F358520

General Info

Members Datasets Scaffolds Average Seq Length
246 141 237 221

Family's Representative Sequence

Representative Sequence 3300049582|Ga0501048_0057378|Ga0501048_0057378_639_1346
Length 235
Sequence MCSPGSAEAVTVLVVTGTDTGVGKTIATAALACHARRAGLDVAVCKPVQTGIDAGDDDLAEVARLSGVRELAGFGRYPQPLAPVAAAEDAGMPLPTREQLLALIGDLDRPGRLTLVEGAGGLLVELGENGVTARDLAVGLGAAVLVVVSPSLGTLNHTALTLESIAAQNLSCAGLVIGSWPRRPGVVETTNRSALARLAAVRAALPEGAASLGTTEFASLCAQAFDRDWVTSLVA

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
5 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
6 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
7 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
64 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
65 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
72 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
79 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
107 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
108 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
109 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
136 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
137 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
138 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
139 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
140 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
141 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0
Isolates 3.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.98
Nodule 0.41
Rhizoplane 17.48
Rhizosphere 49.19
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10009839 3300002459 Bacteria 1970
2 Ga0055540_1000136 3300003792 Bacteria 73398
3 Ga0055540_1003354 3300003792 Bacteria 7777
4 Ga0055540_1009520 3300003792 Bacteria 3347
5 Ga0070683_100161340 3300005329 Bacteria 2127
6 Ga0070670_100559215 3300005331 Bacteria 1021
7 Ga0070668_100030685 3300005347 Bacteria 4088
8 Ga0070668_100122766 3300005347 Bacteria 2077
9 Ga0070671_100052678 3300005355 Bacteria 3383
10 Ga0070674_100058732 3300005356 Bacteria 2675
11 Ga0070667_100001293 3300005367 Bacteria 22631
12 Ga0070667_100005403 3300005367 Bacteria 10671
13 Ga0070667_100271503 3300005367 Bacteria 1521
14 Ga0070714_100112961 3300005435 Bacteria 2408
15 Ga0070713_100071175 3300005436 Bacteria 2938
16 Ga0070708_100615017 3300005445 Bacteria 1024
17 Ga0070678_100252992 3300005456 Bacteria 1478
18 Ga0070685_10161833 3300005466 Bacteria 1427
19 Ga0070684_100316597 3300005535 Bacteria 1433
20 Ga0068853_100020541 3300005539 Bacteria 5493
21 Ga0070686_100469413 3300005544 Bacteria 971
22 Ga0070665_100004596 3300005548 Bacteria 14442
23 Ga0068859_100142683 3300005617 Bacteria 2469
24 Ga0068859_100493294 3300005617 Bacteria 1320
25 Ga0068864_100251915 3300005618 Bacteria 1640
26 Ga0068861_100224692 3300005719 Bacteria 1589
27 Ga0068863_100083207 3300005841 Bacteria 3032
28 Ga0068863_100137295 3300005841 Bacteria 2336
29 Ga0068858_100260204 3300005842 Bacteria 1649
30 Ga0068860_100606072 3300005843 Bacteria 1101
31 Ga0075365_10006370 3300006038 Bacteria 6489
32 Ga0075365_10089916 3300006038 Bacteria 2091
33 Ga0075365_10186193 3300006038 Bacteria 1452
34 Ga0075368_10011989 3300006042 Bacteria 3163
35 Ga0075363_100000212 3300006048 Bacteria 16030
36 Ga0075363_100000793 3300006048 Bacteria 10916
37 Ga0075363_100000928 3300006048 Bacteria 10354
38 Ga0075363_100015633 3300006048 Bacteria 3734
39 Ga0075363_100062647 3300006048 Bacteria 2006
40 Ga0075364_10000234 3300006051 Bacteria 26412
41 Ga0075364_10004135 3300006051 Bacteria 8320
42 Ga0075364_10025083 3300006051 Bacteria 3793
43 Ga0075364_10037093 3300006051 Bacteria 3154
44 Ga0075364_10251641 3300006051 Bacteria 1201
45 Ga0075362_10016826 3300006177 Bacteria 3002
46 Ga0075362_10077820 3300006177 Bacteria 1525
47 Ga0075362_10223791 3300006177 Bacteria 920
48 Ga0075367_10004066 3300006178 Bacteria 7077
49 Ga0075369_10001288 3300006186 Bacteria 8528
50 Ga0075369_10004407 3300006186 Bacteria 5200
51 Ga0075369_10038610 3300006186 Bacteria 2038
52 Ga0075369_10055149 3300006186 Bacteria 1727
53 Ga0075369_10107296 3300006186 Bacteria 1257
54 Ga0075370_10003418 3300006353 Bacteria 7556
55 Ga0075370_10064815 3300006353 Bacteria 2084
56 Ga0068865_100619229 3300006881 Bacteria 917
57 Ga0097620_100142685 3300006931 Bacteria 2469
