005341 | Ga0070691_10013855 | Ga0070691_100138553 | 170 |
| 60 | 3300005341 | Ga0070691_10270596 | Ga0070691_102705962 | 170 |
| 61 | 3300005435 | Ga0070714_100001788 | Ga0070714_1000017888 | 170 |
| 62 | 3300005458 | Ga0070681_10012431 | Ga0070681_100124313 | 170 |
| 63 | 3300005458 | Ga0070681_10331961 | Ga0070681_103319612 | 170 |
| 64 | 3300005530 | Ga0070679_100072798 | Ga0070679_1000727983 | 170 |
| 65 | 3300005563 | Ga0068855_100073708 | Ga0068855_1000737083 | 170 |
| 66 | 3300005563 | Ga0068855_100094428 | Ga0068855_1000944284 | 170 |
| 67 | 3300005563 | Ga0068855_100122993 | Ga0068855_1001229932 | 170 |
| 68 | 3300005563 | Ga0068855_100653534 | Ga0068855_1006535342 | 170 |
| 69 | 3300005614 | Ga0068856_100675310 | Ga0068856_1006753102 | 170 |
| 70 | 3300009093 | Ga0105240_10019053 | Ga0105240_100190533 | 170 |
| 71 | 3300009093 | Ga0105240_10110316 | Ga0105240_101103165 | 170 |
| 72 | 3300009093 | Ga0105240_10327995 | Ga0105240_103279952 | 170 |
| 73 | 3300009551 | Ga0105238_10008615 | Ga0105238_1000861510 | 170 |
| 74 | 3300013105 | Ga0157369_10938492 | Ga0157369_109384921 | 170 |
| 75 | 3300013296 | Ga0157374_10272476 | Ga0157374_102724762 | 170 |
| 76 | 3300013307 | Ga0157372_10129903 | Ga0157372_101299033 | 170 |
| 77 | 3300025912 | Ga0207707_10166094 | Ga0207707_101660941 | 170 |
| 78 | 3300025913 | Ga0207695_10047287 | Ga0207695_100472874 | 170 |
| 79 | 3300025913 | Ga0207695_10293532 | Ga0207695_102935322 | 170 |
| 80 | 3300025924 | Ga0207694_10057283 | Ga0207694_100572834 | 170 |
| 81 | 3300025929 | Ga0207664_10010158 | Ga0207664_100101585 | 170 |
| 82 | 3300025949 | Ga0207667_10019439 | Ga0207667_1001943912 | 170 |
| 83 | 3300025949 | Ga0207667_10089764 | Ga0207667_100897643 | 170 |
| 84 | 3300026041 | Ga0207639_10235466 | Ga0207639_102354662 | 170 |
| 85 | 3300028653 | Ga0265323_10005993 | Ga0265323_100059932 | 170 |
| 86 | 3300028800 | Ga0265338_10002771 | Ga0265338_100027714 | 170 |
| 87 | 3300028800 | Ga0265338_10650252 | Ga0265338_106502521 | 170 |
| 88 | 3300031344 | Ga0265316_10478586 | Ga0265316_104785862 | 170 |
| 89 | 3300046684 | Ga0495669_0254843 | Ga0495669_0254843_165_695 | 170 |
| 90 | 3300048918 | Ga0496115_0065661 | Ga0496115_0065661_257_787 | 170 |
| 91 | 3300048918 | Ga0496115_0873011 | Ga0496115_0873011_119_676 | 170 |
| 92 | 3300049570 | Ga0501033_0052641 | Ga0501033_0052641_1018_1548 | 170 |
| 93 | 3300005327 | Ga0070658_10129310 | Ga0070658_101293103 | 171 |
| 94 | 3300005339 | Ga0070660_100140510 | Ga0070660_1001405103 | 171 |
| 95 | 3300005436 | Ga0070713_101187894 | Ga0070713_1011878941 | 171 |
| 96 | 3300005439 | Ga0070711_100019884 | Ga0070711_1000198843 | 171 |
| 97 | 3300005544 | Ga0070686_100199864 | Ga0070686_1001998641 | 171 |
| 98 | 3300006914 | Ga0075436_100489642 | Ga0075436_1004896421 | 171 |
| 99 | 3300007076 | Ga0075435_100390545 | Ga0075435_1003905452 | 171 |
| 100 | 3300009551 | Ga0105238_10293441 | Ga0105238_102934412 | 171 |
| 101 | 3300025909 | Ga0207705_10252357 | Ga0207705_102523572 | 171 |
| 102 | 3300025916 | Ga0207663_10013953 | Ga0207663_100139533 | 171 |
