F358380

General Info

Members Datasets Scaffolds Average Seq Length
246 195 492 256

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0000017|Ga0466969_0000017_6105_6980
Length 291
Sequence MDRGRQRAGAGRHLAAGARALTQQLHQRTAMDLGLAGKWALVCAASKGLGKGCATALVREGANVVITARGEEALQRTAHELRALGRGEVRAVAGDITTPEGRAAALAACPQVDILVNNAGGPPPGDFRDWSREDWLKAVEGNMLTPIELIKATVDGMAERGFGRIVNITSSSVKAPIETLGLSNGARSGLTGFVAGLARQARLASRNVTINNLLPGQFDTDRLRGTTRAAAERAGRDFDGWWQQRQQAIPARRFGTAEEFGAVCAFLCSAQAGYLTGQNLLLDGGAYPGTF

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
96 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
106 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
107 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
140 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
155 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
156 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
157 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
162 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
174 2511231018 Pseudomonas sp. GM60 Isolate Nodule
175 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
176 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
177 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
178 2643221660 Methylibium sp. Root1272 Isolate Unclassified
179 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
180 2738543013 Variovorax sp. BT01 Isolate Unclassified
181 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
182 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
183 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
184 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
185 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
186 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
187 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
188 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
189 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
190 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
191 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
192 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
193 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
194 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
195 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.06
Metatranscriptomes 0
Isolates 8.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.98
Nodule 1.22
Rhizoplane 7.72
Rhizosphere 73.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0000017 3300044656 Bacteria 103792
2 rootH2_10151705 3300003320 Bacteria 1928
3 JGI25160J50197_1000043 3300003354 Bacteria 146498
4 Ga0055524_1000125 3300003775 Bacteria 90042
5 Ga0055536_1027972 3300003781 Bacteria 1546
6 Ga0055534_1002000 3300003784 Bacteria 7427
7 Ga0055528_1003774 3300003790 Bacteria 7473
8 Ga0055530_10002565 3300003791 Bacteria 11531
9 Ga0055540_1000011 3300003792 Bacteria 282927
10 Ga0055540_1033223 3300003792 Bacteria 1170
11 Ga0065165_1001828 3300005262 Bacteria 20811
12 Ga0065715_10153268 3300005293 Bacteria 1694
13 Ga0070677_10045635 3300005333 Bacteria 1749
14 Ga0068869_100015951 3300005334 Bacteria 5056
15 Ga0070666_10031806 3300005335 Bacteria 3485
16 Ga0068868_100032043 3300005338 Bacteria 4041
17 Ga0070689_100113768 3300005340 Bacteria 2155
18 Ga0070668_100020785 3300005347 Bacteria 4958
19 Ga0070669_100008890 3300005353 Bacteria 7166
20 Ga0070669_100062948 3300005353 Bacteria 2729
21 Ga0070671_100047039 3300005355 Bacteria 3588
22 Ga0070671_100247170 3300005355 Bacteria 1515
23 Ga0070674_100167026 3300005356 Bacteria 1675
24 Ga0070673_100009936 3300005364 Bacteria 6413
25 Ga0070694_100042385 3300005444 Bacteria 3040
26 Ga0070678_100016510 3300005456 Bacteria 4726
27 Ga0070672_100101315 3300005543 Bacteria 2336
28 Ga0070695_100026141 3300005545 Bacteria 3609
29 Ga0070695_100033055 3300005545 Bacteria 3235
30 Ga0070665_100034457 3300005548 Bacteria 5091
31 Ga0070664_100031722 3300005564 Bacteria 4417
32 Ga0068859_100036995 3300005617 Bacteria 4899
33 Ga0068859_100079768 3300005617 Bacteria 3314
34 Ga0068864_100134774 3300005618 Bacteria 2222
35 Ga0068864_100474688 3300005618 Bacteria 1200
36 Ga0068864_100957099 3300005618 Bacteria 847
37 Ga0068858_100019783 3300005842 Bacteria 6293
38 Ga0068858_100765275 3300005842 Bacteria 941
39 Ga0075364_10024914 3300006051 Bacteria 3804
40 Ga0097621_100026698 3300006237 Bacteria 4533
41 Ga0068871_100061221 3300006358 Bacteria 3073
42 Ga0075428_100497563 3300006844 Bacteria 1304
43 Ga0075431_100026178 3300006847 Bacteria 5983
44 Ga0075433_10234012 3300006852 Bacteria 1631
45 Ga0075434_100000002 3300006871 Bacteria 135661
46 Ga0075434_100496854 3300006871 Bacteria 1241
47 Ga0075429_100242954 3300006880 Bacteria 1577
48 Ga0075436_100222967 3300006914 Bacteria 1338
49 Ga0097620_100036994 3300006931 Bacteria 4899
50 Ga0097620_100079769 3300006931 Bacteria 3314
51 Ga0105240_10224411 3300009093 Bacteria 2187
52 Ga0111539_10657183 3300009094 Bacteria 1221
53 Ga0114129_10165149 3300009147 Bacteria 3022
54 Ga0114129_10671972 3300009147 Bacteria 1334
55 Ga0105248_10024928 3300009177 Bacteria 6648
56 Ga0105237_10127299 3300009545 Bacteria 2541
57 Ga0105249_10130181 3300009553 Bacteria 2401
58 Ga0157374_10100550 3300013296 Bacteria 2772
59 Ga0163162_10681039 3300013306 Bacteria 1151
60 Ga0157376_10274300 3300014969 Bacteria 1586
61 Ga0182006_1070126 3300015261 Bacteria 1302
62 Ga0163161_10020067 3300017792 Bacteria 4688
63 Ga0213872_10053377 3300021361 Bacteria 1833
64 Ga0209148_1000659 3300025254 Bacteria 29691
65 Ga0209565_1001884 3300025263 Bacteria 8316
66 Ga0209455_1001231 3300025272 Bacteria 12111
67 Ga0209673_1000061 3300025273 Bacteria 262274
68 Ga0209130_1004421 3300025284 Bacteria 5343
69 Ga0209675_1024243 3300025291 Bacteria 1553
70 Ga0209676_1005731 3300025292 Bacteria 6374
71 Ga0209025_1000040 3300025294 Bacteria 376228
72 Ga0209564_1005333 3300025295 Bacteria 7391
73 Ga0209050_1000583 3300025298 Bacteria 59089
74 Ga0209050_1012384 3300025298 Bacteria 3919
75 Ga0209050_1038777 3300025298 Bacteria 1352
76 Ga0209256_1000113 3300025299 Bacteria 175296
77 Ga0207426_1000014 3300025302 Bacteria 649413
78 Ga0209051_1000020 3300025303 Bacteria 508628
79 Ga0209051_1009840 3300025303 Bacteria 4891
80 Ga0209257_1000085 3300025304 Bacteria 291117
81 Ga0207697_10010615 3300025315 Bacteria 3930
82 Ga0207682_10076992 3300025893 Bacteria 1422
83 Ga0207680_10025965 3300025903 Bacteria 3239
84 Ga0207645_10015335 3300025907 Bacteria 5095
85 Ga0207643_10145577 3300025908 Bacteria 1417
86 Ga0207695_10250859 3300025913 Bacteria 1669
87 Ga0207695_10360362 3300025913 Bacteria 1340
88 Ga0207671_10074250 3300025914 Bacteria 2541
89 Ga0207681_10200254 3300025923 Bacteria 1533
90 Ga0207650_10179563 3300025925 Bacteria 1686
91 Ga0207691_10014015 3300025940 Bacteria 7648
92 Ga0207691_10195840 3300025940 Bacteria 1761
93 Ga0207711_10087920 3300025941 Bacteria 2727
94 Ga0207689_10050774 3300025942 Bacteria 3418
95 Ga0207679_10048655 3300025945 Bacteria 3088
96 Ga0207651_10058767 3300025960 Bacteria 2659
97 Ga0207658_10090150 3300025986 Bacteria 2376
98 Ga0207677_10022071 3300026023 Bacteria 3904
99 Ga0207703_10442918 3300026035 Bacteria 1212
100 Ga0207639_10428083 3300026041 Bacteria 1198
101 Ga0207641_10078803 3300026088 Bacteria 2854
102 Ga0207641_10134021 3300026088 Bacteria 2228
103 Ga0207648_10000263 3300026089 Bacteria 56886
104 Ga0207648_10029095 3300026089 Bacteria 4899
105 Ga0207676_10406581 3300026095 Bacteria 1273
106 Ga0207683_10019535 3300026121 Bacteria 5787
107 Ga0207683_10022034 3300026121 Bacteria 5466
108 Ga0207683_10288492 3300026121 Bacteria 1500
109 Ga0207683_10338035 3300026121 Bacteria 1381
110 Ga0207428_10037838 3300027907 Bacteria 3924
111 Ga0207428_10390870 3300027907 Bacteria 1019
112 Ga0268265_10041962 3300028380 Bacteria 3391
113 Ga0268265_10360388 3300028380 Bacteria 1331
114 Ga0268264_10094382 3300028381 Bacteria 2586
115 Ga0265328_10008268 3300031239 Bacteria 4302
116 Ga0265316_10192368 3300031344 Bacteria 1515
117 Ga0307408_100000221 3300031548 Bacteria 60975
118 Ga0307406_10001423 3300031901 Bacteria 13269
119 Ga0373954_0000014 3300035118 Bacteria 71012
120 Ga0373924_0019639 3300035410 Bacteria 2619
121 Ga0373931_0416257 3300035691 Bacteria 853
122 Ga0373927_0002728 3300035695 Bacteria 12880
123 Ga0373933_0002300 3300035724 Bacteria 10867
124 Ga0373937_0000218 3300036401 Bacteria 55605
125 Ga0373925_0345503 3300037068 Bacteria 1207
126 Ga0373925_0420856 3300037068 Bacteria 1091
127 Ga0395900_0169699 3300037418 Bacteria 2222
128 Ga0395905_0107411 3300037471 Bacteria 2620
129 Ga0395905_0108817 3300037471 Bacteria 2602
130 Ga0436361_0289897 3300039447 Bacteria 1895
131 Ga0450914_011683 3300042118 Bacteria 868
132 Ga0439435_0070910 3300042436 Bacteria 1031
133 Ga0466966_0001817 3300044684 Bacteria 13843
134 Ga0466966_0051404 3300044684 Bacteria 2619
135 Ga0466961_0001407 3300044693 Bacteria 14912
136 Ga0466961_0011409 3300044693 Bacteria 5683
137 Ga0466961_0118114 3300044693 Bacteria 1666
138 Ga0453684_0004531 3300044712 Bacteria 29152
139 Ga0453684_0006707 3300044712 Bacteria 21712
140 Ga0453684_0269522 3300044712 Bacteria 1946
141 Ga0466970_0006747 3300044765 Bacteria 5744
142 Ga0466957_0020079 3300044842 Bacteria 3932
143 Ga0466957_0090390 3300044842 Bacteria 1917
144 Ga0466957_0121227 3300044842 Bacteria 1667
145 Ga0466959_0001240 3300045049 Bacteria 15427
146 Ga0466958_0010356 3300045836 Bacteria 5221
147 Ga0466967_0018520 3300045976 Bacteria 5568
148 Ga0466967_0651098 3300045976 Bacteria 1042
149 Ga0466967_0790672 3300045976 Bacteria 942
150 Ga0495603_0001694 3300046455 Bacteria 12959
151 Ga0495590_0005981 3300046457 Bacteria 4771
152 Ga0495590_0010230 3300046457 Bacteria 3533
153 Ga0495590_0017702 3300046457 Bacteria 2560
154 Ga0495650_0014022 3300046471 Bacteria 4200
155 Ga0495580_0004173 3300046472 Bacteria 12154
156 Ga0495605_0002328 3300046474 Bacteria 11837
157 Ga0495662_0303460 3300046476 Bacteria 785
158 Ga0495583_0012339 3300046506 Bacteria 4842
159 Ga0495606_0007275 3300046507 Bacteria 9975
160 Ga0495631_0214357 3300046518 Bacteria 822
161 Ga0495648_0011014 3300046524 Bacteria 6851
162 Ga0495665_0027378 3300046531 Bacteria 3059
163 Ga0495625_0036420 3300046660 Bacteria 3617
164 Ga0495647_0016263 3300046681 Bacteria 2616
165 Ga0495613_0569421 3300046689 Bacteria 756
166 Ga0495670_0310272 3300046691 Bacteria 846
167 Ga0495671_0045862 3300046692 Bacteria 2187
168 Ga0495649_0010926 3300046694 Bacteria 5348
169 Ga0495649_0026647 3300046694 Bacteria 3212
170 Ga0495589_0028407 3300046794 Bacteria 2823
171 Ga0495604_0178077 3300047317 Bacteria 1489
172 Ga0495674_0004252 3300047319 Bacteria 13794
173 Ga0495676_0059176 3300047321 Bacteria 3011
174 Ga0495683_0000561 3300047323 Bacteria 28045
175 Ga0495687_008981 3300047443 Bacteria 5650
176 Ga0495687_016806 3300047443 Bacteria 3669
177 Ga0495685_036921 3300047447 Bacteria 1677
178 Ga0495673_0002394 3300047469 Bacteria 13258
179 Ga0495681_0211651 3300047470 Bacteria 781
180 Ga0496100_0000139 3300048903 Bacteria 40188
181 Ga0496100_0006117 3300048903 Bacteria 6542
182 Ga0496101_0000243 3300048904 Bacteria 40099
183 Ga0496101_0009338 3300048904 Bacteria 6444
184 Ga0496102_0000179 3300048905 Bacteria 86002
185 Ga0496103_0000369 3300048906 Bacteria 40485
186 Ga0496104_0008430 3300048907 Bacteria 9166
187 Ga0496104_0019114 3300048907 Bacteria 6263
188 Ga0496104_0053365 3300048907 Bacteria 3818
189 Ga0496105_0001659 3300048908 Bacteria 15865
190 Ga0496105_0032129 3300048908 Bacteria 4306
191 Ga0496105_0463885 3300048908 Bacteria 998
192 Ga0496106_0564179 3300048909 Bacteria 913
193 Ga0496108_0135432 3300048911 Bacteria 2119
194 Ga0496112_0011627 3300048915 Bacteria 8051
195 Ga0496113_0059232 3300048916 Bacteria 2884
196 Ga0496114_0004650 3300048917 Bacteria 10672
197 Ga0496114_0254656 3300048917 Bacteria 1545
198 Ga0496115_0131025 3300048918 Bacteria 2067
199 Ga0496117_0001138 3300048920 Bacteria 40074
200 Ga0496118_0001176 3300048921 Bacteria 40395
201 Ga0496121_0001521 3300048924 Bacteria 38915
202 Ga0496121_0006794 3300048924 Bacteria 14016
203 Ga0496121_0015558 3300048924 Bacteria 7953
204 Ga0495682_0006617 3300049460 Bacteria 4683
205 Ga0501033_0026902 3300049570 Bacteria 4328
206 Ga0501034_0069484 3300049571 Bacteria 3533
207 Ga0501034_0900501 3300049571 Bacteria 772
208 Ga0501047_0009658 3300049581 Bacteria 9118
209 Ga0501047_0049209 3300049581 Bacteria 4070
210 Ga0501266_000123 3300049763 Bacteria 9596
211 Ga0501035_0029376 3300049822 Bacteria 5013
212 Ga0501044_0000987 3300049823 Bacteria 34197
213 nmdc:mga05p37_428624_c1 3300050507 Bacteria 1537
214 nmdc:mga09592_42692_c1 3300050508 Bacteria 3814
215 nmdc:mga0qj67_217117_c1 3300050509 Bacteria 1553
216 nmdc:mga0qj67_49270_c1 3300050509 Bacteria 3330
217 nmdc:mga06r32_66035_c1 3300050510 Bacteria 3491
218 nmdc:mga08y16_14146_c1 3300050511 Bacteria 8398
219 nmdc:mga0n895_6398_c1 3300050512 Bacteria 9997
220 nmdc:mga0n895_682276_c1 3300050512 Bacteria 1024
221 nmdc:mga08x19_106857_c1 3300050514 Bacteria 1862
222 nmdc:mga0a205_163287_c1 3300050515 Bacteria 2123
223 Ga0466962_0002649 3300061719 Bacteria 8514
224 Ga0530510_0343980 3300061734 Bacteria 1120
225 2511336118 2511231018 Bacteria 6436256
226 2514048282 2513237166 Bacteria 10373764
227 2521558763 2521172590 Bacteria 5047645
228 2563056876 2562617112 Bacteria 10918404
229 2644338748 2643221660 Bacteria 4208257
230 2713481106 2711768613 Bacteria 11048459
231 2739248029 2738543013 Bacteria 5618633
232 2819614010 2818991449 Bacteria 5518009
233 2889306314 2889306138 Bacteria 6358934
234 2904443942 2904439833 Bacteria 5931679
235 2904534509 2904530477 Bacteria 5876334
236 2904584400 2904584206 Bacteria 6028872
237 2904590868 2904589729 Bacteria 6113573
238 2904603291 2904601388 Bacteria 5884906
239 2919050182 2919046199 Bacteria 5567169
240 2919080704 2919079590 Bacteria 5946433
241 2919133070 2919130084 Bacteria 5301837
242 2929195880 2929195423 Bacteria 5325372
243 8021623195 8021622325 Bacteria 4844743
244 8021626967 8021626552 Bacteria 4665214
245 8021649019 8021648035 Bacteria 4772378
246 8055307098 8055301274 Bacteria 8587385
247 Ga0466969_0000017
248 rootH2_10151705
249 JGI25160J50197_1000043
250 Ga0055524_1000125
251 Ga0055536_1027972
252 Ga0055534_1002000
253 Ga0055528_1003774
254 Ga0055530_10002565
255 Ga0055540_1000011
256 Ga0055540_1033223
257 Ga0065165_1001828
258 Ga0065715_10153268
259 Ga0070677_10045635
260 Ga0068869_100015951
261 Ga0070666_10031806
262 Ga0068868_100032043
263 Ga0070689_100113768
264 Ga0070668_100020785
265 Ga0070669_100008890
266 Ga0070669_100062948
267 Ga0070671_100047039
268 Ga0070671_100247170
269 Ga0070674_100167026
270 Ga0070673_100009936
271 Ga0070694_100042385
272 Ga0070678_100016510
273 Ga0070672_100101315
274 Ga0070695_100026141
275 Ga0070695_100033055
276 Ga0070665_100034457
277 Ga0070664_100031722
278 Ga0068859_100036995
279 Ga0068859_100079768
280 Ga0068864_100134774
281 Ga0068864_100474688
282 Ga0068864_100957099
283 Ga0068858_100019783
284 Ga0068858_100765275
285 Ga0075364_10024914
286 Ga0097621_100026698
287 Ga0068871_100061221
288 Ga0075428_100497563
289 Ga0075431_100026178
290 Ga0075433_10234012
291 Ga0075434_100000002
292 Ga0075434_100496854
293 Ga0075429_100242954
294 Ga0075436_100222967
295 Ga0097620_100036994
296 Ga0097620_100079769
297 Ga0105240_10224411
298 Ga0111539_10657183
299 Ga0114129_10165149
300 Ga0114129_10671972
301 Ga0105248_10024928
302 Ga0105237_10127299
303 Ga0105249_10130181
304 Ga0157374_10100550
305 Ga0163162_10681039
306 Ga0157376_10274300
307 Ga0182006_1070126
308 Ga0163161_10020067
309 Ga0213872_10053377
310 Ga0209148_1000659
311 Ga0209565_1001884
312 Ga0209455_1001231
313 Ga0209673_1000061
314 Ga0209130_1004421
315 Ga0209675_1024243
316 Ga0209676_1005731
317 Ga0209025_1000040
318 Ga0209564_1005333
319 Ga0209050_1000583
320 Ga0209050_1012384
321 Ga0209050_1038777
322 Ga0209256_1000113
323 Ga0207426_1000014
324 Ga0209051_1000020
325 Ga0209051_1009840
326 Ga0209257_1000085
327 Ga0207697_10010615
328 Ga0207682_10076992
329 Ga0207680_10025965
330 Ga0207645_10015335
331 Ga0207643_10145577
332 Ga0207695_10250859
333 Ga0207695_10360362
334 Ga0207671_10074250
335 Ga0207681_10200254
336 Ga0207650_10179563
337 Ga0207691_10014015
338 Ga0207691_10195840
339 Ga0207711_10087920
340 Ga0207689_10050774
341 Ga0207679_10048655
342 Ga0207651_10058767
343 Ga0207658_10090150
344 Ga0207677_10022071
345 Ga0207703_10442918
346 Ga0207639_10428083
347 Ga0207641_10078803
348 Ga0207641_10134021
349 Ga0207648_10000263
350 Ga0207648_10029095
351 Ga0207676_10406581
352 Ga0207683_10019535
353 Ga0207683_10022034
354 Ga0207683_10288492
355 Ga0207683_10338035
356 Ga0207428_10037838
357 Ga0207428_10390870
358 Ga0268265_10041962
359 Ga0268265_10360388
360 Ga0268264_10094382
361 Ga0265328_10008268
362 Ga0265316_10192368
363 Ga0307408_100000221
364 Ga0307406_10001423
365 Ga0373954_0000014
366 Ga0373924_0019639
367 Ga0373931_0416257
368 Ga0373927_0002728
369 Ga0373933_0002300
370 Ga0373937_0000218
371 Ga0373925_0345503
372 Ga0373925_0420856
373 Ga0395900_0169699
374 Ga0395905_0107411
375 Ga0395905_0108817
376 Ga0436361_0289897
377 Ga0450914_011683
378 Ga0439435_0070910
379 Ga0466966_0001817
380 Ga0466966_0051404
381 Ga0466961_0001407
382 Ga0466961_0011409
383 Ga0466961_0118114
384 Ga0453684_0004531
385 Ga0453684_0006707
386 Ga0453684_0269522
387 Ga0466970_0006747
388 Ga0466957_0020079
389 Ga0466957_0090390
390 Ga0466957_0121227
391 Ga0466959_0001240
392 Ga0466958_0010356
393 Ga0466967_0018520
394 Ga0466967_0651098
395 Ga0466967_0790672
396 Ga0495603_0001694
397 Ga0495590_0005981
398 Ga0495590_0010230
399 Ga0495590_0017702
400 Ga0495650_0014022
401 Ga0495580_0004173
402 Ga0495605_0002328
403 Ga0495662_0303460
404 Ga0495583_0012339
405 Ga0495606_0007275
406 Ga0495631_0214357
407 Ga0495648_0011014
408 Ga0495665_0027378
409 Ga0495625_0036420
410 Ga0495647_0016263
411 Ga0495613_0569421
412 Ga0495670_0310272
413 Ga0495671_0045862
414 Ga0495649_0010926
415 Ga0495649_0026647
416 Ga0495589_0028407
417 Ga0495604_0178077
418 Ga0495674_0004252
419 Ga0495676_0059176
420 Ga0495683_0000561
421 Ga0495687_008981
422 Ga0495687_016806
423 Ga0495685_036921
424 Ga0495673_0002394
425 Ga0495681_0211651
426 Ga0496100_0000139
427 Ga0496100_0006117
428 Ga0496101_0000243
429 Ga0496101_0009338
430 Ga0496102_0000179
431 Ga0496103_0000369
432 Ga0496104_0008430
433 Ga0496104_0019114
434 Ga0496104_0053365
435 Ga0496105_0001659
436 Ga0496105_0032129
437 Ga0496105_0463885
438 Ga0496106_0564179
439 Ga0496108_0135432
440 Ga0496112_0011627
441 Ga0496113_0059232
442 Ga0496114_0004650
443 Ga0496114_0254656
444 Ga0496115_0131025
445 Ga0496117_0001138
446 Ga0496118_0001176
447 Ga0496121_0001521
448 Ga0496121_0006794
449 Ga0496121_0015558
450 Ga0495682_0006617
451 Ga0501033_0026902
452 Ga0501034_0069484
453 Ga0501034_0900501
454 Ga0501047_0009658
455 Ga0501047_0049209
456 Ga0501266_000123
457 Ga0501035_0029376
458 Ga0501044_0000987
459 nmdc:mga05p37_428624_c1
460 nmdc:mga09592_42692_c1
461 nmdc:mga0qj67_217117_c1
462 nmdc:mga0qj67_49270_c1
463 nmdc:mga06r32_66035_c1
464 nmdc:mga08y16_14146_c1
465 nmdc:mga0n895_6398_c1
466 nmdc:mga0n895_682276_c1
467 nmdc:mga08x19_106857_c1
468 nmdc:mga0a205_163287_c1
469 Ga0466962_0002649
470 Ga0530510_0343980
471 2511336118
472 2514048282
473 2521558763
474 2563056876
475 2644338748
476 2713481106
477 2739248029
478 2819614010
479 2889306314
480 2904443942
481 2904534509
482 2904584400
483 2904590868
484 2904603291
485 2919050182
486 2919080704
487 2919133070
488 2929195880
489 8021623195
490 8021626967
491 8021649019
492 8055307098

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

38

231

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

43

287

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z1n-assembly2.cif.gz_B crystal structure of ape0912 from aeropyrum pernix k1 0.9274 1 141
3f9i-assembly1.cif.gz_A-2 error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9215 5 141
5vps-assembly1.cif.gz_A crystal structure of an sdr from burkholderia ambifaria in complex with nadph with a tcep adduct 0.9177 1 151
2z1n-assembly1.cif.gz_A crystal structure of ape0912 from aeropyrum pernix k1 0.9156 1 141
3ai3-assembly1.cif.gz_G the crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with nadph and l-sorbose 0.9144 1 138
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9744 9 56 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9345 5 78 3.40.50.720
2z1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9156 1 141 3.40.50.720
3ai1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 1 138 3.40.50.720
5va8D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9082 1 152 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V8KN64-F1-model_v4 Short-chain dehydrogenase 0.9704 6 66 GO:0016020
GO:0016491
AF-A0A2V2L0T1-F1-model_v4 deleted 0.9704 5 66
AF-A0A384K484-F1-model_v4 Uncharacterized protein 0.9659 4 78 GO:0016491
AF-A0A6J4IXM9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.958 1 66 GO:0050664
AF-A0A381T439-F1-model_v4 Ketoreductase (KR) domain-containing protein 0.9566 5 66 GO:0005777
GO:0008670
GO:0009062

Map