F358260

General Info

Members Datasets Scaffolds Average Seq Length
246 134 246 179

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10020567|Ga0265323_100205673
Length 202
Sequence MSVVTKTGDSGTTALMYGRRVPKNHPRVEACGAVDELNAALGLARATATDKFVARNLPAIQKDLIVLMGELGVLRRDLPRYFRSGHSRVTPAMTATLDASVQEIESQNMTFKGWAMPGATLHSAALDVARTVCRRAERRVCALKESGGLVNVEIIIYLNRLSDLLWLFARRVETAEVRPPNSPPKIKTRAGRFILRVSSAGK

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
68 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
69 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
70 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
71 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
72 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
73 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
76 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 1.22
Rhizosphere 95.53
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10013004 3300003791 Bacteria 2865
2 Ga0070658_10129310 3300005327 Unclassified 2104
3 Ga0070658_10252623 3300005327 Bacteria 1496
4 Ga0070670_100054488 3300005331 Unclassified 3434
5 Ga0070660_100140510 3300005339 Bacteria 1937
6 Ga0070689_100311530 3300005340 Unclassified 1312
7 Ga0070691_10013855 3300005341 Unclassified 3700
8 Ga0070691_10270596 3300005341 Bacteria 918
9 Ga0070669_100604058 3300005353 Bacteria 919
10 Ga0070714_100001788 3300005435 Bacteria 15659
11 Ga0070713_101187894 3300005436 Unclassified 738
12 Ga0070711_100019884 3300005439 Bacteria 4318
13 Ga0070694_100011974 3300005444 Bacteria 5383
14 Ga0070708_100209518 3300005445 Unclassified 1826
15 Ga0070708_100522658 3300005445 Unclassified 1119
16 Ga0070681_10012431 3300005458 Bacteria 8445
17 Ga0070681_10331961 3300005458 Bacteria 1430
18 Ga0070685_10533077 3300005466 Unclassified 835
19 Ga0070707_100000444 3300005468 Archaea 41019
20 Ga0070707_100016755 3300005468 Bacteria 6879
21 Ga0070707_100251667 3300005468 Unclassified 1719
22 Ga0070707_100252892 3300005468 Unclassified 1715
23 Ga0070707_100936731 3300005468 Archaea 831
24 Ga0070699_100006022 3300005518 Archaea 10601
25 Ga0070699_100478535 3300005518 Unclassified 1130
26 Ga0070679_100072798 3300005530 Bacteria 3429
27 Ga0070684_100622220 3300005535 Bacteria 1004
28 Ga0070697_100022193 3300005536 Archaea 5037
29 Ga0070697_100107749 3300005536 Archaea 2318
30 Ga0070697_100213949 3300005536 Bacteria 1642
31 Ga0068853_100000006 3300005539 Bacteria 295921
32 Ga0070686_100199864 3300005544 Bacteria 1432
33 Ga0068855_100073708 3300005563 Bacteria 3966
34 Ga0068855_100094428 3300005563 Bacteria 3449
35 Ga0068855_100122993 3300005563 Bacteria 2969
36 Ga0068855_100653534 3300005563 Unclassified 1129
37 Ga0070664_100788640 3300005564 Unclassified 888
38 Ga0068857_100535180 3300005577 Unclassified 1102
39 Ga0068857_100898166 3300005577 Unclassified 849
40 Ga0068854_100855680 3300005578 Bacteria 796
41 Ga0068856_100675310 3300005614 Bacteria 1053
42 Ga0068858_100014879 3300005842 Bacteria 7318
43 Ga0068858_100243832 3300005842 Bacteria 1705
44 Ga0068862_100451181 3300005844 Bacteria 1212
45 Ga0070712_100164467 3300006175 Bacteria 1716
46 Ga0075366_10051266 3300006195 Bacteria 2452
47 Ga0097621_100303207 3300006237 Bacteria 1411
48 Ga0075428_100008693 3300006844 Bacteria 11266
49 Ga0075436_100489642 3300006914 Unclassified 899
50 Ga0075435_100390545 3300007076 Unclassified 1196
51 Ga0099794_10002757 3300007265 Archaea 6558
52 Ga0099794_10006370 3300007265 Unclassified 4776
53 Ga0099794_10015987 3300007265 Bacteria 3320
54 Ga0099794_10074601 3300007265 Unclassified 1666
55 Ga0099794_10109110 3300007265 Bacteria 1385
56 Ga0105240_10019053 3300009093 Bacteria 9178