| 103 | 3300026035 | Ga0207703_10249250 | Ga0207703_102492501 | 171 |
| 104 | 3300028556 | Ga0265337_1156549 | Ga0265337_11565491 | 171 |
| 105 | 3300028558 | Ga0265326_10017107 | Ga0265326_100171072 | 171 |
| 106 | 3300028563 | Ga0265319_1045579 | Ga0265319_10455792 | 171 |
| 107 | 3300028573 | Ga0265334_10051833 | Ga0265334_100518332 | 171 |
| 108 | 3300028653 | Ga0265323_10039762 | Ga0265323_100397622 | 171 |
| 109 | 3300028653 | Ga0265323_10117585 | Ga0265323_101175851 | 171 |
| 110 | 3300028666 | Ga0265336_10049834 | Ga0265336_100498342 | 171 |
| 111 | 3300028800 | Ga0265338_10000038 | Ga0265338_10000038113 | 171 |
| 112 | 3300028800 | Ga0265338_10000843 | Ga0265338_1000084332 | 171 |
| 113 | 3300028800 | Ga0265338_10004765 | Ga0265338_1000476517 | 171 |
| 114 | 3300028800 | Ga0265338_10090095 | Ga0265338_100900952 | 171 |
| 115 | 3300028800 | Ga0265338_10176582 | Ga0265338_101765822 | 171 |
| 116 | 3300028800 | Ga0265338_10205872 | Ga0265338_102058722 | 171 |
| 117 | 3300028800 | Ga0265338_10530988 | Ga0265338_105309881 | 171 |
| 118 | 3300029957 | Ga0265324_10138123 | Ga0265324_101381232 | 171 |
| 119 | 3300031240 | Ga0265320_10000364 | Ga0265320_1000036414 | 171 |
| 120 | 3300031240 | Ga0265320_10011935 | Ga0265320_100119352 | 171 |
| 121 | 3300031240 | Ga0265320_10049178 | Ga0265320_100491782 | 171 |
| 122 | 3300031240 | Ga0265320_10229417 | Ga0265320_102294172 | 171 |
| 123 | 3300031241 | Ga0265325_10006938 | Ga0265325_100069386 | 171 |
| 124 | 3300031241 | Ga0265325_10012831 | Ga0265325_100128313 | 171 |
| 125 | 3300031247 | Ga0265340_10109176 | Ga0265340_101091762 | 171 |
| 126 | 3300031249 | Ga0265339_10011911 | Ga0265339_100119117 | 171 |
| 127 | 3300031249 | Ga0265339_10083331 | Ga0265339_100833312 | 171 |
| 128 | 3300031251 | Ga0265327_10001745 | Ga0265327_1000174519 | 171 |
| 129 | 3300031344 | Ga0265316_10008385 | Ga0265316_1000838511 | 171 |
| 130 | 3300031344 | Ga0265316_10136913 | Ga0265316_101369132 | 171 |
| 131 | 3300031344 | Ga0265316_10344602 | Ga0265316_103446022 | 171 |
| 132 | 3300031595 | Ga0265313_10002951 | Ga0265313_100029514 | 171 |
| 133 | 3300031711 | Ga0265314_10086445 | Ga0265314_100864452 | 171 |
| 134 | 3300031711 | Ga0265314_10224204 | Ga0265314_102242041 | 171 |
| 135 | 3300031712 | Ga0265342_10262107 | Ga0265342_102621071 | 171 |
| 136 | 3300035086 | Ga0373934_0259017 | Ga0373934_0259017_80_610 | 171 |
| 137 | 3300035118 | Ga0373954_0052687 | Ga0373954_0052687_873_1403 | 171 |
| 138 | 3300035410 | Ga0373924_0457251 | Ga0373924_0457251_27_557 | 171 |
| 139 | 3300035724 | Ga0373933_0017506 | Ga0373933_0017506_2180_2710 | 171 |
| 140 | 3300036401 | Ga0373937_0344507 | Ga0373937_0344507_620_1150 | 171 |
| 141 | 3300036401 | Ga0373937_0878432 | Ga0373937_0878432_189_734 | 171 |
| 142 | 3300036401 | Ga0373937_1249683 | Ga0373937_1249683_44_574 | 171 |
| 143 | 3300037068 | Ga0373925_0417556 | Ga0373925_0417556_65_595 | 171 |
| 144 | 3300045051 | Ga0451576_0864391 | Ga0451576_0864391_157_705 | 171 |
| 145 | 3300045051 | Ga0451576_1257466 | Ga0451576_1257466_207_737 | 171 |
| 146 | 3300046454 | Ga0495592_0193281 | Ga0495592_0193281_747_1277 | 171 |