58 Ga0097620_100493280 3300006931 Bacteria 1320
59 Ga0105250_10100918 3300009092 Bacteria 1177
60 Ga0105242_10147499 3300009176 Bacteria 2048
61 Ga0105237_10000175 3300009545 Bacteria 90284
62 Ga0105237_10198227 3300009545 Bacteria 2007
63 Ga0105249_10280647 3300009553 Bacteria 1663
64 Ga0105249_10386125 3300009553 Bacteria 1427
65 Ga0105239_10003915 3300010375 Bacteria 18039
66 Ga0105239_10105382 3300010375 Bacteria 3123
67 Ga0163161_10149348 3300017792 Bacteria 1775
68 Ga0209673_1006053 3300025273 Bacteria 5945
69 Ga0209051_1000011 3300025303 Bacteria 610828
70 Ga0209051_1000559 3300025303 Bacteria 45332
71 Ga0209051_1000670 3300025303 Bacteria 38433
72 Ga0207650_10258850 3300025925 Bacteria 1411
73 Ga0207700_10667224 3300025928 Bacteria 927
74 Ga0207664_10048409 3300025929 Bacteria 3342
75 Ga0207664_10201015 3300025929 Bacteria 1720
76 Ga0207709_10289959 3300025935 Bacteria 1212
77 Ga0207669_10045203 3300025937 Bacteria 2593
78 Ga0207712_10010322 3300025961 Bacteria 5930
79 Ga0207668_10043103 3300025972 Bacteria 3059
80 Ga0207658_10001047 3300025986 Bacteria 22453
81 Ga0207658_10013462 3300025986 Bacteria 5588
82 Ga0207639_10015630 3300026041 Bacteria 5355
83 Ga0207641_10100906 3300026088 Bacteria 2542
84 Ga0207641_10438699 3300026088 Bacteria 1260
85 Ga0207676_10041611 3300026095 Bacteria 3529
86 Ga0207675_100143798 3300026118 Bacteria 2267
87 Ga0268266_10002908 3300028379 Bacteria 17732
88 Ga0268266_10106307 3300028379 Bacteria 2481
89 Ga0265327_10000081 3300031251 Bacteria 205988
90 Ga0265327_10003372 3300031251 Bacteria 15379
91 Ga0265327_10009711 3300031251 Bacteria 6892
92 Ga0265327_10046265 3300031251 Bacteria 2305
93 Ga0307413_10220234 3300031824 Bacteria 1386
94 Ga0307410_10134801 3300031852 Bacteria 1819
95 Ga0307407_10133588 3300031903 Bacteria 1591
96 Ga0307409_100136954 3300031995 Bacteria 2103
97 Ga0436363_1045148 3300039450 Bacteria 2782
98 Ga0439466_0055777 3300041411 Bacteria 1283
99 Ga0439465_0012627 3300041413 Bacteria 2641
100 Ga0451793_0167831 3300041452 Bacteria 4068
101 Ga0439442_038172 3300042002 Bacteria 1007
102 Ga0439448_0007020 3300042005 Bacteria 3252
103 Ga0466969_0158817 3300044656 Bacteria 1039
104 Ga0466972_0095838 3300044658 Bacteria 1406
105 Ga0466965_0000977 3300044683 Bacteria 11071
106 Ga0466965_0019818 3300044683 Bacteria 3230
107 Ga0466965_0074715 3300044683 Bacteria 1708
108 Ga0466965_0173571 3300044683 Bacteria 1135
109 Ga0466961_0036420 3300044693 Bacteria 3158
110 Ga0466963_0245729 3300044694 Bacteria 1255
111 Ga0466964_0074993 3300044706 Bacteria 1439
112 Ga0466964_0196173 3300044706 Bacteria 966
113 Ga0466971_0042015 3300044719 Bacteria 2054
114 Ga0466971_0247561 3300044719 Bacteria 849
115 Ga0466968_0046284 3300044735 Bacteria 1848
116 Ga0466970_0065791 3300044765 Bacteria 1945
117 Ga0466957_0004000 3300044842 Bacteria 8149
118 Ga0466957_0063515 3300044842 Bacteria 2270
119 Ga0466957_0085819 3300044842 Bacteria 1966
120 Ga0466960_0000150 3300044901 Bacteria 23737
121 Ga0466960_0020049 3300044901 Bacteria 2956
122 Ga0466960_0050762 3300044901 Bacteria 2000
123 Ga0466959_0008423 3300045049 Bacteria 7291
124 Ga0466959_0012199 3300045049 Bacteria 6201
125 Ga0466958_0044205 3300045836 Bacteria 2684
126 Ga0466958_0087677 3300045836 Bacteria 1922
127 Ga0466967_0011056 3300045976 Bacteria 6813
128 Ga0466967_0095339 3300045976 Bacteria 2711
129 Ga0466967_0183714 3300045976 Bacteria 1973
130 Ga0466967_0316867 3300045976 Bacteria 1503
131 Ga0466967_0338982 3300045976 Bacteria 1453
132 Ga0466967_0347845 3300045976 Bacteria 1434
133 Ga0466967_0495946 3300045976 Bacteria 1198
134 Ga0466967_1317364 3300045976 Bacteria 719
135 Ga0495606_0021005 3300046507 Bacteria 4793
136 Ga0495686_0005301 3300047472 Bacteria 10220
137 Ga0496100_0000041 3300048903 Bacteria 92857
138 Ga0496100_0001672 3300048903 Bacteria 11005
139 Ga0496100_0097521 3300048903 Bacteria 2019
140 Ga0496101_0000249 3300048904 Bacteria 38955
141 Ga0496101_0000703 3300048904 Bacteria 20082
142 Ga0496101_0012357 3300048904 Bacteria 5697
143 Ga0496101_0102477 3300048904 Bacteria 2144
144 Ga0496102_0003474 3300048905 Bacteria 13362
145 Ga0496102_0117781 3300048905 Bacteria 2479
146 Ga0496102_0118947 3300048905 Bacteria 2466
147 Ga0496102_0177634 3300048905 Bacteria 2005
148 Ga0496103_0000879 3300048906 Bacteria 21795
149 Ga0496103_0206216 3300048906 Bacteria 1264
150 Ga0496104_0014060 3300048907 Bacteria 7225
151 Ga0496104_0028123 3300048907 Bacteria 5210
152 Ga0496104_0052209 3300048907 Bacteria 3861
153 Ga0496104_0349779 3300048907 Bacteria 1391
154 Ga0496104_0893111 3300048907 Bacteria 794
155 Ga0496105_0006121 3300048908 Bacteria 9213
156 Ga0496105_0058718 3300048908 Bacteria 3175
157 Ga0496106_0000561 3300048909 Bacteria 26484
158 Ga0496106_0004707 3300048909 Bacteria 10110
159 Ga0496106_0018832 3300048909 Bacteria 5115
160 Ga0496107_0007655 3300048910 Bacteria 7456
161 Ga0496107_0042749 3300048910 Bacteria 3255
162 Ga0496107_0658357 3300048910 Bacteria 772
163 Ga0496108_0003812 3300048911 Bacteria 12075
164 Ga0496108_0130813 3300048911 Bacteria 2157
165 Ga0496109_0000582 3300048912 Bacteria 30519
166 Ga0496109_0071793 3300048912 Bacteria 3179
167 Ga0496109_0282528 3300048912 Bacteria 1564
168 Ga0496110_0001049 3300048913 Bacteria 19505
169 Ga0496110_0056567 3300048913 Bacteria 3452
170 Ga0496110_0391316 3300048913 Bacteria 1267
171 Ga0496111_0029399 3300048914 Bacteria 3903
172 Ga0496111_0316251 3300048914 Bacteria 1156
173 Ga0496112_0004562 3300048915 Bacteria 11771
174 Ga0496113_0040541 3300048916 Bacteria 3432
175 Ga0496114_0004930 3300048917 Bacteria 10401
176 Ga0496114_0720047 3300048917 Bacteria 874
177 Ga0496115_0016424 3300048918 Bacteria 5638
178 Ga0496115_0191010 3300048918 Bacteria 1692
179 Ga0496116_0004667 3300048919 Bacteria 12968
180 Ga0496117_0040390 3300048920 Bacteria 3431
181 Ga0496118_0009791 3300048921 Bacteria 9608
182 Ga0496119_0006416 3300048922 Bacteria 10909
183 Ga0496121_0000016 3300048924 Bacteria 562911
184 Ga0496122_0000250 3300048925 Bacteria 121043
185 Ga0496122_0087711 3300048925 Bacteria 2136
186 Ga0496123_0014352 3300048926 Bacteria 6573
187 Ga0496123_0027858 3300048926 Bacteria 4197
188 Ga0496124_0000015 3300048927 Bacteria 460700
189 Ga0496125_0000021 3300048928 Bacteria 460688
190 Ga0496126_0000015 3300048929 Bacteria 663212
191 Ga0496126_0006189 3300048929 Bacteria 13394
192 Ga0496126_0046405 3300048929 Bacteria 3985
193 Ga0496126_0324754 3300048929 Bacteria 1264
194 Ga0501032_0127336 3300049569 Bacteria 1681
195 Ga0501036_0052665 3300049572 Bacteria 3447
196 Ga0501037_0014047 3300049573 Bacteria 5899
197 Ga0501038_0059894 3300049574 Bacteria 3260
198 Ga0501043_0437442 3300049579 Bacteria 984
199 Ga0501046_0004893 3300049580 Bacteria 12064
200 Ga0501047_0012600 3300049581 Bacteria 8011
201 Ga0501047_0629793 3300049581 Bacteria 893
202 Ga0501048_0057378 3300049582 Bacteria 2761
203 Ga0501069_0024785 3300049585 Bacteria 3275
204 Ga0501070_0105683 3300049586 Bacteria 2327
205 Ga0501070_0216056 3300049586 Bacteria 1573
206 Ga0501070_0363817 3300049586 Bacteria 1173
207 Ga0501073_0130890 3300049589 Bacteria 1739
208 Ga0501080_0135100 3300049742 Bacteria 2283
209 Ga0501044_0003653 3300049823 Bacteria 17312
210 nmdc:mga03683_15342_c1 3300050489 Bacteria 1860
211 nmdc:mga03683_51365_c1 3300050489 Bacteria 1720
212 nmdc:mga03n38_133_c1 3300050490 Bacteria 16165
213 nmdc:mga03n38_155236_c1 3300050490 Bacteria 1155
214 nmdc:mga03n38_15824_c1 3300050490 Bacteria 2921
215 nmdc:mga03n38_158266_c1 3300050490 Bacteria 1145
216 nmdc:mga00v17_11301_c1 3300050491 Bacteria 4906
217 nmdc:mga00v17_173586_c1 3300050491 Bacteria 1390
218 nmdc:mga00v17_211095_c1 3300050491 Bacteria 1256
219 nmdc:mga00v17_220160_c1 3300050491 Bacteria 1229
220 nmdc:mga00v17_235906_c1 3300050491 Bacteria 1185
221 nmdc:mga00v17_2548_c1 3300050491 Bacteria 9338
222 nmdc:mga00v17_4348_c1 3300050491 Bacteria 6219
223 nmdc:mga00v17_5887_c1 3300050491 Bacteria 6476
224 nmdc:mga0yw44_123212_c1 3300050492 Bacteria 1671
225 nmdc:mga0yw44_224975_c1 3300050492 Bacteria 1244
226 nmdc:mga0yw44_4676_c1 3300050492 Bacteria 6328
227 nmdc:mga06z11_11519_c1 3300050494 Bacteria 3817
228 nmdc:mga07m45_2902_c1 3300050496 Bacteria 8125
229 nmdc:mga07m45_740_c1 3300050496 Bacteria 13945
230 nmdc:mga0sz30_2044_c1 3300050516 Bacteria 7207
231 nmdc:mga0sz30_79544_c1 3300050516 Bacteria 1418
232 nmdc:mga0sz30_99920_c1 3300050516 Bacteria 1267
233 Ga0500610_0007360 3300053079 Bacteria 4711
234 Ga0500635_0000430 3300053080 Bacteria 12188
235 Ga0500562_036647 3300053108 Bacteria 1301
236 Ga0500652_000985 3300053131 Bacteria 9378
237 Ga0466962_0188401 3300061719 Bacteria 1006

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0052209 Ga0496104_0052209_3280_3837 185
2 3300049581 Ga0501047_0629793 Ga0501047_0629793_12_719 185
3 3300053080 Ga0500635_0000430 Ga0500635_0000430_9899_10579 185
4 3300053131 Ga0500652_000985 Ga0500652_000985_5739_6419 185
5 3300048910 Ga0496107_0658357 Ga0496107_0658357_13_603 196
6 3300039450 Ga0436363_1045148 Ga0436363_1045148_1996_2676 197
7 3300045976 Ga0466967_0495946 Ga0466967_0495946_342_1022 201
8 3300031251 Ga0265327_10003372 Ga0265327_1000337210 203
9 3300031251 Ga0265327_10009711 Ga0265327_100097114 205
10 3300053108 Ga0500562_036647 Ga0500562_036647_547_1227 205
11 3300005356 Ga0070674_100058732 Ga0070674_1000587322 206
12 3300005456 Ga0070678_100252992 Ga0070678_1002529922 206
13 3300005466 Ga0070685_10161833 Ga0070685_101618332 206
14 3300005544 Ga0070686_100469413 Ga0070686_1004694132 206
15 3300005841 Ga0068863_100137295 Ga0068863_1001372952 206
16 3300006038 Ga0075365_10006370 Ga0075365_100063704 206
17 3300006048 Ga0075363_100000793 Ga0075363_1000007933 206
18 3300006051 Ga0075364_10004135 Ga0075364_100041353 206
19 3300006881 Ga0068865_100619229 Ga0068865_1006192292 206
20 3300009176 Ga0105242_10147499 Ga0105242_101474993 206
21 3300017792 Ga0163161_10149348 Ga0163161_101493482 206
22 3300025935 Ga0207709_10289959 Ga0207709_102899592 206
23 3300025937 Ga0207669_10045203 Ga0207669_100452032 206
24 3300026088 Ga0207641_10438699 Ga0207641_104386992 206
25 3300028379 Ga0268266_10106307 Ga0268266_101063072 206
26 3300048903 Ga0496100_0001672 Ga0496100_0001672_5021_5701 206
27 3300048904 Ga0496101_0000703 Ga0496101_0000703_14201_14881 206
28 3300048905 Ga0496102_0117781 Ga0496102_0117781_266_946 206
29 3300048907 Ga0496104_0014060 Ga0496104_0014060_3643_4323 206
30 3300048908 Ga0496105_0006121 Ga0496105_0006121_4492_5172 206
31 3300048909 Ga0496106_0004707 Ga0496106_0004707_7241_7921 206
32 3300048917 Ga0496114_0004930 Ga0496114_0004930_1049_1729 206
33 3300048918 Ga0496115_0016424 Ga0496115_0016424_4733_5413 206
34 3300050490 nmdc:mga03n38_155236_c1 nmdc:mga03n38_155236_c1_369_1037 206
35 3300050491 nmdc:mga00v17_4348_c1 nmdc:mga00v17_4348_c1_301_969 206
36 3300050492 nmdc:mga0yw44_4676_c1 nmdc:mga0yw44_4676_c1_3528_4196 206
37 3300031824 Ga0307413_10220234 Ga0307413_102202342 207
38 3300031995 Ga0307409_100136954 Ga0307409_1001369543 207
39 3300048929 Ga0496126_0046405 Ga0496126_0046405_1334_2014 207
40 3300003792 Ga0055540_1003354 Ga0055540_10033545 208
41 3300006051 Ga0075364_10251641 Ga0075364_102516412 208
42 3300006186 Ga0075369_10004407 Ga0075369_100044076 208
43 3300025273 Ga0209673_1006053 Ga0209673_10060532 208
44 3300050491 nmdc:mga00v17_235906_c1 nmdc:mga00v17_235906_c1_327_1001 208
45 3300050492 nmdc:mga0yw44_123212_c1 nmdc:mga0yw44_123212_c1_976_1650 208
46 iso_pu_bacteria 8057568493 8057573437 208
47 3300046507 Ga0495606_0021005 Ga0495606_0021005_432_1109 209
48 3300005347 Ga0070668_100030685 Ga0070668_1000306852 210
49 3300005617 Ga0068859_100142683 Ga0068859_1001426833 210
50 3300006931 Ga0097620_100142685 Ga0097620_1001426853 210
51 3300025972 Ga0207668_10043103 Ga0207668_100431035 210
52 3300048904 Ga0496101_0012357 Ga0496101_0012357_603_1283 210
53 3300048905 Ga0496102_0177634 Ga0496102_0177634_562_1242 210
54 3300048907 Ga0496104_0349779 Ga0496104_0349779_429_1109 210
55 3300048909 Ga0496106_0018832 Ga0496106_0018832_1839_2519 210
56 3300048910 Ga0496107_0042749 Ga0496107_0042749_1727_2407 210
57 3300048917 Ga0496114_0720047 Ga0496114_0720047_36_716 210
58 3300049586 Ga0501070_0216056 Ga0501070_0216056_420_1100 210
59 3300031251 Ga0265327_10000081 Ga0265327_1000008189 213
60 iso_pu_bacteria 2643221687 2644485940 217
61 iso_pu_bacteria 2902837492 2902840713 217
62 iso_pu_bacteria 2842134933 2842137689 218
63 iso_pu_bacteria 2939582691 2939588184 218
64 iso_pu_bacteria 2738541264 2738665134 219
65 iso_pu_bacteria 2738541356 2739144268 219
66 iso_pu_bacteria 2902792274 2902795907 219
67 iso_pu_bacteria 2929212328 2929215506 219
68 3300044683 Ga0466965_0000977 Ga0466965_0000977_5476_6177 220
69 3300044706 Ga0466964_0196173 Ga0466964_0196173_40_741 220
70 3300044842 Ga0466957_0004000 Ga0466957_0004000_1948_2649 220
71 3300045049 Ga0466959_0008423 Ga0466959_0008423_4701_5402 220
72 3300045836 Ga0466958_0087677 Ga0466958_0087677_78_779 220
73 3300045976 Ga0466967_0011056 Ga0466967_0011056_2257_2958 220
74 3300048918 Ga0496115_0191010 Ga0496115_0191010_32_703 220
75 3300048925 Ga0496122_0087711 Ga0496122_0087711_514_1185 220
76 3300048926 Ga0496123_0027858 Ga0496123_0027858_2880_3551 220
77 3300048929 Ga0496126_0006189 Ga0496126_0006189_8374_9045 220
78 3300003792 Ga0055540_1009520 Ga0055540_10095202 221
79 3300005539 Ga0068853_100020541 Ga0068853_1000205414 221
80 3300025303 Ga0209051_1000559 Ga0209051_100055928 221
81 3300025303 Ga0209051_1000670 Ga0209051_100067012 221
82 3300026041 Ga0207639_10015630 Ga0207639_100156303 221
83 3300041452 Ga0451793_0167831 Ga0451793_0167831_558_1232 221
84 3300044901 Ga0466960_0000150 Ga0466960_0000150_11967_12641 221
85 3300044901 Ga0466960_0020049 Ga0466960_0020049_447_1112 221
86 3300047472 Ga0495686_0005301 Ga0495686_0005301_6023_6697 221
87 3300006038 Ga0075365_10186193 Ga0075365_101861932 222
88 3300006048 Ga0075363_100000212 Ga0075363_1000002126 222
89 3300006048 Ga0075363_100015633 Ga0075363_1000156335 222
90 3300006048 Ga0075363_100062647 Ga0075363_1000626473 222
91 3300006051 Ga0075364_10000234 Ga0075364_100002349 222
92 3300006051 Ga0075364_10037093 Ga0075364_100370932 222
93 3300006177 Ga0075362_10016826 Ga0075362_100168263 222
94 3300006177 Ga0075362_10077820 Ga0075362_100778203 222
95 3300006177 Ga0075362_10223791 Ga0075362_102237912 222
96 3300006186 Ga0075369_10001288 Ga0075369_100012882 222
97 3300006186 Ga0075369_10038610 Ga0075369_100386102 222
98 3300006186 Ga0075369_10055149 Ga0075369_100551492 222
99 3300006353 Ga0075370_10003418 Ga0075370_100034182 222
100 3300031852 Ga0307410_10134801 Ga0307410_101348013 222
101 3300041411 Ga0439466_0055777 Ga0439466_0055777_270_938 222
102 3300041413 Ga0439465_0012627 Ga0439465_0012627_508_1176 222
103 3300042002 Ga0439442_038172 Ga0439442_038172_39_707 222
104 3300044658 Ga0466972_0095838 Ga0466972_0095838_327_995 222
105 3300044842 Ga0466957_0063515 Ga0466957_0063515_811_1479 222
106 3300045976 Ga0466967_0316867 Ga0466967_0316867_784_1452 222
107 3300045976 Ga0466967_1317364 Ga0466967_1317364_38_706 222
108 3300048929 Ga0496126_0324754 Ga0496126_0324754_333_1010 222
109 3300049586 Ga0501070_0363817 Ga0501070_0363817_488_1156 222
110 3300050489 nmdc:mga03683_15342_c1 nmdc:mga03683_15342_c1_455_1123 222
111 3300050490 nmdc:mga03n38_133_c1 nmdc:mga03n38_133_c1_5568_6236 222
112 3300050490 nmdc:mga03n38_158266_c1 nmdc:mga03n38_158266_c1_128_796 222
113 3300050491 nmdc:mga00v17_11301_c1 nmdc:mga00v17_11301_c1_3765_4433 222
114 3300050491 nmdc:mga00v17_173586_c1 nmdc:mga00v17_173586_c1_266_943 222
115 3300050491 nmdc:mga00v17_211095_c1 nmdc:mga00v17_211095_c1_186_863 222
116 3300050491 nmdc:mga00v17_220160_c1 nmdc:mga00v17_220160_c1_411_1088 222
117 3300050491 nmdc:mga00v17_2548_c1 nmdc:mga00v17_2548_c1_7487_8155 222
118 3300050492 nmdc:mga0yw44_224975_c1 nmdc:mga0yw44_224975_c1_172_849 222
119 3300050496 nmdc:mga07m45_740_c1 nmdc:mga07m45_740_c1_7685_8353 222
120 3300050516 nmdc:mga0sz30_2044_c1 nmdc:mga0sz30_2044_c1_2962_3630 222
121 3300050516 nmdc:mga0sz30_79544_c1 nmdc:mga0sz30_79544_c1_257_934 222
122 3300002459 JGI24751J29686_10009839 JGI24751J29686_100098392 223
123 3300003792 Ga0055540_1000136 Ga0055540_100013642 223
124 3300005329 Ga0070683_100161340 Ga0070683_1001613402 223
125 3300005331 Ga0070670_100559215 Ga0070670_1005592152 223
126 3300005347 Ga0070668_100122766 Ga0070668_1001227662 223
127 3300005355 Ga0070671_100052678 Ga0070671_1000526782 223
128 3300005367 Ga0070667_100001293 Ga0070667_1000012935 223
129 3300005367 Ga0070667_100005403 Ga0070667_1000054032 223
130 3300005367 Ga0070667_100271503 Ga0070667_1002715032 223
131 3300005435 Ga0070714_100112961 Ga0070714_1001129612 223
132 3300005436 Ga0070713_100071175 Ga0070713_1000711752 223
133 3300005445 Ga0070708_100615017 Ga0070708_1006150171 223
134 3300005535 Ga0070684_100316597 Ga0070684_1003165972 223
135 3300005548 Ga0070665_100004596 Ga0070665_1000045966 223
136 3300005617 Ga0068859_100493294 Ga0068859_1004932942 223
137 3300005618 Ga0068864_100251915 Ga0068864_1002519152 223
138 3300005719 Ga0068861_100224692 Ga0068861_1002246922 223
139 3300005841 Ga0068863_100083207 Ga0068863_1000832072 223
140 3300005842 Ga0068858_100260204 Ga0068858_1002602041 223
141 3300005843 Ga0068860_100606072 Ga0068860_1006060722 223
142 3300006038 Ga0075365_10089916 Ga0075365_100899162 223
143 3300006042 Ga0075368_10011989 Ga0075368_100119892 223
144 3300006048 Ga0075363_100000928 Ga0075363_1000009283 223
145 3300006051 Ga0075364_10025083 Ga0075364_100250833 223
146 3300006178 Ga0075367_10004066 Ga0075367_100040663 223
147 3300006186 Ga0075369_10107296 Ga0075369_101072961 223
148 3300006353 Ga0075370_10064815 Ga0075370_100648152 223
149 3300006931 Ga0097620_100493280 Ga0097620_1004932802 223
150 3300009092 Ga0105250_10100918 Ga0105250_101009181 223
151 3300009545 Ga0105237_10000175 Ga0105237_100001757 223
152 3300009545 Ga0105237_10198227 Ga0105237_101982272 223
153 3300009553 Ga0105249_10280647 Ga0105249_102806472 223
154 3300009553 Ga0105249_10386125 Ga0105249_103861252 223
155 3300010375 Ga0105239_10003915 Ga0105239_1000391514 223
156 3300010375 Ga0105239_10105382 Ga0105239_101053822 223
157 3300025303 Ga0209051_1000011 Ga0209051_1000011149 223
158 3300025925 Ga0207650_10258850 Ga0207650_102588502 223
159 3300025928 Ga0207700_10667224 Ga0207700_106672242 223
160 3300025929 Ga0207664_10048409 Ga0207664_100484092 223
161 3300025929 Ga0207664_10201015 Ga0207664_102010152 223
162 3300025961 Ga0207712_10010322 Ga0207712_100103222 223
163 3300025986 Ga0207658_10001047 Ga0207658_1000104716 223
164 3300025986 Ga0207658_10013462 Ga0207658_100134622 223
165 3300026088 Ga0207641_10100906 Ga0207641_101009063 223
166 3300026095 Ga0207676_10041611 Ga0207676_100416113 223
167 3300026118 Ga0207675_100143798 Ga0207675_1001437984 223
168 3300028379 Ga0268266_10002908 Ga0268266_1000290816 223
169 3300031251 Ga0265327_10046265 Ga0265327_100462654 223
170 3300031903 Ga0307407_10133588 Ga0307407_101335882 223
171 3300042005 Ga0439448_0007020 Ga0439448_0007020_282_974 223
172 3300044656 Ga0466969_0158817 Ga0466969_0158817_50_721 223
173 3300044683 Ga0466965_0019818 Ga0466965_0019818_1411_2103 223
174 3300044683 Ga0466965_0074715 Ga0466965_0074715_635_1306 223
175 3300044683 Ga0466965_0173571 Ga0466965_0173571_198_878 223
176 3300044693 Ga0466961_0036420 Ga0466961_0036420_1206_1877 223
177 3300044694 Ga0466963_0245729 Ga0466963_0245729_367_1047 223
178 3300044706 Ga0466964_0074993 Ga0466964_0074993_355_1026 223
179 3300044719 Ga0466971_0042015 Ga0466971_0042015_858_1538 223
180 3300044719 Ga0466971_0247561 Ga0466971_0247561_144_815 223
181 3300044735 Ga0466968_0046284 Ga0466968_0046284_529_1200 223
182 3300044765 Ga0466970_0065791 Ga0466970_0065791_472_1143 223
183 3300044842 Ga0466957_0085819 Ga0466957_0085819_781_1461 223
184 3300044901 Ga0466960_0050762 Ga0466960_0050762_1076_1756 223
185 3300045049 Ga0466959_0012199 Ga0466959_0012199_4168_4839 223
186 3300045836 Ga0466958_0044205 Ga0466958_0044205_1695_2366 223
187 3300045976 Ga0466967_0095339 Ga0466967_0095339_491_1171 223
188 3300045976 Ga0466967_0183714 Ga0466967_0183714_1262_1948 223
