F358464

General Info

Members Datasets Scaffolds Average Seq Length
246 161 490 465

Family's Representative Sequence

Representative Sequence 3300046694|Ga0495649_0000631|Ga0495649_0000631_3663_5345
Length 560
Sequence MSSAGASAAVAASMRAEKRIVQTLRNANATSPETAVALAEGRLIQRGALRRLIRSHAVIEAAPNTFWLDDAAYAEMKKLRTSRIILTMFGLAALLIILATVTIAKADTPQAPALRPDQIAFRGLYKELVETNTTLSEGSCTLAAQRMAARMVAAGYSDADARVVIPEDQPKFGSLIATLPGTDASAPAMLLLAHIDVVEARRADWERDPFVLVEENGFFYARGASDDKAEASVWVDSLIRLKQQGFQPRRTIKLALTCGEETNDNWNGVQWLLEHHPEMLQAGFALNEGAGGQLDANANRIALNVQAGEKVYQDYTLELTNPGGHSARPRKDNAIGAMGAALDRLVQHDFPLELSPVTRAYFSAIAQTTPASAADLRALTAHDTPDAAAAARLGAVNPVWNAMMRTTCIPTLISGGHAPNAQPQKVTVNVNCRILPGHSIAETQAEIASALANPAITIKTIGEPSPTSPAPLLTPAILDPIKAAAAKLWPGVPVVPTLSTGATDGRFTNAAGVATYGVTGMFTDPDGNGVHGLNERLRVRSLYEGRDFLFELIQLYAMQD

Samples

Sample ID Description Type Environment
1 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
103 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
131 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
139 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
140 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
141 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
142 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
143 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
144 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
145 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
146 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
147 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
148 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
149 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
150 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
151 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
152 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
153 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
154 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
155 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
156 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
157 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
158 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
159 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
160 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
161 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.72
Metatranscriptomes 0
Isolates 5.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.89
Nodule 0
Rhizoplane 5.28
Rhizosphere 68.29
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495649_0000631 3300046694 Bacteria 28705
2 Ga0055536_1000943 3300003781 Bacteria 18711
3 Ga0055536_1001855 3300003781 Bacteria 12351
4 Ga0055534_1004640 3300003784 Bacteria 3907
5 Ga0055530_10000779 3300003791 Bacteria 26560
6 Ga0055531_10000711 3300003794 Bacteria 28363
7 Ga0055531_10002030 3300003794 Bacteria 14004
8 Ga0065707_10081971 3300005295 Bacteria 26697
9 Ga0070676_10059616 3300005328 Bacteria 2264
10 Ga0070670_100003881 3300005331 Bacteria 12461
11 Ga0070677_10007391 3300005333 Bacteria 3664
12 Ga0068869_100000640 3300005334 Bacteria 19693
13 Ga0070680_100041250 3300005336 Bacteria 3742
14 Ga0070687_100047209 3300005343 Bacteria 2208
15 Ga0070692_10015723 3300005345 Bacteria 3585
16 Ga0070669_100049030 3300005353 Bacteria 3083
17 Ga0070675_100007382 3300005354 Bacteria 8490
18 Ga0070671_100047378 3300005355 Bacteria 3574
19 Ga0070674_100001381 3300005356 Bacteria 12831
20 Ga0070659_100001782 3300005366 Bacteria 15474
21 Ga0070667_100052171 3300005367 Bacteria 3450
22 Ga0070667_100070832 3300005367 Bacteria 2968
23 Ga0070701_10002798 3300005438 Bacteria 6782
24 Ga0070700_100013266 3300005441 Bacteria 4627
25 Ga0070700_100025277 3300005441 Bacteria 3497
26 Ga0070708_100097188 3300005445 Bacteria 2692
27 Ga0070662_100014719 3300005457 Bacteria 5228
28 Ga0070662_100044836 3300005457 Bacteria 3170
29 Ga0070681_10138803 3300005458 Bacteria 2361
30 Ga0068867_100003489 3300005459 Bacteria 11061
31 Ga0068867_100015117 3300005459 Bacteria 5473
32 Ga0070672_100013559 3300005543 Bacteria 5762
33 Ga0070672_100048782 3300005543 Bacteria 3292
34 Ga0070672_100103311 3300005543 Bacteria 2314
35 Ga0070665_100000136 3300005548 Bacteria 138094
36 Ga0070665_100000921 3300005548 Bacteria 37702
37 Ga0070665_100025011 3300005548 Bacteria 6019
38 Ga0070665_100040855 3300005548 Bacteria 4662
39 Ga0070664_100108724 3300005564 Bacteria 2418
40 Ga0068854_100025405 3300005578 Bacteria 4064
41 Ga0070702_100060496 3300005615 Bacteria 2202
42 Ga0068864_100000283 3300005618 Bacteria 45450
43 Ga0068864_100002250 3300005618 Bacteria 15962
44 Ga0068864_100130148 3300005618 Bacteria 2260
45 Ga0068861_100008242 3300005719 Bacteria 7173
46 Ga0068870_10019222 3300005840 Bacteria 3311
47 Ga0068870_10045803 3300005840 Bacteria 2291
48 Ga0068863_100000091 3300005841 Bacteria 98724
49 Ga0068863_100027248 3300005841 Bacteria 5450
50 Ga0068863_100069239 3300005841 Bacteria 3337
51 Ga0068863_100156918 3300005841 Bacteria 2179
52 Ga0068858_100000059 3300005842 Bacteria 117158
53 Ga0068858_100019886 3300005842 Bacteria 6278
54 Ga0081455_10103476 3300005937 Bacteria 2280
55 Ga0075428_100005988 3300006844 Bacteria 13503
56 Ga0075428_100112726 3300006844 Bacteria 2962
57 Ga0075428_100172303 3300006844 Bacteria 2345
58 Ga0075431_100040471 3300006847 Bacteria 4804
59 Ga0075431_100158728 3300006847 Bacteria 2326
60 Ga0075429_100026689 3300006880 Bacteria 5015
61 Ga0075429_100114029 3300006880 Bacteria 2362
62 Ga0068865_100031929 3300006881 Bacteria 3514
63 Ga0068865_100042836 3300006881 Bacteria 3089
64 Ga0105240_10001688 3300009093 Bacteria 37384
65 Ga0105240_10014399 3300009093 Bacteria 10800
66 Ga0111539_10196908 3300009094 Bacteria 2350
67 Ga0114129_10398072 3300009147 Bacteria 1815
68 Ga0105248_10000280 3300009177 Bacteria 60247
69 Ga0105248_10083408 3300009177 Bacteria 3595
70 Ga0105238_10009338 3300009551 Bacteria 9821
71 Ga0105238_10051182 3300009551 Bacteria 4154
72 Ga0105238_10106179 3300009551 Bacteria 2790
73 Ga0105246_10095740 3300011119 Bacteria 2150
74 Ga0157372_10466574 3300013307 Bacteria 1472
75 Ga0157375_10015470 3300013308 Bacteria 6830
76 Ga0157375_10170225 3300013308 Bacteria 2325
77 Ga0163163_10002851 3300014325 Bacteria 14609
78 Ga0163163_10064619 3300014325 Bacteria 3631
79 Ga0157380_10020853 3300014326 Bacteria 4906
80 Ga0157380_10034203 3300014326 Bacteria 3919
81 Ga0157380_10063763 3300014326 Bacteria 2956
82 Ga0213872_10003881 3300021361 Bacteria 8115
83 Ga0209675_1000082 3300025291 Bacteria 153550
84 Ga0209676_1000081 3300025292 Bacteria 285297
85 Ga0209676_1000118 3300025292 Bacteria 201939
86 Ga0209676_1000459 3300025292 Bacteria 68606
87 Ga0209050_1000017 3300025298 Bacteria 728928
88 Ga0209050_1013173 3300025298 Bacteria 3703
89 Ga0209050_1022715 3300025298 Bacteria 2237
90 Ga0209257_1000151 3300025304 Bacteria 191408
91 Ga0209257_1000232 3300025304 Bacteria 130749
92 Ga0209257_1002993 3300025304 Bacteria 15328
93 Ga0207710_10013053 3300025900 Bacteria 3499
94 Ga0207645_10001984 3300025907 Bacteria 16446
95 Ga0207645_10006994 3300025907 Bacteria 8033
96 Ga0207643_10013914 3300025908 Bacteria 4365
97 Ga0207705_10078899 3300025909 Bacteria 2397
98 Ga0207695_10001211 3300025913 Bacteria 44223
99 Ga0207695_10002054 3300025913 Bacteria 30785
100 Ga0207695_10103365 3300025913 Bacteria 2840
101 Ga0207657_10045905 3300025919 Bacteria 3830
102 Ga0207694_10035471 3300025924 Bacteria 3827
103 Ga0207650_10012531 3300025925 Bacteria 5853
104 Ga0207644_10031522 3300025931 Bacteria 3693
105 Ga0207690_10003157 3300025932 Bacteria 9898
106 Ga0207706_10004566 3300025933 Bacteria 12995
107 Ga0207706_10059858 3300025933 Bacteria 3354
108 Ga0207706_10106518 3300025933 Bacteria 2467
109 Ga0207686_10012712 3300025934 Bacteria 4634
110 Ga0207669_10027871 3300025937 Bacteria 3099
111 Ga0207691_10002053 3300025940 Bacteria 19685
112 Ga0207691_10022041 3300025940 Bacteria 6010
113 Ga0207711_10000678 3300025941 Bacteria 33766
114 Ga0207689_10002341 3300025942 Bacteria 17718
115 Ga0207689_10062651 3300025942 Bacteria 3059
116 Ga0207651_10019023 3300025960 Bacteria 4105
117 Ga0207640_10045616 3300025981 Bacteria 2815
118 Ga0207658_10047678 3300025986 Bacteria 3137
119 Ga0207658_10121841 3300025986 Bacteria 2081
120 Ga0207677_10128073 3300026023 Bacteria 1922
121 Ga0207641_10000011 3300026088 Bacteria 384362
122 Ga0207641_10036289 3300026088 Bacteria 4114
123 Ga0207641_10044292 3300026088 Bacteria 3742
124 Ga0207648_10005145 3300026089 Bacteria 13243
125 Ga0207648_10006570 3300026089 Bacteria 11547
126 Ga0207676_10000117 3300026095 Bacteria 69834
127 Ga0207676_10176747 3300026095 Bacteria 1865
128 Ga0207675_100003433 3300026118 Bacteria 15488
129 Ga0207675_100036866 3300026118 Bacteria 4561
130 Ga0207698_10218636 3300026142 Bacteria 1720
131 Ga0209999_1005056 3300027543 Bacteria 2371
132 Ga0209983_1003701 3300027665 Bacteria 3241
133 Ga0209971_1000777 3300027682 Bacteria 8204
134 Ga0209998_10002095 3300027717 Bacteria 4658
135 Ga0209974_10001323 3300027876 Bacteria 8911
136 Ga0268266_10000003 3300028379 Bacteria 1701703
137 Ga0307517_10031361 3300028786 Bacteria 6188
138 Ga0307515_10033488 3300028794 Bacteria 8454
139 Ga0307513_10009571 3300031456 Bacteria 12240
140 Ga0307513_10058473 3300031456 Bacteria 4097
141 Ga0307509_10064291 3300031507 Bacteria 3860
142 Ga0307516_10098620 3300031730 Bacteria 2740
143 Ga0307413_10031632 3300031824 Bacteria 2989
144 Ga0307413_10143358 3300031824 Bacteria 1654
145 Ga0307407_10004866 3300031903 Bacteria 5764
146 Ga0307412_10144236 3300031911 Bacteria 1748
147 Ga0307409_100062378 3300031995 Bacteria 2918
148 Ga0307409_100110355 3300031995 Bacteria 2305
149 Ga0307409_100121111 3300031995 Bacteria 2216
150 Ga0307416_100051056 3300032002 Bacteria 3301
151 Ga0307416_100112170 3300032002 Bacteria 2406
152 Ga0307414_10000107 3300032004 Bacteria 58717
153 Ga0307414_10101512 3300032004 Bacteria 2166
154 Ga0307414_10102357 3300032004 Bacteria 2158
155 Ga0307411_10024269 3300032005 Bacteria 3611
156 Ga0307411_10093282 3300032005 Bacteria 2107
157 Ga0307415_100024364 3300032126 Bacteria 3777
158 Ga0395899_0000003 3300037312 Bacteria 1232684
159 Ga0395905_0130332 3300037471 Bacteria 2365
160 Ga0395905_0203151 3300037471 Bacteria 1857
161 Ga0237819_00487 3300038705 Bacteria 13421
162 Ga0237819_00749 3300038705 Bacteria 10427
163 Ga0237816_00725 3300039145 Bacteria 2772
164 Ga0495638_0000470 3300046460 Bacteria 48486
165 Ga0495638_0002848 3300046460 Bacteria 13865
166 Ga0495638_0025778 3300046460 Bacteria 3817
167 Ga0495583_0000002 3300046506 Bacteria 782521
168 Ga0495632_0003901 3300046519 Bacteria 10362
169 Ga0495637_0027675 3300046520 Bacteria 2534
170 Ga0495643_0067661 3300046522 Bacteria 1881
171 Ga0495654_0022497 3300046530 Bacteria 3272
172 Ga0495625_0000274 3300046660 Bacteria 80067
173 Ga0495625_0000853 3300046660 Bacteria 41514
174 Ga0495625_0006333 3300046660 Bacteria 10575
175 Ga0495625_0016321 3300046660 Bacteria 5847
176 Ga0495625_0023635 3300046660 Bacteria 4691
177 Ga0495625_0027150 3300046660 Bacteria 4316
178 Ga0495669_0042133 3300046684 Bacteria 2029
179 Ga0495670_0009167 3300046691 Bacteria 4866
180 Ga0495672_0023705 3300047320 Bacteria 3967
181 Ga0496102_0011011 3300048905 Bacteria 7793
182 Ga0496102_0191418 3300048905 Bacteria 1927
183 Ga0496109_0001726 3300048912 Bacteria 18234
184 Ga0496109_0053202 3300048912 Bacteria 3692
185 Ga0496112_0071775 3300048915 Bacteria 3422
186 Ga0496114_0019153 3300048917 Viruses 5546
187 Ga0496114_0031011 3300048917 Bacteria 4398
188 Ga0496115_0000546 3300048918 Bacteria 29331
189 Ga0496115_0006965 3300048918 Bacteria 8303
190 Ga0496115_0008556 3300048918 Bacteria 7575
191 Ga0496115_0021459 3300048918 Bacteria 4991
192 Ga0496115_0023980 3300048918 Bacteria 4738
193 Ga0496115_0042235 3300048918 Bacteria 3632
194 Ga0496121_0009036 3300048924 Bacteria 11547
195 Ga0501032_0017249 3300049569 Bacteria 5070
196 Ga0501033_0039643 3300049570 Bacteria 3519
197 Ga0501036_0098785 3300049572 Bacteria 2468
198 Ga0501047_0011333 3300049581 Bacteria 8441
199 Ga0501080_0193259 3300049742 Bacteria 1870
200 Ga0501044_0023166 3300049823 Bacteria 6608
201 nmdc:mga09592_74428_c1 3300050508 Bacteria 2886