57 Ga0105240_10110316 3300009093 Bacteria 3330
58 Ga0105240_10327995 3300009093 Unclassified 1743
59 Ga0105240_10970742 3300009093 Bacteria 910
60 Ga0111539_10027890 3300009094 Bacteria 6895
61 Ga0114129_10525833 3300009147 Bacteria 1542
62 Ga0105237_10519570 3300009545 Unclassified 1197
63 Ga0105238_10008615 3300009551 Bacteria 10206
64 Ga0105238_10293441 3300009551 Bacteria 1609
65 Ga0105249_10466721 3300009553 Bacteria 1303
66 Ga0105239_10390727 3300010375 Bacteria 1574
67 Ga0105239_10792687 3300010375 Bacteria 1085
68 Ga0157370_10271009 3300013104 Bacteria 1568
69 Ga0157369_10938492 3300013105 Bacteria 887
70 Ga0157374_10272476 3300013296 Bacteria 1669
71 Ga0157372_10129903 3300013307 Bacteria 2898
72 Ga0157372_12390886 3300013307 Unclassified 607
73 Ga0157375_10803709 3300013308 Bacteria 1089
74 Ga0213876_10197040 3300021384 Bacteria 1071
75 Ga0209050_1002655 3300025298 Bacteria 14633
76 Ga0207705_10252357 3300025909 Unclassified 1345
77 Ga0207707_10166094 3300025912 Bacteria 1929
78 Ga0207695_10047287 3300025913 Unclassified 4554
79 Ga0207695_10293532 3300025913 Bacteria 1518
80 Ga0207693_10181770 3300025915 Bacteria 1655
81 Ga0207663_10013953 3300025916 Bacteria 4384
82 Ga0207646_10000028 3300025922 Bacteria 227768
83 Ga0207646_10004778 3300025922 Unclassified 14551
84 Ga0207646_10006464 3300025922 Archaea 12099
85 Ga0207646_10124604 3300025922 Unclassified 2316
86 Ga0207646_10802763 3300025922 Archaea 838
87 Ga0207694_10057283 3300025924 Bacteria 3029
88 Ga0207664_10010158 3300025929 Bacteria 6643
89 Ga0207661_11333830 3300025944 Bacteria 659
90 Ga0207679_10916190 3300025945 Unclassified 802
91 Ga0207667_10019439 3300025949 Bacteria 7584
92 Ga0207667_10089764 3300025949 Bacteria 3176
93 Ga0207667_10382294 3300025949 Bacteria 1434
94 Ga0207703_10005916 3300026035 Bacteria 9804
95 Ga0207703_10249250 3300026035 Unclassified 1600
96 Ga0207639_10000001 3300026041 Bacteria 1431562
97 Ga0207639_10235466 3300026041 Unclassified 1589
98 Ga0207702_10684575 3300026078 Unclassified 1010
99 Ga0207641_10582938 3300026088 Bacteria 1093
100 Ga0209588_1000728 3300027671 Bacteria 8305
101 Ga0209588_1002822 3300027671 Archaea 4758
102 Ga0209588_1012446 3300027671 Unclassified 2583
103 Ga0268264_10931157 3300028381 Bacteria 873
104 Ga0265337_1001501 3300028556 Bacteria 11453
105 Ga0265337_1156549 3300028556 Unclassified 617
106 Ga0265326_10005542 3300028558 Bacteria 3980
107 Ga0265326_10017107 3300028558 Bacteria 2094
108 Ga0265319_1045579 3300028563 Bacteria 1464
109 Ga0265334_10051833 3300028573 Bacteria 1572
110 Ga0265334_10097299 3300028573 Bacteria 1068
111 Ga0265334_10157087 3300028573 Unclassified 800
112 Ga0265334_10157886 3300028573 Bacteria 798
113 Ga0265323_10005993 3300028653 Bacteria 5140
114 Ga0265323_10020567 3300028653 Bacteria 2540
115 Ga0265323_10039762 3300028653 Unclassified 1714
116 Ga0265323_10117585 3300028653 Bacteria 868
117 Ga0265322_10059879 3300028654 Bacteria 1080
118 Ga0265336_10017103 3300028666 Unclassified 2363
119 Ga0265336_10049834 3300028666 Bacteria 1268
120 Ga0265338_10000038 3300028800 Bacteria 237195
121 Ga0265338_10000214 3300028800 Bacteria 106870
122 Ga0265338_10000843 3300028800 Bacteria 51673
123 Ga0265338_10001139 3300028800 Bacteria 43978
124 Ga0265338_10002771 3300028800 Bacteria 25646
125 Ga0265338_10003168 3300028800 Bacteria 23481
126 Ga0265338_10004557 3300028800 Bacteria 18651
127 Ga0265338_10004765 3300028800 Bacteria 18132
128 Ga0265338_10088813 3300028800 Unclassified 2563
129 Ga0265338_10090095 3300028800 Bacteria 2539
130 Ga0265338_10134715 3300028800 Bacteria 1944
131 Ga0265338_10176582 3300028800 Bacteria 1632
132 Ga0265338_10205872 3300028800 Unclassified 1480
133 Ga0265338_10282794 3300028800 Bacteria 1211
134 Ga0265338_10530988 3300028800 Bacteria 825
135 Ga0265338_10650252 3300028800 Bacteria 731
136 Ga0265324_10000911 3300029957 Bacteria 18695
137 Ga0265324_10099967 3300029957 Bacteria 986
138 Ga0265324_10138123 3300029957 Unclassified 828
139 Ga0265320_10000364 3300031240 Bacteria 36776
140 Ga0265320_10011935 3300031240 Bacteria 5086
141 Ga0265320_10049178 3300031240 Bacteria 2053
142 Ga0265320_10114131 3300031240 Unclassified 1236
143 Ga0265320_10229417 3300031240 Bacteria 826
144 Ga0265325_10006938 3300031241 Bacteria 6834
145 Ga0265325_10012831 3300031241 Bacteria 4781
146 Ga0265325_10025853 3300031241 Bacteria 3185
147 Ga0265340_10000246 3300031247 Bacteria 28156
148 Ga0265340_10058414 3300031247 Bacteria 1852
149 Ga0265340_10109176 3300031247 Unclassified 1280
150 Ga0265340_10147411 3300031247 Unclassified 1074
151 Ga0265339_10011911 3300031249 Bacteria 5331
152 Ga0265339_10083331 3300031249 Bacteria 1686
153 Ga0265327_10001745 3300031251 Bacteria 25747
154 Ga0265327_10002967 3300031251 Bacteria 16924
155 Ga0265327_10025339 3300031251 Bacteria 3461
156 Ga0265316_10008385 3300031344 Bacteria 9599
157 Ga0265316_10014755 3300031344 Bacteria 6859
158 Ga0265316_10136913 3300031344 Unclassified 1842
159 Ga0265316_10316481 3300031344 Bacteria 1134
160 Ga0265316_10344602 3300031344 Bacteria 1079
161 Ga0265316_10413337 3300031344 Unclassified 970
162 Ga0265316_10478586 3300031344 Bacteria 891
163 Ga0265313_10002951 3300031595 Bacteria 14195
164 Ga0265314_10025645 3300031711 Bacteria 4442
165 Ga0265314_10086445 3300031711 Bacteria 2053
166 Ga0265314_10224204 3300031711 Unclassified 1095
167 Ga0265342_10262107 3300031712 Bacteria 919
168 Ga0373934_0259017 3300035086 Unclassified 720
169 Ga0373953_0003541 3300035117 Bacteria 4878
170 Ga0373954_0052687 3300035118 Bacteria 1912
171 Ga0373956_0007923 3300035119 Bacteria 4288
172 Ga0373957_0299444 3300035120 Bacteria 682
173 Ga0373924_0457251 3300035410 Unclassified 572
174 Ga0373935_0633908 3300035692 Bacteria 783
175 Ga0373933_0017506 3300035724 Bacteria 4020
176 Ga0373933_0036232 3300035724 Bacteria 2886
177 Ga0373937_0001257 3300036401 Bacteria 21283
178 Ga0373937_0344507 3300036401 Unclassified 1411
179 Ga0373937_0878432 3300036401 Bacteria 845
180 Ga0373937_1249683 3300036401 Bacteria 691
181 Ga0373925_0417556 3300037068 Bacteria 1096
182 Ga0436365_1796911 3300039437 Bacteria 2110
183 Ga0451787_043969 3300041441 Bacteria 1136
184 Ga0451577_0172310 3300042876 Bacteria 1950
185 Ga0453684_1361902 3300044712 Unclassified 738
186 Ga0451576_0022881 3300045051 Bacteria 6772
187 Ga0451576_0864391 3300045051 Bacteria 949
188 Ga0451576_1257466 3300045051 Bacteria 772
189 Ga0495592_0000101 3300046454 Bacteria 75856
190 Ga0495592_0193281 3300046454 Bacteria 1378
191 Ga0495651_0201433 3300046462 Bacteria 1393
192 Ga0495662_0193347 3300046476 Unclassified 1003
193 Ga0495662_0223357 3300046476 Bacteria 928
194 Ga0495664_0009030 3300046477 Bacteria 5572
195 Ga0495664_0373881 3300046477 Unclassified 857
196 Ga0495608_0412360 3300046511 Bacteria 825
197 Ga0495618_0002290 3300046514 Bacteria 12403
198 Ga0495618_0013607 3300046514 Bacteria 4952
199 Ga0495628_0093625 3300046516 Bacteria 2324
200 Ga0495628_0108957 3300046516 Bacteria 2132
201 Ga0495628_0618699 3300046516 Unclassified 772
202 Ga0495630_0220150 3300046517 Bacteria 1449
203 Ga0495630_0547473 3300046517 Bacteria 887
204 Ga0495630_0859968 3300046517 Bacteria 691
205 Ga0495643_0000057 3300046522 Bacteria 195145
206 Ga0495666_0059534 3300046526 Unclassified 1826
207 Ga0495652_0072480 3300046529 Bacteria 2871
208 Ga0495652_0162970 3300046529 Unclassified 1729
209 Ga0495586_0000348 3300046535 Bacteria 29056
210 Ga0495586_0000548 3300046535 Bacteria 21893
211 Ga0495586_0250058 3300046535 Bacteria 1011
212 Ga0495587_0382076 3300046536 Bacteria 783
213 Ga0495645_0011192 3300046543 Bacteria 6311
214 Ga0495645_0448646 3300046543 Bacteria 814
215 Ga0495622_0011971 3300046557 Bacteria 4013
216 Ga0495667_0028593 3300046559 Bacteria 3755
217 Ga0495667_0187539 3300046559 Bacteria 1326
218 Ga0495667_0517428 3300046559 Bacteria 747
219 Ga0495635_0030671 3300046663 Bacteria 3735
220 Ga0495599_0211314 3300046678 Unclassified 1189
221 Ga0495669_0254843 3300046684 Unclassified 843
222 Ga0495613_0003977 3300046689 Bacteria 11062
223 Ga0495613_0166327 3300046689 Bacteria 1567
224 Ga0495600_0362769 3300046809 Bacteria 906
225 Ga0495600_0584656 3300046809 Bacteria 680
226 Ga0495581_0121361 3300047315 Unclassified 1521
227 Ga0495674_0022746 3300047319 Bacteria 5778
228 Ga0495674_0052043 3300047319 Bacteria 3606
229 Ga0495680_0006547 3300047322 Bacteria 10810
230 Ga0495680_0458224 3300047322 Unclassified 872
231 Ga0495680_0501734 3300047322 Unclassified 824
232 Ga0495680_0507531 3300047322 Bacteria 818
233 Ga0495675_0188982 3300047444 Unclassified 1258
234 Ga0495675_0342040 3300047444 Unclassified 881
235 Ga0495684_0109209 3300047471 Unclassified 2089
236 Ga0495684_1015570 3300047471 Unclassified 526
237 Ga0496115_0065661 3300048918 Bacteria 2931
238 Ga0496115_0873011 3300048918 Bacteria 695
239 Ga0501033_0052641 3300049570 Bacteria 3017
240 Ga0501047_0482033 3300049581 Bacteria 1068
241 Ga0501035_0127979 3300049822 Bacteria 2216
242 nmdc:mga03683_17945_c1 3300050489 Bacteria 2684
243 nmdc:mga0k408_548533_c1 3300050493 Unclassified 683
244 nmdc:mga08y16_26211_c1 3300050511 Bacteria 6147
245 Ga0495601_0047531 3300053077 Unclassified 2702
246 Ga0500645_029124 3300053730 Bacteria 1668

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100311530 Ga0070689_1003115302 155
2 3300005466 Ga0070685_10533077 Ga0070685_105330771 155
3 3300005578 Ga0068854_100855680 Ga0068854_1008556801 155
4 3300013104 Ga0157370_10271009 Ga0157370_102710093 155
5 3300026078 Ga0207702_10684575 Ga0207702_106845752 155
6 3300028800 Ga0265338_10282794 Ga0265338_102827942 155
7 3300028556 Ga0265337_1001501 Ga0265337_100150111 156
8 3300028654 Ga0265322_10059879 Ga0265322_100598792 156
9 3300028800 Ga0265338_10000214 Ga0265338_1000021437 156
10 3300028800 Ga0265338_10003168 Ga0265338_100031688 156
11 3300028800 Ga0265338_10004557 Ga0265338_1000455716 156
12 3300029957 Ga0265324_10099967 Ga0265324_100999672 156
13 3300046543 Ga0495645_0448646 Ga0495645_0448646_277_777 156
14 3300005577 Ga0068857_100898166 Ga0068857_1008981661 157
15 3300046526 Ga0495666_0059534 Ga0495666_0059534_1322_1816 158
16 3300047315 Ga0495581_0121361 Ga0495581_0121361_12_506 158
17 3300047471 Ga0495684_1015570 Ga0495684_1015570_15_509 158
18 3300005444 Ga0070694_100011974 Ga0070694_1000119742 159
19 3300021384 Ga0213876_10197040 Ga0213876_101970402 159
20 3300035117 Ga0373953_0003541 Ga0373953_0003541_3286_3786 160
21 3300035119 Ga0373956_0007923 Ga0373956_0007923_1690_2190 160
22 3300035120 Ga0373957_0299444 Ga0373957_0299444_38_538 160
23 3300035724 Ga0373933_0036232 Ga0373933_0036232_2224_2724 160
24 3300036401 Ga0373937_0001257 Ga0373937_0001257_10927_11427 160
25 3300046511 Ga0495608_0412360 Ga0495608_0412360_302_802 160
26 3300046514 Ga0495618_0002290 Ga0495618_0002290_2522_3022 160
27 3300046517 Ga0495630_0220150 Ga0495630_0220150_680_1180 160
28 3300046535 Ga0495586_0000548 Ga0495586_0000548_14024_14524 160
29 3300046536 Ga0495587_0382076 Ga0495587_0382076_74_574 160
