F358276

General Info

Members Datasets Scaffolds Average Seq Length
246 144 492 71

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10004612|Ga0265327_100046122
Length 86
Sequence LRVANPYLLAYNFANMIQVTKKDSKESVENLLRRFNRKVQQSGVIAVAKQGQYFEKPISKTERRKKAIVRRERKAIKVKKLKLGQK

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
104 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
105 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
106 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
121 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
129 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
132 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
140 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
141 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
144 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.11
Nodule 0
Rhizoplane 1.22
Rhizosphere 78.05
Stem 0
Stem Tuber 0
Unclassified 25.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10004612 3300031251 Bacteria 12109
2 rootH1_10057818 3300003323 Bacteria 17352
3 Ga0070658_10001494 3300005327 Bacteria 19829
4 Ga0070658_10034624 3300005327 Bacteria 4064
5 Ga0070658_10329601 3300005327 Unclassified 1304
6 Ga0070658_10720312 3300005327 Bacteria 866
7 Ga0070666_10006299 3300005335 Bacteria 7299
8 Ga0070666_10067112 3300005335 Bacteria 2435
9 Ga0070666_10086547 3300005335 Bacteria 2147
10 Ga0070680_100037856 3300005336 Unclassified 3899
11 Ga0068868_100042729 3300005338 Bacteria 3539
12 Ga0070689_101695126 3300005340 Unclassified 575
13 Ga0070668_100247653 3300005347 Bacteria 1478
14 Ga0070668_100326589 3300005347 Bacteria 1293
15 Ga0070669_100151350 3300005353 Unclassified 1796
16 Ga0070671_100000001 3300005355 Bacteria 1228151
17 Ga0070671_100025012 3300005355 Bacteria 4894
18 Ga0070673_100139727 3300005364 Bacteria 2042
19 Ga0070673_102064554 3300005364 Unclassified 541
20 Ga0070667_100000001 3300005367 Bacteria 1108638
21 Ga0070667_100186005 3300005367 Unclassified 1838
22 Ga0070681_10090567 3300005458 Unclassified 3009
23 Ga0068867_101459656 3300005459 Unclassified 636
24 Ga0068867_102198817 3300005459 Bacteria 523
25 Ga0070685_11310026 3300005466 Unclassified 553
26 Ga0070679_100040804 3300005530 Unclassified 4618
27 Ga0070679_100309872 3300005530 Bacteria 1528
28 Ga0070686_100030131 3300005544 Bacteria 3307
29 Ga0068855_100000364 3300005563 Bacteria 56128
30 Ga0068855_100045868 3300005563 Bacteria 5167
31 Ga0068855_100142157 3300005563 Bacteria 2734
32 Ga0068857_100023129 3300005577 Bacteria 5467
33 Ga0068854_101189902 3300005578 Unclassified 682
34 Ga0068856_102054774 3300005614 Unclassified 581
35 Ga0068852_100017766 3300005616 Bacteria 5589
36 Ga0068859_100424506 3300005617 Bacteria 1426
37 Ga0068859_101518371 3300005617 Bacteria 739
38 Ga0068859_102973054 3300005617 Unclassified 518
39 Ga0068861_100049349 3300005719 Bacteria 3186
40 Ga0068863_100109813 3300005841 Bacteria 2626
41 Ga0068863_100130684 3300005841 Bacteria 2398
42 Ga0068863_100814878 3300005841 Bacteria 931
43 Ga0068863_101209359 3300005841 Bacteria 762
44 Ga0068858_100012467 3300005842 Bacteria 8017