202 nmdc:mga0qj67_14233_c1 3300050509 Bacteria 6013
203 nmdc:mga06r32_162739_c1 3300050510 Bacteria 2214
204 nmdc:mga08y16_268447_c1 3300050511 Bacteria 1762
205 Ga0500643_002841 3300053087 Bacteria 8636
206 Ga0500583_0015077 3300053092 Bacteria 3047
207 Ga0500583_0019834 3300053092 Bacteria 2764
208 Ga0500651_0023475 3300053093 Bacteria 3863
209 Ga0500641_0007225 3300053096 Bacteria 3959
210 Ga0500641_0008769 3300053096 Bacteria 3618
211 Ga0500641_0023636 3300053096 Bacteria 2366
212 Ga0500562_001263 3300053108 Bacteria 6250
213 Ga0500562_009963 3300053108 Bacteria 2404
214 Ga0500642_0002148 3300053130 Bacteria 5728
215 Ga0500655_000851 3300053133 Bacteria 5945
216 Ga0500658_0001813 3300053134 Bacteria 8434
217 Ga0500559_0000086 3300053136 Bacteria 73688
218 Ga0500559_0020716 3300053136 Bacteria 2782
219 Ga0500568_0023065 3300053139 Unclassified 2651
220 Ga0500568_0027765 3300053139 Bacteria 2364
221 Ga0500573_0007620 3300053140 Bacteria 5916
222 Ga0500590_000742 3300053148 Bacteria 11915
223 Ga0500616_0001499 3300053153 Bacteria 22058
224 Ga0500616_0003196 3300053153 Bacteria 12744
225 Ga0500622_0010869 3300053156 Bacteria 4973
226 Ga0500622_0026335 3300053156 Bacteria 3071
227 Ga0500624_000001 3300053157 Bacteria 284974
228 Ga0500627_0000035 3300053158 Bacteria 80123
229 Ga0500627_0004787 3300053158 Bacteria 4403
230 Ga0500636_0009474 3300053177 Bacteria 5661
231 Ga0500637_0000010 3300053178 Bacteria 81649
232 Ga0500609_000847 3300053731 Bacteria 4587
233 2558910498 2558860112 Bacteria 9931328
234 2585263186 2582581305 Bacteria 4895574
235 2643820738 2643221560 Bacteria 4801179
236 2643833093 2643221563 Bacteria 4726935
237 2643884002 2643221574 Bacteria 2789653
238 2643999978 2643221598 Bacteria 4578346
239 2644053112 2643221608 Bacteria 4724829
240 2644088406 2643221614 Bacteria 4260023
241 2644343642 2643221661 Bacteria 4267604
242 2644368880 2643221666 Bacteria 4265935
243 2644549955 2643221699 Bacteria 5731501
244 2852684162 2852680915 Bacteria 4100189
245 2895882199 2895880812 Bacteria 11255272
246 Ga0495649_0000631
247 Ga0055536_1000943
248 Ga0055536_1001855
249 Ga0055534_1004640
250 Ga0055530_10000779
251 Ga0055531_10000711
252 Ga0055531_10002030
253 Ga0065707_10081971
254 Ga0070676_10059616
255 Ga0070670_100003881
256 Ga0070677_10007391
257 Ga0068869_100000640
258 Ga0070680_100041250
259 Ga0070687_100047209
260 Ga0070692_10015723
261 Ga0070669_100049030
262 Ga0070675_100007382
263 Ga0070671_100047378
264 Ga0070674_100001381
265 Ga0070659_100001782
266 Ga0070667_100052171
267 Ga0070667_100070832
268 Ga0070701_10002798
269 Ga0070700_100013266
270 Ga0070700_100025277
271 Ga0070708_100097188
272 Ga0070662_100014719
273 Ga0070662_100044836
274 Ga0070681_10138803
275 Ga0068867_100003489
276 Ga0068867_100015117
277 Ga0070672_100013559
278 Ga0070672_100048782
279 Ga0070672_100103311
280 Ga0070665_100000136
281 Ga0070665_100000921
282 Ga0070665_100025011
283 Ga0070665_100040855
284 Ga0070664_100108724
285 Ga0068854_100025405
286 Ga0070702_100060496
287 Ga0068864_100000283
288 Ga0068864_100002250
289 Ga0068864_100130148
290 Ga0068861_100008242
291 Ga0068870_10019222
292 Ga0068870_10045803
293 Ga0068863_100000091
294 Ga0068863_100027248
295 Ga0068863_100069239
296 Ga0068863_100156918
297 Ga0068858_100000059
298 Ga0068858_100019886
299 Ga0081455_10103476
300 Ga0075428_100005988
301 Ga0075428_100112726
302 Ga0075428_100172303
303 Ga0075431_100040471
304 Ga0075431_100158728
305 Ga0075429_100026689
306 Ga0075429_100114029
307 Ga0068865_100031929
308 Ga0068865_100042836
309 Ga0105240_10001688
310 Ga0105240_10014399
311 Ga0111539_10196908
312 Ga0114129_10398072
313 Ga0105248_10000280
314 Ga0105248_10083408
315 Ga0105238_10009338
316 Ga0105238_10051182
317 Ga0105238_10106179
318 Ga0105246_10095740
319 Ga0157372_10466574
320 Ga0157375_10015470
321 Ga0157375_10170225
322 Ga0163163_10002851
323 Ga0163163_10064619
324 Ga0157380_10020853
325 Ga0157380_10034203
326 Ga0157380_10063763
327 Ga0213872_10003881
328 Ga0209675_1000082
329 Ga0209676_1000081
330 Ga0209676_1000118
331 Ga0209676_1000459
332 Ga0209050_1000017
333 Ga0209050_1013173
334 Ga0209050_1022715
335 Ga0209257_1000151
336 Ga0209257_1000232
337 Ga0209257_1002993
338 Ga0207710_10013053
339 Ga0207645_10001984
340 Ga0207645_10006994
341 Ga0207643_10013914
342 Ga0207705_10078899
343 Ga0207695_10001211
344 Ga0207695_10002054
345 Ga0207695_10103365
346 Ga0207657_10045905
347 Ga0207694_10035471
348 Ga0207650_10012531
349 Ga0207644_10031522
350 Ga0207690_10003157
351 Ga0207706_10004566
352 Ga0207706_10059858
353 Ga0207706_10106518
354 Ga0207686_10012712
355 Ga0207669_10027871
356 Ga0207691_10002053
357 Ga0207691_10022041
358 Ga0207711_10000678
359 Ga0207689_10002341
360 Ga0207689_10062651
361 Ga0207651_10019023
362 Ga0207640_10045616
363 Ga0207658_10047678
364 Ga0207658_10121841
365 Ga0207677_10128073
366 Ga0207641_10000011
367 Ga0207641_10036289
368 Ga0207641_10044292
369 Ga0207648_10005145
370 Ga0207648_10006570
371 Ga0207676_10000117
372 Ga0207676_10176747
373 Ga0207675_100003433
374 Ga0207675_100036866
375 Ga0207698_10218636
376 Ga0209999_1005056
377 Ga0209983_1003701
378 Ga0209971_1000777
379 Ga0209998_10002095
380 Ga0209974_10001323
381 Ga0268266_10000003
382 Ga0307517_10031361
383 Ga0307515_10033488
384 Ga0307513_10009571
385 Ga0307513_10058473
386 Ga0307509_10064291
387 Ga0307516_10098620
388 Ga0307413_10031632
389 Ga0307413_10143358
390 Ga0307407_10004866
391 Ga0307412_10144236
392 Ga0307409_100062378
393 Ga0307409_100110355
394 Ga0307409_100121111
395 Ga0307416_100051056
396 Ga0307416_100112170
397 Ga0307414_10000107
398 Ga0307414_10101512
399 Ga0307414_10102357
400 Ga0307411_10024269
401 Ga0307411_10093282
402 Ga0307415_100024364
403 Ga0395899_0000003
404 Ga0395905_0130332
405 Ga0395905_0203151
406 Ga0237819_00487
407 Ga0237819_00749
408 Ga0237816_00725
409 Ga0495638_0000470
410 Ga0495638_0002848
411 Ga0495638_0025778
412 Ga0495583_0000002
413 Ga0495632_0003901
414 Ga0495637_0027675
415 Ga0495643_0067661
416 Ga0495654_0022497
417 Ga0495625_0000274
418 Ga0495625_0000853
419 Ga0495625_0006333
420 Ga0495625_0016321
421 Ga0495625_0023635
422 Ga0495625_0027150
423 Ga0495669_0042133
424 Ga0495670_0009167
425 Ga0495672_0023705
426 Ga0496102_0011011
427 Ga0496102_0191418
428 Ga0496109_0001726
429 Ga0496109_0053202
430 Ga0496112_0071775
431 Ga0496114_0019153
432 Ga0496114_0031011
433 Ga0496115_0000546
434 Ga0496115_0006965
435 Ga0496115_0008556
436 Ga0496115_0021459
437 Ga0496115_0023980
438 Ga0496115_0042235
439 Ga0496121_0009036
440 Ga0501032_0017249
441 Ga0501033_0039643
442 Ga0501036_0098785
443 Ga0501047_0011333
444 Ga0501080_0193259
445 Ga0501044_0023166
446 nmdc:mga09592_74428_c1
447 nmdc:mga0qj67_14233_c1
448 nmdc:mga06r32_162739_c1
449 nmdc:mga08y16_268447_c1
450 Ga0500643_002841
451 Ga0500583_0015077
452 Ga0500583_0019834
453 Ga0500651_0023475
454 Ga0500641_0007225
455 Ga0500641_0008769
456 Ga0500641_0023636
457 Ga0500562_001263
458 Ga0500562_009963
459 Ga0500642_0002148
460 Ga0500655_000851
461 Ga0500658_0001813
462 Ga0500559_0000086
463 Ga0500559_0020716
464 Ga0500568_0023065
465 Ga0500568_0027765
466 Ga0500573_0007620
467 Ga0500590_000742
468 Ga0500616_0001499
469 Ga0500616_0003196
470 Ga0500622_0010869
471 Ga0500622_0026335
472 Ga0500624_000001
473 Ga0500627_0000035
474 Ga0500627_0004787
475 Ga0500636_0009474
476 Ga0500637_0000010
477 Ga0500609_000847
478 2558910498
479 2585263186
480 2643820738
481 2643833093
482 2643884002
483 2643999978
484 2644053112
485 2644088406
486 2644343642
487 2644368880
488 2644549955
489 2852684162
490 2895882199

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

307

458

0.95

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

190

555

0.88

PF04389

Peptidase_M28

Peptidase family M28

174

335

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1q7l-assembly1.cif.gz_A zn-binding domain of the t347g mutant of human aminoacylase-i 0.8501 24 200
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.8176 26 454
4h2k-assembly1.cif.gz_A crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.809 26 454
4h2k-assembly2.cif.gz_B crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae 0.7979 32 454
4op4-assembly1.cif.gz_A crystal structure of the catalytic domain of dape protein from v.cholerea in the zn bound form 0.791 32 454
ID Description Score Start End Superfamily
af_Q55DP8_2_191_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8812 22 200 3.40.630.10
af_Q2FWN8_3_180_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8771 29 198 3.40.630.10
af_B6TIJ2_17_198_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8706 32 186 3.40.630.10
af_Q4CR09_10_160_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8701 35 189 3.40.630.10
af_Q4CYZ5_13_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8559 38 198 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A3D1V8Z4-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.904 28 221 GO:0016787
AF-A0A800JSN1-F1-model_v4 deleted 0.9025 28 186
AF-A0A520HJV3-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.8969 16 174 GO:0016787
AF-A0A520HJV3-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.8912 16 174 GO:0016787
AF-A0A3N5Y9B0-F1-model_v4 deleted 0.8874 25 212

Map