189 3300045976 Ga0466967_0338982 Ga0466967_0338982_651_1322 223
190 3300045976 Ga0466967_0347845 Ga0466967_0347845_579_1250 223
191 3300048903 Ga0496100_0000041 Ga0496100_0000041_18106_18798 223
192 3300048903 Ga0496100_0097521 Ga0496100_0097521_822_1493 223
193 3300048904 Ga0496101_0000249 Ga0496101_0000249_19204_19896 223
194 3300048904 Ga0496101_0102477 Ga0496101_0102477_727_1398 223
195 3300048905 Ga0496102_0003474 Ga0496102_0003474_1841_2512 223
196 3300048905 Ga0496102_0118947 Ga0496102_0118947_746_1438 223
197 3300048906 Ga0496103_0000879 Ga0496103_0000879_57_749 223
198 3300048906 Ga0496103_0206216 Ga0496103_0206216_461_1132 223
199 3300048907 Ga0496104_0028123 Ga0496104_0028123_2098_2769 223
200 3300048907 Ga0496104_0893111 Ga0496104_0893111_110_784 223
201 3300048908 Ga0496105_0058718 Ga0496105_0058718_2007_2678 223
202 3300048909 Ga0496106_0000561 Ga0496106_0000561_11884_12576 223
203 3300048910 Ga0496107_0007655 Ga0496107_0007655_2391_3083 223
204 3300048911 Ga0496108_0003812 Ga0496108_0003812_5347_6039 223
205 3300048911 Ga0496108_0130813 Ga0496108_0130813_163_834 223
206 3300048912 Ga0496109_0000582 Ga0496109_0000582_6710_7402 223
207 3300048912 Ga0496109_0071793 Ga0496109_0071793_2055_2726 223
208 3300048912 Ga0496109_0282528 Ga0496109_0282528_567_1238 223
209 3300048913 Ga0496110_0001049 Ga0496110_0001049_7639_8331 223
210 3300048913 Ga0496110_0056567 Ga0496110_0056567_1516_2187 223
211 3300048913 Ga0496110_0391316 Ga0496110_0391316_359_1030 223
212 3300048914 Ga0496111_0029399 Ga0496111_0029399_2463_3155 223
213 3300048914 Ga0496111_0316251 Ga0496111_0316251_27_698 223
214 3300048915 Ga0496112_0004562 Ga0496112_0004562_2450_3121 223
215 3300048916 Ga0496113_0040541 Ga0496113_0040541_2424_3116 223
216 3300048919 Ga0496116_0004667 Ga0496116_0004667_7639_8331 223
217 3300048920 Ga0496117_0040390 Ga0496117_0040390_1544_2236 223
218 3300048921 Ga0496118_0009791 Ga0496118_0009791_957_1649 223
219 3300048922 Ga0496119_0006416 Ga0496119_0006416_6958_7650 223
220 3300048924 Ga0496121_0000016 Ga0496121_0000016_80815_81507 223
221 3300048925 Ga0496122_0000250 Ga0496122_0000250_6238_6930 223
222 3300048926 Ga0496123_0014352 Ga0496123_0014352_5538_6230 223
223 3300048927 Ga0496124_0000015 Ga0496124_0000015_296883_297575 223
224 3300048928 Ga0496125_0000021 Ga0496125_0000021_163126_163818 223
225 3300048929 Ga0496126_0000015 Ga0496126_0000015_163126_163818 223
226 3300049569 Ga0501032_0127336 Ga0501032_0127336_565_1245 223
227 3300049572 Ga0501036_0052665 Ga0501036_0052665_592_1272 223
228 3300049573 Ga0501037_0014047 Ga0501037_0014047_563_1243 223
229 3300049574 Ga0501038_0059894 Ga0501038_0059894_748_1428 223
230 3300049579 Ga0501043_0437442 Ga0501043_0437442_38_718 223
231 3300049580 Ga0501046_0004893 Ga0501046_0004893_9112_9792 223
232 3300049581 Ga0501047_0012600 Ga0501047_0012600_7051_7731 223
233 3300049582 Ga0501048_0057378 Ga0501048_0057378_639_1346 223
234 3300049585 Ga0501069_0024785 Ga0501069_0024785_1373_2053 223
235 3300049586 Ga0501070_0105683 Ga0501070_0105683_418_1098 223
236 3300049589 Ga0501073_0130890 Ga0501073_0130890_406_1086 223
237 3300049742 Ga0501080_0135100 Ga0501080_0135100_49_729 223
238 3300049823 Ga0501044_0003653 Ga0501044_0003653_5121_5801 223
239 3300050489 nmdc:mga03683_51365_c1 nmdc:mga03683_51365_c1_754_1440 223
240 3300050490 nmdc:mga03n38_15824_c1 nmdc:mga03n38_15824_c1_263_949 223
241 3300050491 nmdc:mga00v17_5887_c1 nmdc:mga00v17_5887_c1_1718_2404 223
242 3300050494 nmdc:mga06z11_11519_c1 nmdc:mga06z11_11519_c1_1053_1739 223
243 3300050496 nmdc:mga07m45_2902_c1 nmdc:mga07m45_2902_c1_1573_2259 223
244 3300050516 nmdc:mga0sz30_99920_c1 nmdc:mga0sz30_99920_c1_555_1241 223
245 3300053079 Ga0500610_0007360 Ga0500610_0007360_2408_3088 223
246 3300061719 Ga0466962_0188401 Ga0466962_0188401_183_863 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13500