45 Ga0068858_100040081 3300005842 Bacteria 4343
46 Ga0068860_100005914 3300005843 Bacteria 12311
47 Ga0068860_100133560 3300005843 Bacteria 2383
48 Ga0068860_100359402 3300005843 Bacteria 1434
49 Ga0068862_100074601 3300005844 Bacteria 2932
50 Ga0075365_10000151 3300006038 Bacteria 22036
51 Ga0075364_10000496 3300006051 Bacteria 19996
52 Ga0075364_10270332 3300006051 Bacteria 1156
53 Ga0075364_11002446 3300006051 Unclassified 568
54 Ga0075362_10444032 3300006177 Bacteria 658
55 Ga0075369_10000021 3300006186 Bacteria 44895
56 Ga0075369_10135693 3300006186 Bacteria 1120
57 Ga0075366_10711039 3300006195 Unclassified 624
58 Ga0068871_100000001 3300006358 Bacteria 215987
59 Ga0097620_100424476 3300006931 Bacteria 1426
60 Ga0097620_101518537 3300006931 Bacteria 739
61 Ga0097620_102970565 3300006931 Unclassified 518
62 Ga0105240_10000118 3300009093 Bacteria 163934
63 Ga0105240_10002095 3300009093 Bacteria 32628
64 Ga0105240_10009553 3300009093 Bacteria 13730
65 Ga0105240_11118382 3300009093 Bacteria 837
66 Ga0105240_12594329 3300009093 Unclassified 524
67 Ga0111539_11239744 3300009094 Bacteria 866
68 Ga0105245_10153490 3300009098 Bacteria 2179
69 Ga0105245_10232779 3300009098 Unclassified 1782
70 Ga0105245_10908219 3300009098 Unclassified 922
71 Ga0105247_10040171 3300009101 Bacteria 2859
72 Ga0105247_10184673 3300009101 Unclassified 1393
73 Ga0105247_10205588 3300009101 Unclassified 1325
74 Ga0105241_10000917 3300009174 Bacteria 22309
75 Ga0105241_10601191 3300009174 Bacteria 994
76 Ga0105242_10223353 3300009176 Bacteria 1684
77 Ga0105242_13147619 3300009176 Bacteria 512
78 Ga0105248_10028875 3300009177 Bacteria 6183
79 Ga0105237_10310938 3300009545 Bacteria 1579
80 Ga0105238_10141121 3300009551 Bacteria 2386
81 Ga0105238_10375669 3300009551 Bacteria 1412
82 Ga0105249_11415137 3300009553 Bacteria 767
83 Ga0105249_11627792 3300009553 Bacteria 718
84 Ga0105028_103411 3300009993 Bacteria 1662
85 Ga0105239_11962475 3300010375 Bacteria 679
86 Ga0105246_10015223 3300011119 Bacteria 4853
87 Ga0157371_10023238 3300013102 Unclassified 4533
88 Ga0157369_10136895 3300013105 Bacteria 2592
89 Ga0157374_10044566 3300013296 Unclassified 4100
90 Ga0157374_10047401 3300013296 Unclassified 3985
91 Ga0157374_10991638 3300013296 Unclassified 859
92 Ga0157374_12420769 3300013296 Unclassified 552
93 Ga0157378_10055211 3300013297 Bacteria 3538
94 Ga0157378_11106041 3300013297 Unclassified 830
95 Ga0157378_13152970 3300013297 Unclassified 512
96 Ga0163162_10288765 3300013306 Bacteria 1772
97 Ga0163162_12504899 3300013306 Bacteria 593
98 Ga0157372_10017916 3300013307 Bacteria 7611
99 Ga0157372_10020217 3300013307 Bacteria 7179
100 Ga0157372_10198815 3300013307 Bacteria 2322
101 Ga0157372_12896102 3300013307 Bacteria 549
102 Ga0157375_11377602 3300013308 Bacteria 830
103 Ga0163163_10026687 3300014325 Bacteria 5525
104 Ga0163163_10291391 3300014325 Bacteria 1684
105 Ga0163163_11160069 3300014325 Unclassified 835
106 Ga0157377_10026744 3300014745 Bacteria 3091
107 Ga0157379_10118313 3300014968 Unclassified 2383
108 Ga0207710_10110237 3300025900 Unclassified 1306
109 Ga0207710_10364375 3300025900 Bacteria 738
110 Ga0207680_10040297 3300025903 Bacteria 2717
111 Ga0207680_10052309 3300025903 Bacteria 2447
112 Ga0207680_10128758 3300025903 Bacteria 1665
113 Ga0207680_11107003 3300025903 Bacteria 566
114 Ga0207705_10007842 3300025909 Bacteria 7840
115 Ga0207654_10000905 3300025911 Bacteria 16385
116 Ga0207695_10001907 3300025913 Bacteria 32545
117 Ga0207695_10001983 3300025913 Bacteria 31603
118 Ga0207695_10003048 3300025913 Bacteria 24011
119 Ga0207695_10379625 3300025913 Bacteria 1299
120 Ga0207671_10579723 3300025914 Bacteria 894
121 Ga0207660_10015677 3300025917 Unclassified 5006
122 Ga0207660_10182364 3300025917 Bacteria 1631
123 Ga0207649_11124950 3300025920 Bacteria 620
124 Ga0207652_10003529 3300025921 Bacteria 12903
125 Ga0207652_10357062 3300025921 Unclassified 1319
126 Ga0207652_11069106 3300025921 Bacteria 707
127 Ga0207681_10135081 3300025923 Unclassified 1829
128 Ga0207681_11362346 3300025923 Bacteria 596
129 Ga0207694_10123272 3300025924 Bacteria 2071
130 Ga0207687_10120614 3300025927 Bacteria 1960
131 Ga0207687_10470955 3300025927 Unclassified 1044
132 Ga0207664_10116609 3300025929 Bacteria 2228
133 Ga0207644_10000001 3300025931 Bacteria 1243214
134 Ga0207644_10016264 3300025931 Bacteria 5005
135 Ga0207644_11199081 3300025931 Bacteria 638
136 Ga0207686_10400330 3300025934 Bacteria 1046
137 Ga0207667_10000434 3300025949 Bacteria 56114
138 Ga0207667_10035276 3300025949 Bacteria 5366
139 Ga0207667_10074552 3300025949 Bacteria 3525
140 Ga0207667_12264170 3300025949 Bacteria 500
141 Ga0207651_10304071 3300025960 Bacteria 1327
142 Ga0207712_10692690 3300025961 Bacteria 889
143 Ga0207712_11642413 3300025961 Bacteria 576
144 Ga0207668_10193133 3300025972 Bacteria 1615
145 Ga0207668_10223959 3300025972 Bacteria 1512
146 Ga0207658_10000003 3300025986 Bacteria 1151934
147 Ga0207658_10091228 3300025986 Bacteria 2363
148 Ga0207677_10061453 3300026023 Bacteria 2602
149 Ga0207703_10001658 3300026035 Bacteria 20007
150 Ga0207703_10029258 3300026035 Bacteria 4345
151 Ga0207703_10254739 3300026035 Bacteria 1584
152 Ga0207702_11450761 3300026078 Unclassified 680
153 Ga0207641_10112305 3300026088 Bacteria 2418
154 Ga0207641_10172963 3300026088 Bacteria 1973
155 Ga0207641_10918958 3300026088 Bacteria 869
156 Ga0207648_10034958 3300026089 Bacteria 4430
157 Ga0207676_11565678 3300026095 Unclassified 657
158 Ga0207674_10017029 3300026116 Bacteria 7936
159 Ga0207698_10012285 3300026142 Bacteria 5597
160 Ga0210002_1005398 3300027617 Bacteria 1918
161 Ga0209998_10011583 3300027717 Unclassified 1826
162 Ga0268265_10077495 3300028380 Bacteria 2611
163 Ga0268264_10007278 3300028381 Bacteria 9261
164 Ga0268264_10319429 3300028381 Bacteria 1468
165 Ga0268264_10728717 3300028381 Bacteria 986
166 Ga0265337_1008585 3300028556 Bacteria 3700
167 Ga0265326_10109756 3300028558 Unclassified 783
168 Ga0265338_10070790 3300028800 Bacteria 2988
169 Ga0265338_11073695 3300028800 Bacteria 543
170 Ga0265327_10001541 3300031251 Bacteria 28417
171 Ga0265327_10136629 3300031251 Bacteria 1149
172 Ga0307509_10023020 3300031507 Bacteria 7005
173 Ga0307407_11433627 3300031903 Bacteria 545
174 Ga0307407_11664763 3300031903 Bacteria 507
175 Ga0373962_0042102 3300035242 Bacteria 1290
176 Ga0373925_0126490 3300037068 Bacteria 1989
177 Ga0395899_0001513 3300037312 Bacteria 19701
178 Ga0395899_0031150 3300037312 Unclassified 4009
179 Ga0395900_0037003 3300037418 Bacteria 5031
180 Ga0395900_0056463 3300037418 Unclassified 4041
181 Ga0395900_0103815 3300037418 Bacteria 2919
182 Ga0395898_0001854 3300037466 Bacteria 27100
183 Ga0395898_0016480 3300037466 Bacteria 7559
184 Ga0395905_0000682 3300037471 Bacteria 45023
185 Ga0395905_0076224 3300037471 Unclassified 3143
186 Ga0395901_0002934 3300038443 Bacteria 17207
187 Ga0395901_0003747 3300038443 Bacteria 15315
188 Ga0395901_0053367 3300038443 Bacteria 4200
189 Ga0451789_0704842 3300041443 Unclassified 695
190 Ga0451800_1538542 3300041459 Unclassified 521
191 Ga0451807_2720857 3300041486 Unclassified 2085
192 Ga0451833_0079502 3300041491 Unclassified 639
193 Ga0439431_0057281 3300041997 Unclassified 1020
194 Ga0439442_032135 3300042002 Unclassified 1097
195 Ga0466958_0808976 3300045836 Unclassified 611
196 Ga0466967_0266214 3300045976 Bacteria 1641
197 Ga0495590_0092501 3300046457 Bacteria 1071
198 Ga0495583_0048413 3300046506 Bacteria 1951
199 Ga0495671_0386560 3300046692 Bacteria 670
200 Ga0495660_0001416 3300046810 Bacteria 16447
201 Ga0495672_0000016 3300047320 Bacteria 500601
202 Ga0495672_0021288 3300047320 Unclassified 4231
203 Ga0495672_0050808 3300047320 Bacteria 2445
204 Ga0496125_0233991 3300048928 Bacteria 1172
205 Ga0501034_1158256 3300049571 Unclassified 653
206 Ga0501073_0022183 3300049589 Bacteria 4575
207 Ga0501080_0000252 3300049742 Bacteria 40432
208 nmdc:mga03683_698614_c1 3300050489 Unclassified 502
209 nmdc:mga03683_89854_c2 3300050489 Bacteria 658
210 nmdc:mga00v17_247493_c1 3300050491 Bacteria 1156
211 nmdc:mga00v17_585_c1 3300050491 Bacteria 20310
212 nmdc:mga00v17_882589_c1 3300050491 Unclassified 567
213 nmdc:mga0yw44_182_c1 3300050492 Bacteria 22055
214 nmdc:mga0k408_748791_c1 3300050493 Unclassified 571
215 nmdc:mga0sz30_165339_c1 3300050516 Unclassified 620
216 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
217 nmdc:mga0sz30_52796_c1 3300050516 Bacteria 1726
218 Ga0500610_0002552 3300053079 Bacteria 6756
219 Ga0500643_000011 3300053087 Bacteria 385630
220 Ga0500643_000428 3300053087 Bacteria 31998
221 Ga0500644_0000397 3300053088 Bacteria 20681
222 Ga0500644_0028941 3300053088 Bacteria 1737
223 Ga0500644_0318677 3300053088 Bacteria 668
224 Ga0500646_0016433 3300053090 Bacteria 1932
225 Ga0500583_0000146 3300053092 Bacteria 30082
226 Ga0500583_0028716 3300053092 Bacteria 2417
227 Ga0500651_0000246 3300053093 Bacteria 33131
228 Ga0500651_0138576 3300053093 Bacteria 1468
229 Ga0500554_061291 3300053102 Bacteria 1207
230 Ga0500555_000001 3300053103 Bacteria 1353713
231 Ga0500555_114251 3300053103 Unclassified 678
232 Ga0500562_000001 3300053108 Bacteria 1178987
233 Ga0500621_013026 3300053126 Bacteria 2983
234 Ga0500642_0001929 3300053130 Bacteria 6008
235 Ga0500655_045935 3300053133 Bacteria 863
236 Ga0500568_0096001 3300053139 Unclassified 1115
237 Ga0500577_0000369 3300053142 Bacteria 11488
238 Ga0500588_0089170 3300053146 Unclassified 1045
239 Ga0500589_000002 3300053147 Bacteria 245055
240 Ga0500589_291819 3300053147 Unclassified 580
241 Ga0500604_0059359 3300053151 Unclassified 1198
242 Ga0500604_0286238 3300053151 Unclassified 571
243 Ga0500616_0000005 3300053153 Bacteria 961725
244 Ga0500627_0382696 3300053158 Unclassified 602
245 Ga0500611_000193 3300053727 Bacteria 7906
246 Ga0500611_004473 3300053727 Bacteria 1888
247 Ga0265327_10004612
248 rootH1_10057818
249 Ga0070658_10001494
250 Ga0070658_10034624
251 Ga0070658_10329601
252 Ga0070658_10720312
253 Ga0070666_10006299
254 Ga0070666_10067112
255 Ga0070666_10086547
256 Ga0070680_100037856
257 Ga0068868_100042729
258 Ga0070689_101695126
259 Ga0070668_100247653
260 Ga0070668_100326589
261 Ga0070669_100151350
262 Ga0070671_100000001
263 Ga0070671_100025012
264 Ga0070673_100139727
265 Ga0070673_102064554
266 Ga0070667_100000001
267 Ga0070667_100186005
268 Ga0070681_10090567
269 Ga0068867_101459656
270 Ga0068867_102198817
271 Ga0070685_11310026
272 Ga0070679_100040804
273 Ga0070679_100309872
274 Ga0070686_100030131
275 Ga0068855_100000364
276 Ga0068855_100045868
277 Ga0068855_100142157
278 Ga0068857_100023129
279 Ga0068854_101189902
280 Ga0068856_102054774
281 Ga0068852_100017766
282 Ga0068859_100424506
283 Ga0068859_101518371
284 Ga0068859_102973054
285 Ga0068861_100049349
286 Ga0068863_100109813
287 Ga0068863_100130684
288 Ga0068863_100814878
289 Ga0068863_101209359
290 Ga0068858_100012467
291 Ga0068858_100040081
292 Ga0068860_100005914
293 Ga0068860_100133560
294 Ga0068860_100359402
295 Ga0068862_100074601
296 Ga0075365_10000151
297 Ga0075364_10000496
298 Ga0075364_10270332
299 Ga0075364_11002446
300 Ga0075362_10444032
301 Ga0075369_10000021
302 Ga0075369_10135693
303 Ga0075366_10711039
304 Ga0068871_100000001
305 Ga0097620_100424476
306 Ga0097620_101518537
307 Ga0097620_102970565
308 Ga0105240_10000118
309 Ga0105240_10002095
310 Ga0105240_10009553
311 Ga0105240_11118382
312 Ga0105240_12594329
313 Ga0111539_11239744
314 Ga0105245_10153490
315 Ga0105245_10232779
316 Ga0105245_10908219
317 Ga0105247_10040171
318 Ga0105247_10184673
319 Ga0105247_10205588
320 Ga0105241_10000917
321 Ga0105241_10601191
322 Ga0105242_10223353
323 Ga0105242_13147619
324 Ga0105248_10028875
325 Ga0105237_10310938
326 Ga0105238_10141121
327 Ga0105238_10375669
328 Ga0105249_11415137
329 Ga0105249_11627792
330 Ga0105028_103411
331 Ga0105239_11962475
332 Ga0105246_10015223
333 Ga0157371_10023238
334 Ga0157369_10136895
335 Ga0157374_10044566
336 Ga0157374_10047401
337 Ga0157374_10991638
338 Ga0157374_12420769
339 Ga0157378_10055211
340 Ga0157378_11106041
341 Ga0157378_13152970
342 Ga0163162_10288765
343 Ga0163162_12504899
344 Ga0157372_10017916
345 Ga0157372_10020217
346 Ga0157372_10198815
347 Ga0157372_12896102
348 Ga0157375_11377602
349 Ga0163163_10026687
350 Ga0163163_10291391
351 Ga0163163_11160069
352 Ga0157377_10026744
353 Ga0157379_10118313
354 Ga0207710_10110237
355 Ga0207710_10364375
356 Ga0207680_10040297
357 Ga0207680_10052309
358 Ga0207680_10128758
359 Ga0207680_11107003
360 Ga0207705_10007842
361 Ga0207654_10000905
362 Ga0207695_10001907
363 Ga0207695_10001983
364 Ga0207695_10003048
365 Ga0207695_10379625
366 Ga0207671_10579723
367 Ga0207660_10015677
368 Ga0207660_10182364
369 Ga0207649_11124950
370 Ga0207652_10003529
371 Ga0207652_10357062
372 Ga0207652_11069106
373 Ga0207681_10135081
374 Ga0207681_11362346
375 Ga0207694_10123272
376 Ga0207687_10120614
377 Ga0207687_10470955
378 Ga0207664_10116609
379 Ga0207644_10000001
380 Ga0207644_10016264
381 Ga0207644_11199081
382 Ga0207686_10400330
383 Ga0207667_10000434
384 Ga0207667_10035276
385 Ga0207667_10074552
386 Ga0207667_12264170
387 Ga0207651_10304071
388 Ga0207712_10692690
389 Ga0207712_11642413
390 Ga0207668_10193133
391 Ga0207668_10223959
392 Ga0207658_10000003
393 Ga0207658_10091228
394 Ga0207677_10061453
395 Ga0207703_10001658
396 Ga0207703_10029258
397 Ga0207703_10254739
398 Ga0207702_11450761
399 Ga0207641_10112305
400 Ga0207641_10172963
401 Ga0207641_10918958
402 Ga0207648_10034958
403 Ga0207676_11565678
404 Ga0207674_10017029
405 Ga0207698_10012285
406 Ga0210002_1005398
407 Ga0209998_10011583
408 Ga0268265_10077495
409 Ga0268264_10007278
410 Ga0268264_10319429
411 Ga0268264_10728717
412 Ga0265337_1008585
413 Ga0265326_10109756
414 Ga0265338_10070790
415 Ga0265338_11073695
416 Ga0265327_10001541
417 Ga0265327_10136629
418 Ga0307509_10023020
419 Ga0307407_11433627
420 Ga0307407_11664763
421 Ga0373962_0042102
422 Ga0373925_0126490
423 Ga0395899_0001513
424 Ga0395899_0031150
425 Ga0395900_0037003
426 Ga0395900_0056463
427 Ga0395900_0103815
428 Ga0395898_0001854
429 Ga0395898_0016480
430 Ga0395905_0000682
431 Ga0395905_0076224
432 Ga0395901_0002934
433 Ga0395901_0003747
434 Ga0395901_0053367
435 Ga0451789_0704842
436 Ga0451800_1538542
437 Ga0451807_2720857
438 Ga0451833_0079502
439 Ga0439431_0057281
440 Ga0439442_032135
441 Ga0466958_0808976
442 Ga0466967_0266214
443 Ga0495590_0092501
444 Ga0495583_0048413
445 Ga0495671_0386560
446 Ga0495660_0001416
447 Ga0495672_0000016
448 Ga0495672_0021288
449 Ga0495672_0050808
450 Ga0496125_0233991
451 Ga0501034_1158256
452 Ga0501073_0022183
453 Ga0501080_0000252
454 nmdc:mga03683_698614_c1
455 nmdc:mga03683_89854_c2
456 nmdc:mga00v17_247493_c1
457 nmdc:mga00v17_585_c1
458 nmdc:mga00v17_882589_c1
459 nmdc:mga0yw44_182_c1
460 nmdc:mga0k408_748791_c1
461 nmdc:mga0sz30_165339_c1
462 nmdc:mga0sz30_2_c1
463 nmdc:mga0sz30_52796_c1
464 Ga0500610_0002552
465 Ga0500643_000011
466 Ga0500643_000428
467 Ga0500644_0000397
468 Ga0500644_0028941
469 Ga0500644_0318677
470 Ga0500646_0016433
471 Ga0500583_0000146
472 Ga0500583_0028716
473 Ga0500651_0000246
474 Ga0500651_0138576
475 Ga0500554_061291
476 Ga0500555_000001
477 Ga0500555_114251
478 Ga0500562_000001
479 Ga0500621_013026
480 Ga0500642_0001929
481 Ga0500655_045935
482 Ga0500568_0096001
483 Ga0500577_0000369
484 Ga0500588_0089170
485 Ga0500589_000002
486 Ga0500589_291819
487 Ga0500604_0059359
488 Ga0500604_0286238
489 Ga0500616_0000005
490 Ga0500627_0382696
491 Ga0500611_000193
492 Ga0500611_004473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01165

Ribosomal_S21

Ribosomal protein S21

21

80

0.95

Map