| 147 | 3300046476 | Ga0495662_0193347 | Ga0495662_0193347_46_576 | 171 |
| 148 | 3300046477 | Ga0495664_0373881 | Ga0495664_0373881_46_576 | 171 |
| 149 | 3300046516 | Ga0495628_0108957 | Ga0495628_0108957_726_1256 | 171 |
| 150 | 3300046517 | Ga0495630_0859968 | Ga0495630_0859968_113_643 | 171 |
| 151 | 3300046529 | Ga0495652_0162970 | Ga0495652_0162970_396_926 | 171 |
| 152 | 3300046535 | Ga0495586_0250058 | Ga0495586_0250058_225_770 | 171 |
| 153 | 3300046557 | Ga0495622_0011971 | Ga0495622_0011971_971_1603 | 171 |
| 154 | 3300046559 | Ga0495667_0187539 | Ga0495667_0187539_433_978 | 171 |
| 155 | 3300046559 | Ga0495667_0517428 | Ga0495667_0517428_21_551 | 171 |
| 156 | 3300046678 | Ga0495599_0211314 | Ga0495599_0211314_54_584 | 171 |
| 157 | 3300046809 | Ga0495600_0584656 | Ga0495600_0584656_94_624 | 171 |
| 158 | 3300047319 | Ga0495674_0022746 | Ga0495674_0022746_128_658 | 171 |
| 159 | 3300047322 | Ga0495680_0501734 | Ga0495680_0501734_247_777 | 171 |
| 160 | 3300047322 | Ga0495680_0507531 | Ga0495680_0507531_175_720 | 171 |
| 161 | 3300047444 | Ga0495675_0188982 | Ga0495675_0188982_526_1056 | 171 |
| 162 | 3300047471 | Ga0495684_0109209 | Ga0495684_0109209_564_1094 | 171 |
| 163 | 3300053730 | Ga0500645_029124 | Ga0500645_029124_40_573 | 171 |
| 164 | 3300005353 | Ga0070669_100604058 | Ga0070669_1006040581 | 172 |
| 165 | 3300005518 | Ga0070699_100478535 | Ga0070699_1004785351 | 172 |
| 166 | 3300005535 | Ga0070684_100622220 | Ga0070684_1006222202 | 172 |
| 167 | 3300005842 | Ga0068858_100243832 | Ga0068858_1002438322 | 172 |
| 168 | 3300006237 | Ga0097621_100303207 | Ga0097621_1003032072 | 172 |
| 169 | 3300006844 | Ga0075428_100008693 | Ga0075428_10000869310 | 172 |
| 170 | 3300009093 | Ga0105240_10970742 | Ga0105240_109707422 | 172 |
| 171 | 3300009094 | Ga0111539_10027890 | Ga0111539_100278907 | 172 |
| 172 | 3300009147 | Ga0114129_10525833 | Ga0114129_105258332 | 172 |
| 173 | 3300013307 | Ga0157372_12390886 | Ga0157372_123908861 | 172 |
| 174 | 3300025944 | Ga0207661_11333830 | Ga0207661_113338301 | 172 |
| 175 | 3300028558 | Ga0265326_10005542 | Ga0265326_100055423 | 172 |
| 176 | 3300028800 | Ga0265338_10001139 | Ga0265338_1000113925 | 172 |
| 177 | 3300028800 | Ga0265338_10134715 | Ga0265338_101347152 | 172 |
| 178 | 3300029957 | Ga0265324_10000911 | Ga0265324_1000091122 | 172 |
| 179 | 3300031240 | Ga0265320_10114131 | Ga0265320_101141312 | 172 |
| 180 | 3300031241 | Ga0265325_10025853 | Ga0265325_100258532 | 172 |
| 181 | 3300031247 | Ga0265340_10147411 | Ga0265340_101474112 | 172 |
| 182 | 3300031251 | Ga0265327_10002967 | Ga0265327_100029679 | 172 |
| 183 | 3300031251 | Ga0265327_10025339 | Ga0265327_100253393 | 172 |
| 184 | 3300031344 | Ga0265316_10316481 | Ga0265316_103164812 | 172 |
| 185 | 3300049581 | Ga0501047_0482033 | Ga0501047_0482033_330_866 | 172 |
| 186 | 3300049822 | Ga0501035_0127979 | Ga0501035_0127979_140_676 | 172 |
| 187 | 3300050511 | nmdc:mga08y16_26211_c1 | nmdc:mga08y16_26211_c1_1776_2336 | 172 |
| 188 | 3300005331 | Ga0070670_100054488 | Ga0070670_1000544883 | 173 |
