F358447

General Info

Members Datasets Scaffolds Average Seq Length
246 163 492 119

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0004364|Ga0495632_0004364_6874_7305
Length 143
Sequence MGCKIEEFQQEQKKRMRAVQDSMDVLSGKWKIAIISSICCYGKRRFSDILNDIEGISNRMLSKELKELEINQLIKRTVLDTQPITVQYELTDHGDTLQTIISNLTDWGIVHRKKIVGNSLEDVNSPGCERTVAASSNFSGKSA

Samples

Sample ID Description Type Environment
1 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
35 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
36 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
50 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
65 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
66 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
67 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
68 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
69 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
70 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
71 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
72 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
73 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
76 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
91 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
92 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
99 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
110 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
111 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
112 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
113 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
114 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
115 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
116 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
123 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
124 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
128 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
129 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
130 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
131 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
132 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
137 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
138 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
141 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
144 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
145 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
146 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
147 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
148 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
149 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
150 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
151 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
152 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
153 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
154 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
155 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
156 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
157 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
158 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
159 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
160 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
161 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
162 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
163 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.56
Metatranscriptomes 0
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.08
Nodule 0
Rhizoplane 2.03
Rhizosphere 58.13
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495632_0004364 3300046519 Bacteria 9625
2 SwRhRL2b_contig_1686312 2162886007 Bacteria 1504
3 JGI24740J21852_10014588 3300001979 Bacteria 2892
4 JGI24737J22298_10127691 3300001990 Bacteria 751
5 JGI25158J39367_1007945 3300002739 Bacteria 1484
6 rootL2_10060729 3300003322 Bacteria 2601
7 rootL2_10131669 3300003322 Bacteria 2225
8 rootL2_10175248 3300003322 Bacteria 3160
9 rootH1_10000508 3300003323 Bacteria 29027
10 rootH1_10096655 3300003323 Bacteria 10857
11 rootH1_10383845 3300003323 Unclassified 1537
12 Ga0065165_1000981 3300005262 Bacteria 35359
13 Ga0065165_1006211 3300005262 Bacteria 6368
14 Ga0065714_10028899 3300005288 Bacteria 1719
15 Ga0065714_10471151 3300005288 Bacteria 540
16 Ga0065704_10076445 3300005289 Bacteria 5115
17 Ga0065704_10084036 3300005289 Bacteria 3386
18 Ga0065715_10630475 3300005293 Bacteria 690
19 Ga0068855_100387470 3300005563 Bacteria 1534
20 Ga0068857_100059101 3300005577 Bacteria 3405
21 Ga0068857_101420680 3300005577 Bacteria 675
22 Ga0068854_100043710 3300005578 Bacteria 3177
23 Ga0068856_100066210 3300005614 Bacteria 3570
24 Ga0068864_101330005 3300005618 Bacteria 719
25 Ga0068863_102741440 3300005841 Bacteria 501
26 Ga0068862_101515477 3300005844 Bacteria 676
27 Ga0075435_100297042 3300007076 Bacteria 1381
28 Ga0105244_10000004 3300009036 Bacteria 492478
29 Ga0105240_10000606 3300009093 Bacteria 66467
30 Ga0105247_11048869 3300009101 Bacteria 640
31 Ga0105237_10186181 3300009545 Bacteria 2076
32 Ga0105249_10033849 3300009553 Bacteria 4628
33 Ga0105239_10280225 3300010375 Bacteria 1877
34 Ga0105239_10356138 3300010375 Bacteria 1652
35 Ga0105239_11050180 3300010375 Bacteria 937
36 Ga0157371_10069577 3300013102 Bacteria 2492
37 Ga0157371_10268833 3300013102 Bacteria 1230
38 Ga0157371_10391889 3300013102 Bacteria 1015
39 Ga0157371_11435160 3300013102 Bacteria 537
40 Ga0157370_10000463 3300013104 Bacteria 50658
41 Ga0157370_10036974 3300013104 Bacteria 4736
42 Ga0157370_10052595 3300013104 Bacteria 3888
43 Ga0157370_10081342 3300013104 Bacteria 3048
44 Ga0157370_10119027 3300013104 Bacteria 2466
45 Ga0157370_10736756 3300013104 Bacteria 898
46 Ga0163162_10000223 3300013306 Bacteria 51991
47 Ga0163162_12139315 3300013306 Bacteria 642
48 Ga0157372_10172217 3300013307 Bacteria 2505
49 Ga0157375_13186807 3300013308 Bacteria 547
50 Ga0163163_10758242 3300014325 Bacteria 1034
51 Ga0182008_10000791 3300014497 Bacteria 22182
52 Ga0182006_1000110 3300015261 Bacteria 88392
53 Ga0182005_1001673 3300015265 Bacteria 8593
54 Ga0209436_100544 3300025208 Bacteria 16288
55 Ga0209258_123060 3300025242 Bacteria 631
56 Ga0209050_1035854 3300025298 Bacteria 1460
57 Ga0207426_1000030 3300025302 Bacteria 461478
58 Ga0207426_1007154 3300025302 Bacteria 4712
59 Ga0207655_1000008 3300025728 Bacteria 734289
60 Ga0207695_10000685 3300025913 Bacteria 66448
61 Ga0207671_10001393 3300025914 Bacteria 28100
62 Ga0207671_10001892 3300025914 Bacteria 23269
63 Ga0207671_10069807 3300025914 Bacteria 2618
64 Ga0207671_10398497 3300025914 Bacteria 1094
65 Ga0207712_11187751 3300025961 Bacteria 680
66 Ga0207640_10032756 3300025981 Bacteria 3225
67 Ga0207702_10048798 3300026078 Bacteria 3571
68 Ga0207676_11095864 3300026095 Bacteria 787
69 Ga0207674_10052414 3300026116 Bacteria 4161
70 Ga0307517_10404754 3300028786 Bacteria 721
71 Ga0307515_10252968 3300028794 Bacteria 1510
72 Ga0307515_10673069 3300028794 Bacteria 649
73 Ga0316179_1026152 3300030734 Bacteria 2169
74 Ga0265327_10000586 3300031251 Bacteria 61203
75 Ga0307513_10347044 3300031456 Bacteria 1233
76 Ga0307513_10546691 3300031456 Bacteria 871
77 Ga0307408_100005335 3300031548 Bacteria 8610
78 Ga0307516_10343244 3300031730 Bacteria 1160
79 Ga0307405_10000002 3300031731 Bacteria 575196
80 Ga0307413_10015938 3300031824 Bacteria 3865
81 Ga0307410_10006602 3300031852 Bacteria 6274
82 Ga0307406_10000153 3300031901 Bacteria 41029
83 Ga0307406_10009323 3300031901 Bacteria 5501
84 Ga0307407_10004731 3300031903 Bacteria 5820
85 Ga0307412_11199954 3300031911 Bacteria 679
86 Ga0307414_10000002 3300032004 Bacteria 623006
87 Ga0307414_10029002 3300032004 Bacteria 3597
88 Ga0307414_10348943 3300032004 Bacteria 1269
89 Ga0307414_10659966 3300032004 Bacteria 943
90 Ga0307411_10000001 3300032005 Bacteria 931810
91 Ga0307411_10107680 3300032005 Bacteria 1987
92 Ga0307510_10008124 3300033180 Bacteria 12498
93 Ga0307510_10133756 3300033180 Bacteria 2144
94 Ga0439436_0022531 3300041404 Bacteria 1866
95 Ga0439465_0007602 3300041413 Bacteria 3438
96 Ga0451787_173339 3300041441 Unclassified 768
97 Ga0451789_0654848 3300041443 Bacteria 1014
98 Ga0451793_0911820 3300041452 Bacteria 671
99 Ga0451798_0733201 3300041458 Bacteria 684
100 Ga0451802_1303615 3300041460 Bacteria 940
101 Ga0451833_0686793 3300041491 Bacteria 1083
102 Ga0451833_1270259 3300041491 Bacteria 600
103 Ga0451835_0719309 3300041492 Bacteria 509
104 Ga0451851_0000243 3300041507 Bacteria 587
105 Ga0451853_1816488 3300041512 Bacteria 2363
106 Ga0439449_0301546 3300042007 Bacteria 605
107 Ga0450899_053741 3300042135 Bacteria 517
108 Ga0439435_0067210 3300042436 Bacteria 1055
109 Ga0466972_0000019 3300044658 Bacteria 198523
110 Ga0466970_0003156 3300044765 Bacteria 8006
111 Ga0466959_0035543 3300045049 Bacteria 3684
112 Ga0495638_0053658 3300046460 Bacteria 2509
113 Ga0495638_0082992 3300046460 Bacteria 1942
114 Ga0495650_0000050 3300046471 Bacteria 318894
115 Ga0495583_0027148 3300046506 Bacteria 2828
116 Ga0495606_0000213 3300046507 Bacteria 103305
117 Ga0495606_0004976 3300046507 Bacteria 12959
118 Ga0495606_0086105 3300046507 Bacteria 1943
119 Ga0495610_0000001 3300046512 Bacteria 1620061
120 Ga0495610_0005278 3300046512 Bacteria 9242
121 Ga0495610_0104196 3300046512 Bacteria 1266
122 Ga0495616_0002714 3300046513 Bacteria 11592
123 Ga0495632_0051226 3300046519 Bacteria 2033
124 Ga0495643_0049018 3300046522 Bacteria 2279
125 Ga0495648_0038849 3300046524 Bacteria 3037
126 Ga0495648_0427673 3300046524 Bacteria 585
127 Ga0495609_0000003 3300046538 Bacteria 711547
128 Ga0495633_0000989 3300046558 Bacteria 23337
129 Ga0495633_0052542 3300046558 Bacteria 1919
130 Ga0495633_0206348 3300046558 Bacteria 901
131 Ga0495668_0000868 3300046616 Bacteria 34090
132 Ga0495668_0049902 3300046616 Bacteria 2321
133 Ga0495611_0002844 3300046648 Bacteria 7735
134 Ga0495611_0165740 3300046648 Bacteria 1033
135 Ga0495625_0000105 3300046660 Bacteria 126078
136 Ga0495625_0001723 3300046660 Bacteria 25395
137 Ga0495661_0011915 3300046665 Bacteria 5886
138 Ga0495661_0012118 3300046665 Bacteria 5828
139 Ga0495649_0000011 3300046694 Bacteria 416695
140 Ga0495649_0294513 3300046694 Bacteria 827
141 Ga0495660_0019250 3300046810 Bacteria 3920
142 Ga0495672_0010459 3300047320 Bacteria 6607
143 Ga0495687_014055 3300047443 Bacteria 4141
144 Ga0495673_0064575 3300047469 Bacteria 1556
145 Ga0495686_0000122 3300047472 Bacteria 162732
146 Ga0495686_0000436 3300047472 Bacteria 64423
147 Ga0495686_0042448 3300047472 Bacteria 2892
148 Ga0495686_0068512 3300047472 Bacteria 2189
149 Ga0495686_0103012 3300047472 Bacteria 1720
150 Ga0495686_0203617 3300047472 Bacteria 1134
151 Ga0496121_0000028 3300048924 Bacteria 439193
152 Ga0496122_0007600 3300048925 Bacteria 11978
153 Ga0496123_0005589 3300048926 Bacteria 12567
154 Ga0496125_0038126 3300048928 Bacteria 4166
155 Ga0495682_0110044 3300049460 Bacteria 987
156 Ga0501033_0582406 3300049570 Bacteria 769
157 Ga0501037_0823801 3300049573 Bacteria 612
158 Ga0501047_0063415 3300049581 Bacteria 3565
159 Ga0501047_1291810 3300049581 Bacteria 544
160 Ga0501048_0053738 3300049582 Bacteria 2863
161 Ga0501238_000039 3300049671 Bacteria 22400
162 Ga0501249_010002 3300049679 Bacteria 1977
163 Ga0501250_009923 3300049680 Bacteria 1082
164 Ga0501255_045827 3300049684 Bacteria 655
165 Ga0501241_022279 3300049758 Bacteria 1170
166 Ga0501241_034840 3300049758 Bacteria 961
167 Ga0501266_000014 3300049763 Bacteria 181600
168 Ga0501269_000880 3300049766 Bacteria 4487
169 Ga0501280_000529 3300049776 Bacteria 8956
170 Ga0501280_044633 3300049776 Bacteria 728
171 Ga0501044_0083833 3300049823 Bacteria 3222
172 Ga0501044_0214456 3300049823 Bacteria 1878
173 Ga0501044_1573962 3300049823 Bacteria 522
174 nmdc:mga0rr50_367932_c1 3300050513 Bacteria 1211
175 nmdc:mga0sz30_596269_c1 3300050516 Bacteria 500
176 Ga0500578_0000003 3300053086 Bacteria 266033
177 Ga0500578_0044505 3300053086 Bacteria 2849
178 Ga0500643_204731 3300053087 Bacteria 529
179 Ga0500644_0000415 3300053088 Bacteria 20101
180 Ga0500644_0068325 3300053088 Bacteria 1273
181 Ga0500581_350827 3300053089 Bacteria 559
182 Ga0500646_0083487 3300053090 Bacteria 978
183 Ga0500646_0274139 3300053090 Bacteria 599
184 Ga0500583_0000113 3300053092 Bacteria 39569
185 Ga0500583_0306355 3300053092 Bacteria 776
186 Ga0500651_0203862 3300053093 Bacteria 1166
187 Ga0500651_0595299 3300053093 Bacteria 600
188 Ga0500650_0302645 3300053098 Bacteria 707
189 Ga0500555_066488 3300053103 Bacteria 959
190 Ga0500555_174320 3300053103 Bacteria 521
191 Ga0500556_0163643 3300053104 Bacteria 878
192 Ga0500556_0215565 3300053104 Bacteria 757
193 Ga0500562_000027 3300053108 Bacteria 100118
194 Ga0500562_001999 3300053108 Bacteria 5116
195 Ga0500562_013709 3300053108 Bacteria 2072
196 Ga0500569_000218 3300053109 Bacteria 9113
197 Ga0500594_0040932 3300053118 Bacteria 1267
198 Ga0500618_008404 3300053125 Bacteria 2882
199 Ga0500621_094231 3300053126 Bacteria 1188
200 Ga0500642_0006833 3300053130 Bacteria 3791
201 Ga0500642_0074152 3300053130 Bacteria 1553
202 Ga0500642_0495259 3300053130 Bacteria 517
203 Ga0500652_091474 3300053131 Bacteria 1270
204 Ga0500652_280812 3300053131 Bacteria 650
205 Ga0500655_024720 3300053133 Bacteria 1138
206 Ga0500658_0000003 3300053134 Bacteria 512506
207 Ga0500658_0001696 3300053134 Bacteria 8727
208 Ga0500658_0437620 3300053134 Bacteria 596
209 Ga0500559_0024918 3300053136 Bacteria 2546
210 Ga0500561_0069859 3300053137 Bacteria 1002
211 Ga0500564_213882 3300053138 Bacteria 784
212 Ga0500568_0012658 3300053139 Bacteria 3873
213 Ga0500568_0034953 3300053139 Bacteria 2053
214 Ga0500577_0002919 3300053142 Bacteria 4400
215 Ga0500577_0052974 3300053142 Bacteria 1532
216 Ga0500577_0060087 3300053142 Bacteria 1459
217 Ga0500588_0184080 3300053146 Bacteria 769
218 Ga0500588_0225658 3300053146 Bacteria 699
219 Ga0500590_099222 3300053148 Bacteria 1401
220 Ga0500590_146636 3300053148 Bacteria 1071
221 Ga0500616_0000445 3300053153 Bacteria 54193
222 Ga0500616_0100398 3300053153 Bacteria 1415
223 Ga0500616_0222512 3300053153 Bacteria 822
224 Ga0500622_0000021 3300053156 Bacteria 268013
225 Ga0500622_0000062 3300053156 Bacteria 130392
226 Ga0500622_0000340 3300053156 Bacteria 45986
227 Ga0500622_0007076 3300053156 Bacteria 6415
228 Ga0500622_0008291 3300053156 Bacteria 5826
229 Ga0500627_0116103 3300053158 Bacteria 1206
230 Ga0500627_0129338 3300053158 Bacteria 1140
231 Ga0500633_0007329 3300053160 Bacteria 2770
232 Ga0500634_0099910 3300053161 Bacteria 1454
233 Ga0500636_0022087 3300053177 Bacteria 3765
234 Ga0500637_0280307 3300053178 Bacteria 918
235 Ga0500584_120028 3300053726 Bacteria 1044
236 Ga0500611_001231 3300053727 Bacteria 2748
237 Ga0500645_008038 3300053730 Bacteria 3630
238 Ga0500645_061770 3300053730 Bacteria 1082
239 Ga0500587_023538 3300053739 Bacteria 814
240 Ga0500661_002591 3300055283 Bacteria 3414
241 2587753032 2585428061 Bacteria 3939663
242 2587866121 2585428095 Bacteria 3789702
243 2588234427 2585428187 Bacteria 4629388
244 2929925838 2929921140 Bacteria 8649150
245 2945928305 2945924605 Bacteria 4296724
246 2958515899 2958512119 Bacteria 4528530
247 Ga0495632_0004364
248 SwRhRL2b_contig_1686312
249 JGI24740J21852_10014588
250 JGI24737J22298_10127691
251 JGI25158J39367_1007945
252 rootL2_10060729
253 rootL2_10131669
254 rootL2_10175248
255 rootH1_10000508
256 rootH1_10096655
257 rootH1_10383845
258 Ga0065165_1000981
259 Ga0065165_1006211
260 Ga0065714_10028899
261 Ga0065714_10471151
262 Ga0065704_10076445
263 Ga0065704_10084036
264 Ga0065715_10630475
265 Ga0068855_100387470
266 Ga0068857_100059101
267 Ga0068857_101420680
268 Ga0068854_100043710
269 Ga0068856_100066210
270 Ga0068864_101330005
271 Ga0068863_102741440
272 Ga0068862_101515477
273 Ga0075435_100297042
274 Ga0105244_10000004
275 Ga0105240_10000606
276 Ga0105247_11048869
277 Ga0105237_10186181
278 Ga0105249_10033849
279 Ga0105239_10280225
280 Ga0105239_10356138
281 Ga0105239_11050180
282 Ga0157371_10069577
283 Ga0157371_10268833
284 Ga0157371_10391889
285 Ga0157371_11435160
286 Ga0157370_10000463
287 Ga0157370_10036974
288 Ga0157370_10052595
289 Ga0157370_10081342
290 Ga0157370_10119027
291 Ga0157370_10736756
292 Ga0163162_10000223
293 Ga0163162_12139315
294 Ga0157372_10172217
295 Ga0157375_13186807
296 Ga0163163_10758242
297 Ga0182008_10000791
298 Ga0182006_1000110
299 Ga0182005_1001673
300 Ga0209436_100544
301 Ga0209258_123060
302 Ga0209050_1035854
303 Ga0207426_1000030
304 Ga0207426_1007154
305 Ga0207655_1000008
306 Ga0207695_10000685
307 Ga0207671_10001393
308 Ga0207671_10001892
309 Ga0207671_10069807
310 Ga0207671_10398497
311 Ga0207712_11187751
312 Ga0207640_10032756
313 Ga0207702_10048798
314 Ga0207676_11095864
315 Ga0207674_10052414
316 Ga0307517_10404754
317 Ga0307515_10252968
318 Ga0307515_10673069
319 Ga0316179_1026152
320 Ga0265327_10000586
321 Ga0307513_10347044
322 Ga0307513_10546691
323 Ga0307408_100005335
324 Ga0307516_10343244
325 Ga0307405_10000002
326 Ga0307413_10015938
327 Ga0307410_10006602
328 Ga0307406_10000153
329 Ga0307406_10009323
330 Ga0307407_10004731
331 Ga0307412_11199954
332 Ga0307414_10000002
333 Ga0307414_10029002
334 Ga0307414_10348943
335 Ga0307414_10659966
336 Ga0307411_10000001
337 Ga0307411_10107680
338 Ga0307510_10008124
339 Ga0307510_10133756
340 Ga0439436_0022531
341 Ga0439465_0007602
342 Ga0451787_173339
343 Ga0451789_0654848
344 Ga0451793_0911820
345 Ga0451798_0733201
346 Ga0451802_1303615
347 Ga0451833_0686793
348 Ga0451833_1270259
349 Ga0451835_0719309
350 Ga0451851_0000243
351 Ga0451853_1816488
352 Ga0439449_0301546
353 Ga0450899_053741
354 Ga0439435_0067210
355 Ga0466972_0000019
356 Ga0466970_0003156
357 Ga0466959_0035543
358 Ga0495638_0053658
359 Ga0495638_0082992
360 Ga0495650_0000050
361 Ga0495583_0027148
362 Ga0495606_0000213
363 Ga0495606_0004976
364 Ga0495606_0086105
365 Ga0495610_0000001
366 Ga0495610_0005278
367 Ga0495610_0104196
368 Ga0495616_0002714
369 Ga0495632_0051226
370 Ga0495643_0049018
371 Ga0495648_0038849
372 Ga0495648_0427673
373 Ga0495609_0000003
374 Ga0495633_0000989
375 Ga0495633_0052542
376 Ga0495633_0206348
377 Ga0495668_0000868
378 Ga0495668_0049902
379 Ga0495611_0002844
380 Ga0495611_0165740
381 Ga0495625_0000105
382 Ga0495625_0001723
383 Ga0495661_0011915
384 Ga0495661_0012118
385 Ga0495649_0000011
386 Ga0495649_0294513
387 Ga0495660_0019250
388 Ga0495672_0010459
389 Ga0495687_014055
390 Ga0495673_0064575
391 Ga0495686_0000122
392 Ga0495686_0000436
393 Ga0495686_0042448
394 Ga0495686_0068512
395 Ga0495686_0103012
396 Ga0495686_0203617
397 Ga0496121_0000028
398 Ga0496122_0007600
399 Ga0496123_0005589
400 Ga0496125_0038126
401 Ga0495682_0110044
402 Ga0501033_0582406
403 Ga0501037_0823801
404 Ga0501047_0063415
405 Ga0501047_1291810
406 Ga0501048_0053738
407 Ga0501238_000039
408 Ga0501249_010002
409 Ga0501250_009923
410 Ga0501255_045827
411 Ga0501241_022279
412 Ga0501241_034840
413 Ga0501266_000014
414 Ga0501269_000880
415 Ga0501280_000529
416 Ga0501280_044633
417 Ga0501044_0083833
418 Ga0501044_0214456
419 Ga0501044_1573962
420 nmdc:mga0rr50_367932_c1
421 nmdc:mga0sz30_596269_c1
422 Ga0500578_0000003
423 Ga0500578_0044505
424 Ga0500643_204731
425 Ga0500644_0000415
426 Ga0500644_0068325
427 Ga0500581_350827
428 Ga0500646_0083487
429 Ga0500646_0274139
430 Ga0500583_0000113
431 Ga0500583_0306355
432 Ga0500651_0203862
433 Ga0500651_0595299
434 Ga0500650_0302645
435 Ga0500555_066488
436 Ga0500555_174320
437 Ga0500556_0163643
438 Ga0500556_0215565
439 Ga0500562_000027
440 Ga0500562_001999
441 Ga0500562_013709
442 Ga0500569_000218
443 Ga0500594_0040932
444 Ga0500618_008404
445 Ga0500621_094231
446 Ga0500642_0006833
447 Ga0500642_0074152
448 Ga0500642_0495259
449 Ga0500652_091474
450 Ga0500652_280812
451 Ga0500655_024720
452 Ga0500658_0000003
453 Ga0500658_0001696
454 Ga0500658_0437620
455 Ga0500559_0024918
456 Ga0500561_0069859
457 Ga0500564_213882
458 Ga0500568_0012658
459 Ga0500568_0034953
460 Ga0500577_0002919
461 Ga0500577_0052974
462 Ga0500577_0060087
463 Ga0500588_0184080
464 Ga0500588_0225658
465 Ga0500590_099222
466 Ga0500590_146636
467 Ga0500616_0000445
468 Ga0500616_0100398
469 Ga0500616_0222512
470 Ga0500622_0000021
471 Ga0500622_0000062
472 Ga0500622_0000340
473 Ga0500622_0007076
474 Ga0500622_0008291
475 Ga0500627_0116103
476 Ga0500627_0129338
477 Ga0500633_0007329
478 Ga0500634_0099910
479 Ga0500636_0022087
480 Ga0500637_0280307
481 Ga0500584_120028
482 Ga0500611_001231
483 Ga0500645_008038
484 Ga0500645_061770
485 Ga0500587_023538
486 Ga0500661_002591
487 2587753032
488 2587866121
489 2588234427
490 2929925838
491 2945928305
492 2958515899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01638

HxlR

HxlR-like helix-turn-helix

25

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fsw-assembly1.cif.gz_A crystal structure of the putative transcriptional regualator, marr family from porphyromonas gingivalis w83 0.9412 20 111
7kd3-assembly1.cif.gz_A structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9388 20 114
4a5m-assembly1.cif.gz_B redox regulator hypr in its oxidized form 0.9386 19 111
7kd3-assembly1.cif.gz_B structure of an hxlr/duf24 family transcription regulator, cdtr_3200 from hypervirulent clostridioides difficile r20291 0.9381 19 115
7bzg-assembly3.cif.gz_J structure of bacillus subtilis hxlr, wild type in complex with formaldehyde and dna 0.9265 21 116
ID Description Score Start End Superfamily
2fswA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9396 20 109 1.10.10.10
af_P9WMG3_11_158_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9364 20 112 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9296 34 90 1.10.10.10
5j6xB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9077 35 93 1.10.10.10
5hs9B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.901 19 111 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A519ZWZ5-F1-model_v4 Transcriptional regulator 0.9877 9 119 GO:0003677
GO:0005737
AF-A0A4U0H4P7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9846 14 116 GO:0003677
GO:0005737
AF-A0A5B2VVU0-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9816 9 119 GO:0003677
GO:0005737
AF-A0A519X3G2-F1-model_v4 Transcriptional regulator 0.9805 19 119 GO:0003677
GO:0005737
AF-A0A1Q6A6J9-F1-model_v4 HTH hxlR-type domain-containing protein 0.9802 15 118 GO:0003677
GO:0005737

Map