AAA_26

AAA domain

11

207

0.85

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

13

196

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9836 2 223
6e06-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) 0.9817 2 221
3fmf-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9759 2 221
3fmf-assembly2.cif.gz_C crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9749 2 223
3fmf-assembly2.cif.gz_D crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate 0.9672 2 221
ID Description Score Start End Superfamily
3fmfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9759 2 221 3.40.50.300
3fmfB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9587 2 221 3.40.50.300
af_Q2FVJ5_2_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8604 4 194 3.40.50.300
af_Q58695_1_213_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8424 4 193 3.40.50.300
af_A0A1D8PS31_1_209_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8133 1 209 3.40.50.300
ID Description Score Start End GO Terms
AF-X8B3J5-F1-model_v4 deleted 0.9895 82 196
AF-P45486-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.989 1 223 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A1B9D8C7-F1-model_v4 Dethiobiotin synthase 0.9887 46 223 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-A0A5A7ZK01-F1-model_v4 ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) 0.9872 1 221 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102
AF-D5P2S2-F1-model_v4 Putative dethiobiotin synthase (EC 6.3.3.3) 0.9863 66 223 GO:0000287
GO:0004141
GO:0005524
GO:0005829
GO:0009102

Feature Viewer

pLDDT pTM Quality
95.81 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map