| 189 | 3300005577 | Ga0068857_100535180 | Ga0068857_1005351802 | 173 |
| 190 | 3300028573 | Ga0265334_10097299 | Ga0265334_100972992 | 173 |
| 191 | 3300028573 | Ga0265334_10157087 | Ga0265334_101570872 | 173 |
| 192 | 3300042876 | Ga0451577_0172310 | Ga0451577_0172310_475_1029 | 173 |
| 193 | 3300046454 | Ga0495592_0000101 | Ga0495592_0000101_56703_57242 | 173 |
| 194 | 3300046476 | Ga0495662_0223357 | Ga0495662_0223357_134_673 | 173 |
| 195 | 3300046477 | Ga0495664_0009030 | Ga0495664_0009030_165_704 | 173 |
| 196 | 3300046514 | Ga0495618_0013607 | Ga0495618_0013607_4253_4792 | 173 |
| 197 | 3300046516 | Ga0495628_0618699 | Ga0495628_0618699_48_587 | 173 |
| 198 | 3300046517 | Ga0495630_0547473 | Ga0495630_0547473_134_673 | 173 |
| 199 | 3300046529 | Ga0495652_0072480 | Ga0495652_0072480_310_849 | 173 |
| 200 | 3300046535 | Ga0495586_0000348 | Ga0495586_0000348_147_686 | 173 |
| 201 | 3300047319 | Ga0495674_0052043 | Ga0495674_0052043_99_638 | 173 |
| 202 | 3300005539 | Ga0068853_100000006 | Ga0068853_100000006119 | 174 |
| 203 | 3300005564 | Ga0070664_100788640 | Ga0070664_1007886402 | 174 |
| 204 | 3300006175 | Ga0070712_100164467 | Ga0070712_1001644672 | 174 |
| 205 | 3300009553 | Ga0105249_10466721 | Ga0105249_104667212 | 174 |
| 206 | 3300013308 | Ga0157375_10803709 | Ga0157375_108037091 | 174 |
| 207 | 3300025915 | Ga0207693_10181770 | Ga0207693_101817702 | 174 |
| 208 | 3300025945 | Ga0207679_10916190 | Ga0207679_109161901 | 174 |
| 209 | 3300026041 | Ga0207639_10000001 | Ga0207639_100000011018 | 174 |
| 210 | 3300028573 | Ga0265334_10157886 | Ga0265334_101578862 | 174 |
| 211 | 3300028653 | Ga0265323_10020567 | Ga0265323_100205673 | 174 |
| 212 | 3300028666 | Ga0265336_10017103 | Ga0265336_100171031 | 174 |
| 213 | 3300028800 | Ga0265338_10088813 | Ga0265338_100888132 | 174 |
| 214 | 3300031344 | Ga0265316_10014755 | Ga0265316_100147558 | 174 |
| 215 | 3300031711 | Ga0265314_10025645 | Ga0265314_100256454 | 174 |
| 216 | 3300039437 | Ga0436365_1796911 | Ga0436365_1796911_311_853 | 174 |
| 217 | 3300046462 | Ga0495651_0201433 | Ga0495651_0201433_41_583 | 174 |
| 218 | 3300046516 | Ga0495628_0093625 | Ga0495628_0093625_1069_1611 | 174 |
| 219 | 3300046543 | Ga0495645_0011192 | Ga0495645_0011192_1557_2099 | 174 |
| 220 | 3300046689 | Ga0495613_0166327 | Ga0495613_0166327_82_624 | 174 |
| 221 | 3300046809 | Ga0495600_0362769 | Ga0495600_0362769_48_590 | 174 |
| 222 | 3300047322 | Ga0495680_0458224 | Ga0495680_0458224_250_807 | 174 |
| 223 | 3300047444 | Ga0495675_0342040 | Ga0495675_0342040_107_664 | 174 |
| 224 | 3300053077 | Ga0495601_0047531 | Ga0495601_0047531_1777_2319 | 174 |
| 225 | 3300005327 | Ga0070658_10252623 | Ga0070658_102526233 | 175 |
| 226 | 3300005842 | Ga0068858_100014879 | Ga0068858_1000148796 | 175 |
| 227 | 3300005844 | Ga0068862_100451181 | Ga0068862_1004511811 | 175 |
| 228 | 3300009545 | Ga0105237_10519570 | Ga0105237_105195702 | 175 |
| 229 | 3300010375 | Ga0105239_10792687 | Ga0105239_107926872 | 175 |
| 230 | 3300025949 | Ga0207667_10382294 | Ga0207667_103822943 | 175 |