30 3300046559 Ga0495667_0028593 Ga0495667_0028593_2377_2877 160
31 3300046663 Ga0495635_0030671 Ga0495635_0030671_589_1089 160
32 3300046689 Ga0495613_0003977 Ga0495613_0003977_3579_4079 160
33 3300047322 Ga0495680_0006547 Ga0495680_0006547_2636_3136 160
34 3300005445 Ga0070708_100209518 Ga0070708_1002095182 169
35 3300005445 Ga0070708_100522658 Ga0070708_1005226582 169
36 3300005468 Ga0070707_100000444 Ga0070707_10000044413 169
37 3300005468 Ga0070707_100016755 Ga0070707_1000167552 169
38 3300005468 Ga0070707_100251667 Ga0070707_1002516672 169
39 3300005468 Ga0070707_100252892 Ga0070707_1002528922 169
40 3300005468 Ga0070707_100936731 Ga0070707_1009367312 169
41 3300005518 Ga0070699_100006022 Ga0070699_1000060221 169
42 3300005536 Ga0070697_100022193 Ga0070697_1000221935 169
43 3300005536 Ga0070697_100107749 Ga0070697_1001077493 169
44 3300005536 Ga0070697_100213949 Ga0070697_1002139492 169
45 3300007265 Ga0099794_10002757 Ga0099794_100027577 169
46 3300007265 Ga0099794_10006370 Ga0099794_100063703 169
47 3300007265 Ga0099794_10015987 Ga0099794_100159872 169
48 3300007265 Ga0099794_10074601 Ga0099794_100746011 169
49 3300007265 Ga0099794_10109110 Ga0099794_101091102 169
50 3300025922 Ga0207646_10000028 Ga0207646_10000028209 169
51 3300025922 Ga0207646_10004778 Ga0207646_100047782 169
52 3300025922 Ga0207646_10006464 Ga0207646_1000646412 169
53 3300025922 Ga0207646_10124604 Ga0207646_101246042 169
54 3300025922 Ga0207646_10802763 Ga0207646_108027632 169
55 3300027671 Ga0209588_1000728 Ga0209588_10007283 169
56 3300027671 Ga0209588_1002822 Ga0209588_10028225 169
57 3300027671 Ga0209588_1012446 Ga0209588_10124462 169
58 3300045051 Ga0451576_0022881 Ga0451576_0022881_36_590 169
59 3300005341 Ga0070691_10013855 Ga0070691_100138553 170
60 3300005341 Ga0070691_10270596 Ga0070691_102705962 170
61 3300005435 Ga0070714_100001788 Ga0070714_1000017888 170
62 3300005458 Ga0070681_10012431 Ga0070681_100124313 170
63 3300005458 Ga0070681_10331961 Ga0070681_103319612 170
64 3300005530 Ga0070679_100072798 Ga0070679_1000727983 170
65 3300005563 Ga0068855_100073708 Ga0068855_1000737083 170
66 3300005563 Ga0068855_100094428 Ga0068855_1000944284 170
67 3300005563 Ga0068855_100122993 Ga0068855_1001229932 170
68 3300005563 Ga0068855_100653534 Ga0068855_1006535342 170
69 3300005614 Ga0068856_100675310 Ga0068856_1006753102 170
70 3300009093 Ga0105240_10019053 Ga0105240_100190533 170
71 3300009093 Ga0105240_10110316 Ga0105240_101103165 170
72 3300009093 Ga0105240_10327995 Ga0105240_103279952 170
73 3300009551 Ga0105238_10008615 Ga0105238_1000861510 170
74 3300013105 Ga0157369_10938492 Ga0157369_109384921 170
75 3300013296 Ga0157374_10272476 Ga0157374_102724762 170
76 3300013307 Ga0157372_10129903 Ga0157372_101299033 170
77 3300025912 Ga0207707_10166094 Ga0207707_101660941 170
78 3300025913 Ga0207695_10047287 Ga0207695_100472874 170
79 3300025913 Ga0207695_10293532 Ga0207695_102935322 170
80 3300025924 Ga0207694_10057283 Ga0207694_100572834 170
81 3300025929 Ga0207664_10010158 Ga0207664_100101585 170
82 3300025949 Ga0207667_10019439 Ga0207667_1001943912 170
83 3300025949 Ga0207667_10089764 Ga0207667_100897643 170
84 3300026041 Ga0207639_10235466 Ga0207639_102354662 170
85 3300028653 Ga0265323_10005993 Ga0265323_100059932 170
86 3300028800 Ga0265338_10002771 Ga0265338_100027714 170
87 3300028800 Ga0265338_10650252 Ga0265338_106502521 170
88 3300031344 Ga0265316_10478586 Ga0265316_104785862 170
89 3300046684 Ga0495669_0254843 Ga0495669_0254843_165_695 170
90 3300048918 Ga0496115_0065661 Ga0496115_0065661_257_787 170
91 3300048918 Ga0496115_0873011 Ga0496115_0873011_119_676 170
92 3300049570 Ga0501033_0052641 Ga0501033_0052641_1018_1548 170
93 3300005327 Ga0070658_10129310 Ga0070658_101293103 171
94 3300005339 Ga0070660_100140510 Ga0070660_1001405103 171
95 3300005436 Ga0070713_101187894 Ga0070713_1011878941 171
96 3300005439 Ga0070711_100019884 Ga0070711_1000198843 171
97 3300005544 Ga0070686_100199864 Ga0070686_1001998641 171
98 3300006914 Ga0075436_100489642 Ga0075436_1004896421 171
99 3300007076 Ga0075435_100390545 Ga0075435_1003905452 171
100 3300009551 Ga0105238_10293441 Ga0105238_102934412 171
101 3300025909 Ga0207705_10252357 Ga0207705_102523572 171
102 3300025916 Ga0207663_10013953 Ga0207663_100139533 171
103 3300026035 Ga0207703_10249250 Ga0207703_102492501 171
104 3300028556 Ga0265337_1156549 Ga0265337_11565491 171
105 3300028558 Ga0265326_10017107 Ga0265326_100171072 171
106 3300028563 Ga0265319_1045579 Ga0265319_10455792 171
107 3300028573 Ga0265334_10051833 Ga0265334_100518332 171
108 3300028653 Ga0265323_10039762 Ga0265323_100397622 171
109 3300028653 Ga0265323_10117585 Ga0265323_101175851 171
110 3300028666 Ga0265336_10049834 Ga0265336_100498342 171
111 3300028800 Ga0265338_10000038 Ga0265338_10000038113 171
112 3300028800 Ga0265338_10000843 Ga0265338_1000084332 171
113 3300028800 Ga0265338_10004765 Ga0265338_1000476517 171
114 3300028800 Ga0265338_10090095 Ga0265338_100900952 171
115 3300028800 Ga0265338_10176582 Ga0265338_101765822 171
116 3300028800 Ga0265338_10205872 Ga0265338_102058722 171
117 3300028800 Ga0265338_10530988 Ga0265338_105309881 171
118 3300029957 Ga0265324_10138123 Ga0265324_101381232 171
119 3300031240 Ga0265320_10000364 Ga0265320_1000036414 171
120 3300031240 Ga0265320_10011935 Ga0265320_100119352 171
121 3300031240 Ga0265320_10049178 Ga0265320_100491782 171
122 3300031240 Ga0265320_10229417 Ga0265320_102294172 171
123 3300031241 Ga0265325_10006938 Ga0265325_100069386 171
124 3300031241 Ga0265325_10012831 Ga0265325_100128313 171
125 3300031247 Ga0265340_10109176 Ga0265340_101091762 171
126 3300031249 Ga0265339_10011911 Ga0265339_100119117 171
127 3300031249 Ga0265339_10083331 Ga0265339_100833312 171
128 3300031251 Ga0265327_10001745 Ga0265327_1000174519 171
129 3300031344 Ga0265316_10008385 Ga0265316_1000838511 171
130 3300031344 Ga0265316_10136913 Ga0265316_101369132 171
131 3300031344 Ga0265316_10344602 Ga0265316_103446022 171
132 3300031595 Ga0265313_10002951 Ga0265313_100029514 171
133 3300031711 Ga0265314_10086445 Ga0265314_100864452 171
134 3300031711 Ga0265314_10224204 Ga0265314_102242041 171
135 3300031712 Ga0265342_10262107 Ga0265342_102621071 171
136 3300035086 Ga0373934_0259017 Ga0373934_0259017_80_610 171
137 3300035118 Ga0373954_0052687 Ga0373954_0052687_873_1403 171
138 3300035410 Ga0373924_0457251 Ga0373924_0457251_27_557 171
139 3300035724 Ga0373933_0017506 Ga0373933_0017506_2180_2710 171
140 3300036401 Ga0373937_0344507 Ga0373937_0344507_620_1150 171
141 3300036401 Ga0373937_0878432 Ga0373937_0878432_189_734 171
142 3300036401 Ga0373937_1249683 Ga0373937_1249683_44_574 171
143 3300037068 Ga0373925_0417556 Ga0373925_0417556_65_595 171
144 3300045051 Ga0451576_0864391 Ga0451576_0864391_157_705 171
145 3300045051 Ga0451576_1257466 Ga0451576_1257466_207_737 171
146 3300046454 Ga0495592_0193281 Ga0495592_0193281_747_1277 171
147 3300046476 Ga0495662_0193347 Ga0495662_0193347_46_576 171
148 3300046477 Ga0495664_0373881 Ga0495664_0373881_46_576 171
149 3300046516 Ga0495628_0108957 Ga0495628_0108957_726_1256 171
150 3300046517 Ga0495630_0859968 Ga0495630_0859968_113_643 171
151 3300046529 Ga0495652_0162970 Ga0495652_0162970_396_926 171
152 3300046535 Ga0495586_0250058 Ga0495586_0250058_225_770 171
153 3300046557 Ga0495622_0011971 Ga0495622_0011971_971_1603 171
154 3300046559 Ga0495667_0187539 Ga0495667_0187539_433_978 171
155 3300046559 Ga0495667_0517428 Ga0495667_0517428_21_551 171
156 3300046678 Ga0495599_0211314 Ga0495599_0211314_54_584 171
157 3300046809 Ga0495600_0584656 Ga0495600_0584656_94_624 171
158 3300047319 Ga0495674_0022746 Ga0495674_0022746_128_658 171
159 3300047322 Ga0495680_0501734 Ga0495680_0501734_247_777 171
160 3300047322 Ga0495680_0507531 Ga0495680_0507531_175_720 171
161 3300047444 Ga0495675_0188982 Ga0495675_0188982_526_1056 171
162 3300047471 Ga0495684_0109209 Ga0495684_0109209_564_1094 171
163 3300053730 Ga0500645_029124 Ga0500645_029124_40_573 171
164 3300005353 Ga0070669_100604058 Ga0070669_1006040581 172
165 3300005518 Ga0070699_100478535 Ga0070699_1004785351 172
166 3300005535 Ga0070684_100622220 Ga0070684_1006222202 172
167 3300005842 Ga0068858_100243832 Ga0068858_1002438322 172
168 3300006237 Ga0097621_100303207 Ga0097621_1003032072 172
169 3300006844 Ga0075428_100008693 Ga0075428_10000869310 172
170 3300009093 Ga0105240_10970742 Ga0105240_109707422 172
171 3300009094 Ga0111539_10027890 Ga0111539_100278907 172
172 3300009147 Ga0114129_10525833 Ga0114129_105258332 172
173 3300013307 Ga0157372_12390886 Ga0157372_123908861 172
174 3300025944 Ga0207661_11333830 Ga0207661_113338301 172
175 3300028558 Ga0265326_10005542 Ga0265326_100055423 172
176 3300028800 Ga0265338_10001139 Ga0265338_1000113925 172
177 3300028800 Ga0265338_10134715 Ga0265338_101347152 172
178 3300029957 Ga0265324_10000911 Ga0265324_1000091122 172
179 3300031240 Ga0265320_10114131 Ga0265320_101141312 172
180 3300031241 Ga0265325_10025853 Ga0265325_100258532 172
181 3300031247 Ga0265340_10147411 Ga0265340_101474112 172
182 3300031251 Ga0265327_10002967 Ga0265327_100029679 172
183 3300031251 Ga0265327_10025339 Ga0265327_100253393 172
184 3300031344 Ga0265316_10316481 Ga0265316_103164812 172
185 3300049581 Ga0501047_0482033 Ga0501047_0482033_330_866 172
186 3300049822 Ga0501035_0127979 Ga0501035_0127979_140_676 172
187 3300050511 nmdc:mga08y16_26211_c1 nmdc:mga08y16_26211_c1_1776_2336 172
188 3300005331 Ga0070670_100054488 Ga0070670_1000544883 173
189 3300005577 Ga0068857_100535180 Ga0068857_1005351802 173
190 3300028573 Ga0265334_10097299 Ga0265334_100972992 173
191 3300028573 Ga0265334_10157087 Ga0265334_101570872 173
192 3300042876 Ga0451577_0172310 Ga0451577_0172310_475_1029 173
193 3300046454 Ga0495592_0000101 Ga0495592_0000101_56703_57242 173
194 3300046476 Ga0495662_0223357 Ga0495662_0223357_134_673 173
195 3300046477 Ga0495664_0009030 Ga0495664_0009030_165_704 173
196 3300046514 Ga0495618_0013607 Ga0495618_0013607_4253_4792 173
197 3300046516 Ga0495628_0618699 Ga0495628_0618699_48_587 173
198 3300046517 Ga0495630_0547473 Ga0495630_0547473_134_673 173
199 3300046529 Ga0495652_0072480 Ga0495652_0072480_310_849 173
200 3300046535 Ga0495586_0000348 Ga0495586_0000348_147_686 173
201 3300047319 Ga0495674_0052043 Ga0495674_0052043_99_638 173
202 3300005539 Ga0068853_100000006 Ga0068853_100000006119 174
203 3300005564 Ga0070664_100788640 Ga0070664_1007886402 174
204 3300006175 Ga0070712_100164467 Ga0070712_1001644672 174
205 3300009553 Ga0105249_10466721 Ga0105249_104667212 174
206 3300013308 Ga0157375_10803709 Ga0157375_108037091 174
207 3300025915 Ga0207693_10181770 Ga0207693_101817702 174
208 3300025945 Ga0207679_10916190 Ga0207679_109161901 174
209 3300026041 Ga0207639_10000001 Ga0207639_100000011018 174
210 3300028573 Ga0265334_10157886 Ga0265334_101578862 174
211 3300028653 Ga0265323_10020567 Ga0265323_100205673 174
212 3300028666 Ga0265336_10017103 Ga0265336_100171031 174
213 3300028800 Ga0265338_10088813 Ga0265338_100888132 174
214 3300031344 Ga0265316_10014755 Ga0265316_100147558 174
215 3300031711 Ga0265314_10025645 Ga0265314_100256454 174
216 3300039437 Ga0436365_1796911 Ga0436365_1796911_311_853 174
217 3300046462 Ga0495651_0201433 Ga0495651_0201433_41_583 174
218 3300046516 Ga0495628_0093625 Ga0495628_0093625_1069_1611 174
219 3300046543 Ga0495645_0011192 Ga0495645_0011192_1557_2099 174
220 3300046689 Ga0495613_0166327 Ga0495613_0166327_82_624 174
221 3300046809 Ga0495600_0362769 Ga0495600_0362769_48_590 174
222 3300047322 Ga0495680_0458224 Ga0495680_0458224_250_807 174
223 3300047444 Ga0495675_0342040 Ga0495675_0342040_107_664 174
224 3300053077 Ga0495601_0047531 Ga0495601_0047531_1777_2319 174
225 3300005327 Ga0070658_10252623 Ga0070658_102526233 175
226 3300005842 Ga0068858_100014879 Ga0068858_1000148796 175
227 3300005844 Ga0068862_100451181 Ga0068862_1004511811 175
228 3300009545 Ga0105237_10519570 Ga0105237_105195702 175
229 3300010375 Ga0105239_10792687 Ga0105239_107926872 175
230 3300025949 Ga0207667_10382294 Ga0207667_103822943 175
231 3300026035 Ga0207703_10005916 Ga0207703_100059166 175
232 3300028381 Ga0268264_10931157 Ga0268264_109311572 175
233 3300031247 Ga0265340_10000246 Ga0265340_1000024622 175
234 3300041441 Ga0451787_043969 Ga0451787_043969_349_993 175
235 3300044712 Ga0453684_1361902 Ga0453684_1361902_67_624 175
236 3300010375 Ga0105239_10390727 Ga0105239_103907271 176
237 3300026088 Ga0207641_10582938 Ga0207641_105829382 176
238 3300031247 Ga0265340_10058414 Ga0265340_100584141 176
239 3300031344 Ga0265316_10413337 Ga0265316_104133372 176
240 3300003791 Ga0055530_10013004 Ga0055530_100130042 177
241 3300006195 Ga0075366_10051266 Ga0075366_100512663 177
242 3300025298 Ga0209050_1002655 Ga0209050_10026554 177
243 3300035692 Ga0373935_0633908 Ga0373935_0633908_174_731 177
244 3300046522 Ga0495643_0000057 Ga0495643_0000057_111688_112254 177
245 3300050489 nmdc:mga03683_17945_c1 nmdc:mga03683_17945_c1_1748_2311 177
246 3300050493 nmdc:mga0k408_548533_c1 nmdc:mga0k408_548533_c1_44_607 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

3

172

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.9288 25 176
8g3k-assembly1.cif.gz_B cryo-em imaging scaffold subunits a and b used to display kras g12c complex with gdp 0.926 25 176
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9245 25 176
5vl4-assembly1.cif.gz_A accidental minimum contact crystal lattice formed by a redesigned protein oligomer 0.9168 25 176
7ruv-assembly2.cif.gz_B structure of human atp:cobalamin adenosyltransferase e193k bound to adenosylcobalamin 0.9159 25 176
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9273 12 176 1.20.1200.10
5cy5B00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9114 28 176 1.20.1200.10
1wvtA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9104 23 176 1.20.1200.10
2ah6A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9044 25 176 1.20.1200.10
5cy5A00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.8958 25 176 1.20.1200.10
ID Description Score Start End GO Terms
AF-A0A2V6K5D8-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9509 32 176 GO:0005524
GO:0008817
GO:0009236
AF-A0A3E1DXF3-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.95 1 176 GO:0005524
GO:0008817
GO:0009236
AF-A0A6L7WY77-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9456 6 176 GO:0005524
GO:0008817
GO:0009236
AF-A0A3D2YUG6-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9447 20 172 GO:0005524
GO:0008817
GO:0009236
AF-A0A1Q7S8D1-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9436 21 176 GO:0005524
GO:0008817
GO:0009236

Feature Viewer

pLDDT pTM Quality
91.77 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map