| 231 | 3300026035 | Ga0207703_10005916 | Ga0207703_100059166 | 175 |
| 232 | 3300028381 | Ga0268264_10931157 | Ga0268264_109311572 | 175 |
| 233 | 3300031247 | Ga0265340_10000246 | Ga0265340_1000024622 | 175 |
| 234 | 3300041441 | Ga0451787_043969 | Ga0451787_043969_349_993 | 175 |
| 235 | 3300044712 | Ga0453684_1361902 | Ga0453684_1361902_67_624 | 175 |
| 236 | 3300010375 | Ga0105239_10390727 | Ga0105239_103907271 | 176 |
| 237 | 3300026088 | Ga0207641_10582938 | Ga0207641_105829382 | 176 |
| 238 | 3300031247 | Ga0265340_10058414 | Ga0265340_100584141 | 176 |
| 239 | 3300031344 | Ga0265316_10413337 | Ga0265316_104133372 | 176 |
| 240 | 3300003791 | Ga0055530_10013004 | Ga0055530_100130042 | 177 |
| 241 | 3300006195 | Ga0075366_10051266 | Ga0075366_100512663 | 177 |
| 242 | 3300025298 | Ga0209050_1002655 | Ga0209050_10026554 | 177 |
| 243 | 3300035692 | Ga0373935_0633908 | Ga0373935_0633908_174_731 | 177 |
| 244 | 3300046522 | Ga0495643_0000057 | Ga0495643_0000057_111688_112254 | 177 |
| 245 | 3300050489 | nmdc:mga03683_17945_c1 | nmdc:mga03683_17945_c1_1748_2311 | 177 |
| 246 | 3300050493 | nmdc:mga0k408_548533_c1 | nmdc:mga0k408_548533_c1_44_607 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5im6-assembly1.cif.gz_A | crystal structure of designed two-component self-assembling icosahedral cage i32-28 | 0.9288 | 25 | 176 |
| 8g3k-assembly1.cif.gz_B | cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp | 0.926 | 25 | 176 |
| 2zhy-assembly1.cif.gz_A | crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis | 0.9245 | 25 | 176 |
| 5vl4-assembly1.cif.gz_A | accidental minimum contact crystal lattice formed by a redesigned protein oligomer | 0.9168 | 25 | 176 |
| 7ruv-assembly2.cif.gz_B | structure of human atp:cobalamin adenosyltransferase e193k bound to adenosylcobalamin | 0.9159 | 25 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zhzB01 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9273 | 12 | 176 | 1.20.1200.10 |
| 5cy5B00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9114 | 28 | 176 | 1.20.1200.10 |
| 1wvtA00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9104 | 23 | 176 | 1.20.1200.10 |
| 2ah6A00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.9044 | 25 | 176 | 1.20.1200.10 |
| 5cy5A00 | Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like | 0.8958 | 25 | 176 | 1.20.1200.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6K5D8-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9509 | 32 | 176 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A3E1DXF3-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.95 | 1 | 176 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A6L7WY77-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9456 | 6 | 176 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A3D2YUG6-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9447 | 20 | 172 |
GO:0005524
GO:0008817 GO:0009236 |
| AF-A0A1Q7S8D1-F1-model_v4 | Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) | 0.9436 | 21 | 176 |
GO:0005524
GO:0008817 GO:0009236 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar