F358520
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 141 | 237 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300049582|Ga0501048_0057378|Ga0501048_0057378_639_1346 |
| Length | 235 |
| Sequence | MCSPGSAEAVTVLVVTGTDTGVGKTIATAALACHARRAGLDVAVCKPVQTGIDAGDDDLAEVARLSGVRELAGFGRYPQPLAPVAAAEDAGMPLPTREQLLALIGDLDRPGRLTLVEGAGGLLVELGENGVTARDLAVGLGAAVLVVVSPSLGTLNHTALTLESIAAQNLSCAGLVIGSWPRRPGVVETTNRSALARLAAVRAALPEGAASLGTTEFASLCAQAFDRDWVTSLVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 3 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 4 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 5 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 6 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 7 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 8 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 33 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 38 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 41 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 49 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 64 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 65 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 66 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 67 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 68 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 69 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 70 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 71 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 72 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 73 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 74 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 75 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 76 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 77 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 78 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 79 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 80 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 81 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 82 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 83 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 84 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 85 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 86 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 87 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 88 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 91 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 92 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 93 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 94 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 95 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 96 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 97 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 98 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 101 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 102 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 103 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 104 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 105 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 106 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 107 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 108 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 109 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 110 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 111 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 112 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 113 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 114 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 115 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 116 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 117 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 127 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 130 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 131 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 132 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 133 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 134 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 135 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 136 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 137 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 138 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 139 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 140 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 141 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.34 |
| Metatranscriptomes | 0 |
| Isolates | 3.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.98 |
| Nodule | 0.41 |
| Rhizoplane | 17.48 |
| Rhizosphere | 49.19 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10009839 | 3300002459 | Bacteria | 1970 |
| 2 | Ga0055540_1000136 | 3300003792 | Bacteria | 73398 |
| 3 | Ga0055540_1003354 | 3300003792 | Bacteria | 7777 |
| 4 | Ga0055540_1009520 | 3300003792 | Bacteria | 3347 |
| 5 | Ga0070683_100161340 | 3300005329 | Bacteria | 2127 |
| 6 | Ga0070670_100559215 | 3300005331 | Bacteria | 1021 |
| 7 | Ga0070668_100030685 | 3300005347 | Bacteria | 4088 |
| 8 | Ga0070668_100122766 | 3300005347 | Bacteria | 2077 |
| 9 | Ga0070671_100052678 | 3300005355 | Bacteria | 3383 |
| 10 | Ga0070674_100058732 | 3300005356 | Bacteria | 2675 |
| 11 | Ga0070667_100001293 | 3300005367 | Bacteria | 22631 |
| 12 | Ga0070667_100005403 | 3300005367 | Bacteria | 10671 |
| 13 | Ga0070667_100271503 | 3300005367 | Bacteria | 1521 |
| 14 | Ga0070714_100112961 | 3300005435 | Bacteria | 2408 |
| 15 | Ga0070713_100071175 | 3300005436 | Bacteria | 2938 |
| 16 | Ga0070708_100615017 | 3300005445 | Bacteria | 1024 |
| 17 | Ga0070678_100252992 | 3300005456 | Bacteria | 1478 |
| 18 | Ga0070685_10161833 | 3300005466 | Bacteria | 1427 |
| 19 | Ga0070684_100316597 | 3300005535 | Bacteria | 1433 |
| 20 | Ga0068853_100020541 | 3300005539 | Bacteria | 5493 |
| 21 | Ga0070686_100469413 | 3300005544 | Bacteria | 971 |
| 22 | Ga0070665_100004596 | 3300005548 | Bacteria | 14442 |
| 23 | Ga0068859_100142683 | 3300005617 | Bacteria | 2469 |
| 24 | Ga0068859_100493294 | 3300005617 | Bacteria | 1320 |
| 25 | Ga0068864_100251915 | 3300005618 | Bacteria | 1640 |
| 26 | Ga0068861_100224692 | 3300005719 | Bacteria | 1589 |
| 27 | Ga0068863_100083207 | 3300005841 | Bacteria | 3032 |
| 28 | Ga0068863_100137295 | 3300005841 | Bacteria | 2336 |
| 29 | Ga0068858_100260204 | 3300005842 | Bacteria | 1649 |
| 30 | Ga0068860_100606072 | 3300005843 | Bacteria | 1101 |
| 31 | Ga0075365_10006370 | 3300006038 | Bacteria | 6489 |
| 32 | Ga0075365_10089916 | 3300006038 | Bacteria | 2091 |
| 33 | Ga0075365_10186193 | 3300006038 | Bacteria | 1452 |
| 34 | Ga0075368_10011989 | 3300006042 | Bacteria | 3163 |
| 35 | Ga0075363_100000212 | 3300006048 | Bacteria | 16030 |
| 36 | Ga0075363_100000793 | 3300006048 | Bacteria | 10916 |
| 37 | Ga0075363_100000928 | 3300006048 | Bacteria | 10354 |
| 38 | Ga0075363_100015633 | 3300006048 | Bacteria | 3734 |
| 39 | Ga0075363_100062647 | 3300006048 | Bacteria | 2006 |
| 40 | Ga0075364_10000234 | 3300006051 | Bacteria | 26412 |
| 41 | Ga0075364_10004135 | 3300006051 | Bacteria | 8320 |
| 42 | Ga0075364_10025083 | 3300006051 | Bacteria | 3793 |
| 43 | Ga0075364_10037093 | 3300006051 | Bacteria | 3154 |
| 44 | Ga0075364_10251641 | 3300006051 | Bacteria | 1201 |
| 45 | Ga0075362_10016826 | 3300006177 | Bacteria | 3002 |
| 46 | Ga0075362_10077820 | 3300006177 | Bacteria | 1525 |
| 47 | Ga0075362_10223791 | 3300006177 | Bacteria | 920 |
| 48 | Ga0075367_10004066 | 3300006178 | Bacteria | 7077 |
| 49 | Ga0075369_10001288 | 3300006186 | Bacteria | 8528 |
| 50 | Ga0075369_10004407 | 3300006186 | Bacteria | 5200 |
| 51 | Ga0075369_10038610 | 3300006186 | Bacteria | 2038 |
| 52 | Ga0075369_10055149 | 3300006186 | Bacteria | 1727 |
| 53 | Ga0075369_10107296 | 3300006186 | Bacteria | 1257 |
| 54 | Ga0075370_10003418 | 3300006353 | Bacteria | 7556 |
| 55 | Ga0075370_10064815 | 3300006353 | Bacteria | 2084 |
| 56 | Ga0068865_100619229 | 3300006881 | Bacteria | 917 |
| 57 | Ga0097620_100142685 | 3300006931 | Bacteria | 2469 |
| 58 | Ga0097620_100493280 | 3300006931 | Bacteria | 1320 |
| 59 | Ga0105250_10100918 | 3300009092 | Bacteria | 1177 |
| 60 | Ga0105242_10147499 | 3300009176 | Bacteria | 2048 |
| 61 | Ga0105237_10000175 | 3300009545 | Bacteria | 90284 |
| 62 | Ga0105237_10198227 | 3300009545 | Bacteria | 2007 |
| 63 | Ga0105249_10280647 | 3300009553 | Bacteria | 1663 |
| 64 | Ga0105249_10386125 | 3300009553 | Bacteria | 1427 |
| 65 | Ga0105239_10003915 | 3300010375 | Bacteria | 18039 |
| 66 | Ga0105239_10105382 | 3300010375 | Bacteria | 3123 |
| 67 | Ga0163161_10149348 | 3300017792 | Bacteria | 1775 |
| 68 | Ga0209673_1006053 | 3300025273 | Bacteria | 5945 |
| 69 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 70 | Ga0209051_1000559 | 3300025303 | Bacteria | 45332 |
| 71 | Ga0209051_1000670 | 3300025303 | Bacteria | 38433 |
| 72 | Ga0207650_10258850 | 3300025925 | Bacteria | 1411 |
| 73 | Ga0207700_10667224 | 3300025928 | Bacteria | 927 |
| 74 | Ga0207664_10048409 | 3300025929 | Bacteria | 3342 |
| 75 | Ga0207664_10201015 | 3300025929 | Bacteria | 1720 |
| 76 | Ga0207709_10289959 | 3300025935 | Bacteria | 1212 |
| 77 | Ga0207669_10045203 | 3300025937 | Bacteria | 2593 |
| 78 | Ga0207712_10010322 | 3300025961 | Bacteria | 5930 |
| 79 | Ga0207668_10043103 | 3300025972 | Bacteria | 3059 |
| 80 | Ga0207658_10001047 | 3300025986 | Bacteria | 22453 |
| 81 | Ga0207658_10013462 | 3300025986 | Bacteria | 5588 |
| 82 | Ga0207639_10015630 | 3300026041 | Bacteria | 5355 |
| 83 | Ga0207641_10100906 | 3300026088 | Bacteria | 2542 |
| 84 | Ga0207641_10438699 | 3300026088 | Bacteria | 1260 |
| 85 | Ga0207676_10041611 | 3300026095 | Bacteria | 3529 |
| 86 | Ga0207675_100143798 | 3300026118 | Bacteria | 2267 |
| 87 | Ga0268266_10002908 | 3300028379 | Bacteria | 17732 |
| 88 | Ga0268266_10106307 | 3300028379 | Bacteria | 2481 |
| 89 | Ga0265327_10000081 | 3300031251 | Bacteria | 205988 |
| 90 | Ga0265327_10003372 | 3300031251 | Bacteria | 15379 |
| 91 | Ga0265327_10009711 | 3300031251 | Bacteria | 6892 |
| 92 | Ga0265327_10046265 | 3300031251 | Bacteria | 2305 |
| 93 | Ga0307413_10220234 | 3300031824 | Bacteria | 1386 |
| 94 | Ga0307410_10134801 | 3300031852 | Bacteria | 1819 |
| 95 | Ga0307407_10133588 | 3300031903 | Bacteria | 1591 |
| 96 | Ga0307409_100136954 | 3300031995 | Bacteria | 2103 |
| 97 | Ga0436363_1045148 | 3300039450 | Bacteria | 2782 |
| 98 | Ga0439466_0055777 | 3300041411 | Bacteria | 1283 |
| 99 | Ga0439465_0012627 | 3300041413 | Bacteria | 2641 |
| 100 | Ga0451793_0167831 | 3300041452 | Bacteria | 4068 |
| 101 | Ga0439442_038172 | 3300042002 | Bacteria | 1007 |
| 102 | Ga0439448_0007020 | 3300042005 | Bacteria | 3252 |
| 103 | Ga0466969_0158817 | 3300044656 | Bacteria | 1039 |
| 104 | Ga0466972_0095838 | 3300044658 | Bacteria | 1406 |
| 105 | Ga0466965_0000977 | 3300044683 | Bacteria | 11071 |
| 106 | Ga0466965_0019818 | 3300044683 | Bacteria | 3230 |
| 107 | Ga0466965_0074715 | 3300044683 | Bacteria | 1708 |
| 108 | Ga0466965_0173571 | 3300044683 | Bacteria | 1135 |
| 109 | Ga0466961_0036420 | 3300044693 | Bacteria | 3158 |
| 110 | Ga0466963_0245729 | 3300044694 | Bacteria | 1255 |
| 111 | Ga0466964_0074993 | 3300044706 | Bacteria | 1439 |
| 112 | Ga0466964_0196173 | 3300044706 | Bacteria | 966 |
| 113 | Ga0466971_0042015 | 3300044719 | Bacteria | 2054 |
| 114 | Ga0466971_0247561 | 3300044719 | Bacteria | 849 |
| 115 | Ga0466968_0046284 | 3300044735 | Bacteria | 1848 |
| 116 | Ga0466970_0065791 | 3300044765 | Bacteria | 1945 |
| 117 | Ga0466957_0004000 | 3300044842 | Bacteria | 8149 |
| 118 | Ga0466957_0063515 | 3300044842 | Bacteria | 2270 |
| 119 | Ga0466957_0085819 | 3300044842 | Bacteria | 1966 |
| 120 | Ga0466960_0000150 | 3300044901 | Bacteria | 23737 |
| 121 | Ga0466960_0020049 | 3300044901 | Bacteria | 2956 |
| 122 | Ga0466960_0050762 | 3300044901 | Bacteria | 2000 |
| 123 | Ga0466959_0008423 | 3300045049 | Bacteria | 7291 |
| 124 | Ga0466959_0012199 | 3300045049 | Bacteria | 6201 |
| 125 | Ga0466958_0044205 | 3300045836 | Bacteria | 2684 |
| 126 | Ga0466958_0087677 | 3300045836 | Bacteria | 1922 |
| 127 | Ga0466967_0011056 | 3300045976 | Bacteria | 6813 |
| 128 | Ga0466967_0095339 | 3300045976 | Bacteria | 2711 |
| 129 | Ga0466967_0183714 | 3300045976 | Bacteria | 1973 |
| 130 | Ga0466967_0316867 | 3300045976 | Bacteria | 1503 |
| 131 | Ga0466967_0338982 | 3300045976 | Bacteria | 1453 |
| 132 | Ga0466967_0347845 | 3300045976 | Bacteria | 1434 |
| 133 | Ga0466967_0495946 | 3300045976 | Bacteria | 1198 |
| 134 | Ga0466967_1317364 | 3300045976 | Bacteria | 719 |
| 135 | Ga0495606_0021005 | 3300046507 | Bacteria | 4793 |
| 136 | Ga0495686_0005301 | 3300047472 | Bacteria | 10220 |
| 137 | Ga0496100_0000041 | 3300048903 | Bacteria | 92857 |
| 138 | Ga0496100_0001672 | 3300048903 | Bacteria | 11005 |
| 139 | Ga0496100_0097521 | 3300048903 | Bacteria | 2019 |
| 140 | Ga0496101_0000249 | 3300048904 | Bacteria | 38955 |
| 141 | Ga0496101_0000703 | 3300048904 | Bacteria | 20082 |
| 142 | Ga0496101_0012357 | 3300048904 | Bacteria | 5697 |
| 143 | Ga0496101_0102477 | 3300048904 | Bacteria | 2144 |
| 144 | Ga0496102_0003474 | 3300048905 | Bacteria | 13362 |
| 145 | Ga0496102_0117781 | 3300048905 | Bacteria | 2479 |
| 146 | Ga0496102_0118947 | 3300048905 | Bacteria | 2466 |
| 147 | Ga0496102_0177634 | 3300048905 | Bacteria | 2005 |
| 148 | Ga0496103_0000879 | 3300048906 | Bacteria | 21795 |
| 149 | Ga0496103_0206216 | 3300048906 | Bacteria | 1264 |
| 150 | Ga0496104_0014060 | 3300048907 | Bacteria | 7225 |
| 151 | Ga0496104_0028123 | 3300048907 | Bacteria | 5210 |
| 152 | Ga0496104_0052209 | 3300048907 | Bacteria | 3861 |
| 153 | Ga0496104_0349779 | 3300048907 | Bacteria | 1391 |
| 154 | Ga0496104_0893111 | 3300048907 | Bacteria | 794 |
| 155 | Ga0496105_0006121 | 3300048908 | Bacteria | 9213 |
| 156 | Ga0496105_0058718 | 3300048908 | Bacteria | 3175 |
| 157 | Ga0496106_0000561 | 3300048909 | Bacteria | 26484 |
| 158 | Ga0496106_0004707 | 3300048909 | Bacteria | 10110 |
| 159 | Ga0496106_0018832 | 3300048909 | Bacteria | 5115 |
| 160 | Ga0496107_0007655 | 3300048910 | Bacteria | 7456 |
| 161 | Ga0496107_0042749 | 3300048910 | Bacteria | 3255 |
| 162 | Ga0496107_0658357 | 3300048910 | Bacteria | 772 |
| 163 | Ga0496108_0003812 | 3300048911 | Bacteria | 12075 |
| 164 | Ga0496108_0130813 | 3300048911 | Bacteria | 2157 |
| 165 | Ga0496109_0000582 | 3300048912 | Bacteria | 30519 |
| 166 | Ga0496109_0071793 | 3300048912 | Bacteria | 3179 |
| 167 | Ga0496109_0282528 | 3300048912 | Bacteria | 1564 |
| 168 | Ga0496110_0001049 | 3300048913 | Bacteria | 19505 |
| 169 | Ga0496110_0056567 | 3300048913 | Bacteria | 3452 |
| 170 | Ga0496110_0391316 | 3300048913 | Bacteria | 1267 |
| 171 | Ga0496111_0029399 | 3300048914 | Bacteria | 3903 |
| 172 | Ga0496111_0316251 | 3300048914 | Bacteria | 1156 |
| 173 | Ga0496112_0004562 | 3300048915 | Bacteria | 11771 |
| 174 | Ga0496113_0040541 | 3300048916 | Bacteria | 3432 |
| 175 | Ga0496114_0004930 | 3300048917 | Bacteria | 10401 |
| 176 | Ga0496114_0720047 | 3300048917 | Bacteria | 874 |
| 177 | Ga0496115_0016424 | 3300048918 | Bacteria | 5638 |
| 178 | Ga0496115_0191010 | 3300048918 | Bacteria | 1692 |
| 179 | Ga0496116_0004667 | 3300048919 | Bacteria | 12968 |
| 180 | Ga0496117_0040390 | 3300048920 | Bacteria | 3431 |
| 181 | Ga0496118_0009791 | 3300048921 | Bacteria | 9608 |
| 182 | Ga0496119_0006416 | 3300048922 | Bacteria | 10909 |
| 183 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 184 | Ga0496122_0000250 | 3300048925 | Bacteria | 121043 |
| 185 | Ga0496122_0087711 | 3300048925 | Bacteria | 2136 |
| 186 | Ga0496123_0014352 | 3300048926 | Bacteria | 6573 |
| 187 | Ga0496123_0027858 | 3300048926 | Bacteria | 4197 |
| 188 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 189 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 190 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 191 | Ga0496126_0006189 | 3300048929 | Bacteria | 13394 |
| 192 | Ga0496126_0046405 | 3300048929 | Bacteria | 3985 |
| 193 | Ga0496126_0324754 | 3300048929 | Bacteria | 1264 |
| 194 | Ga0501032_0127336 | 3300049569 | Bacteria | 1681 |
| 195 | Ga0501036_0052665 | 3300049572 | Bacteria | 3447 |
| 196 | Ga0501037_0014047 | 3300049573 | Bacteria | 5899 |
| 197 | Ga0501038_0059894 | 3300049574 | Bacteria | 3260 |
| 198 | Ga0501043_0437442 | 3300049579 | Bacteria | 984 |
| 199 | Ga0501046_0004893 | 3300049580 | Bacteria | 12064 |
| 200 | Ga0501047_0012600 | 3300049581 | Bacteria | 8011 |
| 201 | Ga0501047_0629793 | 3300049581 | Bacteria | 893 |
| 202 | Ga0501048_0057378 | 3300049582 | Bacteria | 2761 |
| 203 | Ga0501069_0024785 | 3300049585 | Bacteria | 3275 |
| 204 | Ga0501070_0105683 | 3300049586 | Bacteria | 2327 |
| 205 | Ga0501070_0216056 | 3300049586 | Bacteria | 1573 |
| 206 | Ga0501070_0363817 | 3300049586 | Bacteria | 1173 |
| 207 | Ga0501073_0130890 | 3300049589 | Bacteria | 1739 |
| 208 | Ga0501080_0135100 | 3300049742 | Bacteria | 2283 |
| 209 | Ga0501044_0003653 | 3300049823 | Bacteria | 17312 |
| 210 | nmdc:mga03683_15342_c1 | 3300050489 | Bacteria | 1860 |
| 211 | nmdc:mga03683_51365_c1 | 3300050489 | Bacteria | 1720 |
| 212 | nmdc:mga03n38_133_c1 | 3300050490 | Bacteria | 16165 |
| 213 | nmdc:mga03n38_155236_c1 | 3300050490 | Bacteria | 1155 |
| 214 | nmdc:mga03n38_15824_c1 | 3300050490 | Bacteria | 2921 |
| 215 | nmdc:mga03n38_158266_c1 | 3300050490 | Bacteria | 1145 |
| 216 | nmdc:mga00v17_11301_c1 | 3300050491 | Bacteria | 4906 |
| 217 | nmdc:mga00v17_173586_c1 | 3300050491 | Bacteria | 1390 |
| 218 | nmdc:mga00v17_211095_c1 | 3300050491 | Bacteria | 1256 |
| 219 | nmdc:mga00v17_220160_c1 | 3300050491 | Bacteria | 1229 |
| 220 | nmdc:mga00v17_235906_c1 | 3300050491 | Bacteria | 1185 |
| 221 | nmdc:mga00v17_2548_c1 | 3300050491 | Bacteria | 9338 |
| 222 | nmdc:mga00v17_4348_c1 | 3300050491 | Bacteria | 6219 |
| 223 | nmdc:mga00v17_5887_c1 | 3300050491 | Bacteria | 6476 |
| 224 | nmdc:mga0yw44_123212_c1 | 3300050492 | Bacteria | 1671 |
| 225 | nmdc:mga0yw44_224975_c1 | 3300050492 | Bacteria | 1244 |
| 226 | nmdc:mga0yw44_4676_c1 | 3300050492 | Bacteria | 6328 |
| 227 | nmdc:mga06z11_11519_c1 | 3300050494 | Bacteria | 3817 |
| 228 | nmdc:mga07m45_2902_c1 | 3300050496 | Bacteria | 8125 |
| 229 | nmdc:mga07m45_740_c1 | 3300050496 | Bacteria | 13945 |
| 230 | nmdc:mga0sz30_2044_c1 | 3300050516 | Bacteria | 7207 |
| 231 | nmdc:mga0sz30_79544_c1 | 3300050516 | Bacteria | 1418 |
| 232 | nmdc:mga0sz30_99920_c1 | 3300050516 | Bacteria | 1267 |
| 233 | Ga0500610_0007360 | 3300053079 | Bacteria | 4711 |
| 234 | Ga0500635_0000430 | 3300053080 | Bacteria | 12188 |
| 235 | Ga0500562_036647 | 3300053108 | Bacteria | 1301 |
| 236 | Ga0500652_000985 | 3300053131 | Bacteria | 9378 |
| 237 | Ga0466962_0188401 | 3300061719 | Bacteria | 1006 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048907 | Ga0496104_0052209 | Ga0496104_0052209_3280_3837 | 185 |
| 2 | 3300049581 | Ga0501047_0629793 | Ga0501047_0629793_12_719 | 185 |
| 3 | 3300053080 | Ga0500635_0000430 | Ga0500635_0000430_9899_10579 | 185 |
| 4 | 3300053131 | Ga0500652_000985 | Ga0500652_000985_5739_6419 | 185 |
| 5 | 3300048910 | Ga0496107_0658357 | Ga0496107_0658357_13_603 | 196 |
| 6 | 3300039450 | Ga0436363_1045148 | Ga0436363_1045148_1996_2676 | 197 |
| 7 | 3300045976 | Ga0466967_0495946 | Ga0466967_0495946_342_1022 | 201 |
| 8 | 3300031251 | Ga0265327_10003372 | Ga0265327_1000337210 | 203 |
| 9 | 3300031251 | Ga0265327_10009711 | Ga0265327_100097114 | 205 |
| 10 | 3300053108 | Ga0500562_036647 | Ga0500562_036647_547_1227 | 205 |
| 11 | 3300005356 | Ga0070674_100058732 | Ga0070674_1000587322 | 206 |
| 12 | 3300005456 | Ga0070678_100252992 | Ga0070678_1002529922 | 206 |
| 13 | 3300005466 | Ga0070685_10161833 | Ga0070685_101618332 | 206 |
| 14 | 3300005544 | Ga0070686_100469413 | Ga0070686_1004694132 | 206 |
| 15 | 3300005841 | Ga0068863_100137295 | Ga0068863_1001372952 | 206 |
| 16 | 3300006038 | Ga0075365_10006370 | Ga0075365_100063704 | 206 |
| 17 | 3300006048 | Ga0075363_100000793 | Ga0075363_1000007933 | 206 |
| 18 | 3300006051 | Ga0075364_10004135 | Ga0075364_100041353 | 206 |
| 19 | 3300006881 | Ga0068865_100619229 | Ga0068865_1006192292 | 206 |
| 20 | 3300009176 | Ga0105242_10147499 | Ga0105242_101474993 | 206 |
| 21 | 3300017792 | Ga0163161_10149348 | Ga0163161_101493482 | 206 |
| 22 | 3300025935 | Ga0207709_10289959 | Ga0207709_102899592 | 206 |
| 23 | 3300025937 | Ga0207669_10045203 | Ga0207669_100452032 | 206 |
| 24 | 3300026088 | Ga0207641_10438699 | Ga0207641_104386992 | 206 |
| 25 | 3300028379 | Ga0268266_10106307 | Ga0268266_101063072 | 206 |
| 26 | 3300048903 | Ga0496100_0001672 | Ga0496100_0001672_5021_5701 | 206 |
| 27 | 3300048904 | Ga0496101_0000703 | Ga0496101_0000703_14201_14881 | 206 |
| 28 | 3300048905 | Ga0496102_0117781 | Ga0496102_0117781_266_946 | 206 |
| 29 | 3300048907 | Ga0496104_0014060 | Ga0496104_0014060_3643_4323 | 206 |
| 30 | 3300048908 | Ga0496105_0006121 | Ga0496105_0006121_4492_5172 | 206 |
| 31 | 3300048909 | Ga0496106_0004707 | Ga0496106_0004707_7241_7921 | 206 |
| 32 | 3300048917 | Ga0496114_0004930 | Ga0496114_0004930_1049_1729 | 206 |
| 33 | 3300048918 | Ga0496115_0016424 | Ga0496115_0016424_4733_5413 | 206 |
| 34 | 3300050490 | nmdc:mga03n38_155236_c1 | nmdc:mga03n38_155236_c1_369_1037 | 206 |
| 35 | 3300050491 | nmdc:mga00v17_4348_c1 | nmdc:mga00v17_4348_c1_301_969 | 206 |
| 36 | 3300050492 | nmdc:mga0yw44_4676_c1 | nmdc:mga0yw44_4676_c1_3528_4196 | 206 |
| 37 | 3300031824 | Ga0307413_10220234 | Ga0307413_102202342 | 207 |
| 38 | 3300031995 | Ga0307409_100136954 | Ga0307409_1001369543 | 207 |
| 39 | 3300048929 | Ga0496126_0046405 | Ga0496126_0046405_1334_2014 | 207 |
| 40 | 3300003792 | Ga0055540_1003354 | Ga0055540_10033545 | 208 |
| 41 | 3300006051 | Ga0075364_10251641 | Ga0075364_102516412 | 208 |
| 42 | 3300006186 | Ga0075369_10004407 | Ga0075369_100044076 | 208 |
| 43 | 3300025273 | Ga0209673_1006053 | Ga0209673_10060532 | 208 |
| 44 | 3300050491 | nmdc:mga00v17_235906_c1 | nmdc:mga00v17_235906_c1_327_1001 | 208 |
| 45 | 3300050492 | nmdc:mga0yw44_123212_c1 | nmdc:mga0yw44_123212_c1_976_1650 | 208 |
| 46 | iso_pu_bacteria | 8057568493 | 8057573437 | 208 |
| 47 | 3300046507 | Ga0495606_0021005 | Ga0495606_0021005_432_1109 | 209 |
| 48 | 3300005347 | Ga0070668_100030685 | Ga0070668_1000306852 | 210 |
| 49 | 3300005617 | Ga0068859_100142683 | Ga0068859_1001426833 | 210 |
| 50 | 3300006931 | Ga0097620_100142685 | Ga0097620_1001426853 | 210 |
| 51 | 3300025972 | Ga0207668_10043103 | Ga0207668_100431035 | 210 |
| 52 | 3300048904 | Ga0496101_0012357 | Ga0496101_0012357_603_1283 | 210 |
| 53 | 3300048905 | Ga0496102_0177634 | Ga0496102_0177634_562_1242 | 210 |
| 54 | 3300048907 | Ga0496104_0349779 | Ga0496104_0349779_429_1109 | 210 |
| 55 | 3300048909 | Ga0496106_0018832 | Ga0496106_0018832_1839_2519 | 210 |
| 56 | 3300048910 | Ga0496107_0042749 | Ga0496107_0042749_1727_2407 | 210 |
| 57 | 3300048917 | Ga0496114_0720047 | Ga0496114_0720047_36_716 | 210 |
| 58 | 3300049586 | Ga0501070_0216056 | Ga0501070_0216056_420_1100 | 210 |
| 59 | 3300031251 | Ga0265327_10000081 | Ga0265327_1000008189 | 213 |
| 60 | iso_pu_bacteria | 2643221687 | 2644485940 | 217 |
| 61 | iso_pu_bacteria | 2902837492 | 2902840713 | 217 |
| 62 | iso_pu_bacteria | 2842134933 | 2842137689 | 218 |
| 63 | iso_pu_bacteria | 2939582691 | 2939588184 | 218 |
| 64 | iso_pu_bacteria | 2738541264 | 2738665134 | 219 |
| 65 | iso_pu_bacteria | 2738541356 | 2739144268 | 219 |
| 66 | iso_pu_bacteria | 2902792274 | 2902795907 | 219 |
| 67 | iso_pu_bacteria | 2929212328 | 2929215506 | 219 |
| 68 | 3300044683 | Ga0466965_0000977 | Ga0466965_0000977_5476_6177 | 220 |
| 69 | 3300044706 | Ga0466964_0196173 | Ga0466964_0196173_40_741 | 220 |
| 70 | 3300044842 | Ga0466957_0004000 | Ga0466957_0004000_1948_2649 | 220 |
| 71 | 3300045049 | Ga0466959_0008423 | Ga0466959_0008423_4701_5402 | 220 |
| 72 | 3300045836 | Ga0466958_0087677 | Ga0466958_0087677_78_779 | 220 |
| 73 | 3300045976 | Ga0466967_0011056 | Ga0466967_0011056_2257_2958 | 220 |
| 74 | 3300048918 | Ga0496115_0191010 | Ga0496115_0191010_32_703 | 220 |
| 75 | 3300048925 | Ga0496122_0087711 | Ga0496122_0087711_514_1185 | 220 |
| 76 | 3300048926 | Ga0496123_0027858 | Ga0496123_0027858_2880_3551 | 220 |
| 77 | 3300048929 | Ga0496126_0006189 | Ga0496126_0006189_8374_9045 | 220 |
| 78 | 3300003792 | Ga0055540_1009520 | Ga0055540_10095202 | 221 |
| 79 | 3300005539 | Ga0068853_100020541 | Ga0068853_1000205414 | 221 |
| 80 | 3300025303 | Ga0209051_1000559 | Ga0209051_100055928 | 221 |
| 81 | 3300025303 | Ga0209051_1000670 | Ga0209051_100067012 | 221 |
| 82 | 3300026041 | Ga0207639_10015630 | Ga0207639_100156303 | 221 |
| 83 | 3300041452 | Ga0451793_0167831 | Ga0451793_0167831_558_1232 | 221 |
| 84 | 3300044901 | Ga0466960_0000150 | Ga0466960_0000150_11967_12641 | 221 |
| 85 | 3300044901 | Ga0466960_0020049 | Ga0466960_0020049_447_1112 | 221 |
| 86 | 3300047472 | Ga0495686_0005301 | Ga0495686_0005301_6023_6697 | 221 |
| 87 | 3300006038 | Ga0075365_10186193 | Ga0075365_101861932 | 222 |
| 88 | 3300006048 | Ga0075363_100000212 | Ga0075363_1000002126 | 222 |
| 89 | 3300006048 | Ga0075363_100015633 | Ga0075363_1000156335 | 222 |
| 90 | 3300006048 | Ga0075363_100062647 | Ga0075363_1000626473 | 222 |
| 91 | 3300006051 | Ga0075364_10000234 | Ga0075364_100002349 | 222 |
| 92 | 3300006051 | Ga0075364_10037093 | Ga0075364_100370932 | 222 |
| 93 | 3300006177 | Ga0075362_10016826 | Ga0075362_100168263 | 222 |
| 94 | 3300006177 | Ga0075362_10077820 | Ga0075362_100778203 | 222 |
| 95 | 3300006177 | Ga0075362_10223791 | Ga0075362_102237912 | 222 |
| 96 | 3300006186 | Ga0075369_10001288 | Ga0075369_100012882 | 222 |
| 97 | 3300006186 | Ga0075369_10038610 | Ga0075369_100386102 | 222 |
| 98 | 3300006186 | Ga0075369_10055149 | Ga0075369_100551492 | 222 |
| 99 | 3300006353 | Ga0075370_10003418 | Ga0075370_100034182 | 222 |
| 100 | 3300031852 | Ga0307410_10134801 | Ga0307410_101348013 | 222 |
| 101 | 3300041411 | Ga0439466_0055777 | Ga0439466_0055777_270_938 | 222 |
| 102 | 3300041413 | Ga0439465_0012627 | Ga0439465_0012627_508_1176 | 222 |
| 103 | 3300042002 | Ga0439442_038172 | Ga0439442_038172_39_707 | 222 |
| 104 | 3300044658 | Ga0466972_0095838 | Ga0466972_0095838_327_995 | 222 |
| 105 | 3300044842 | Ga0466957_0063515 | Ga0466957_0063515_811_1479 | 222 |
| 106 | 3300045976 | Ga0466967_0316867 | Ga0466967_0316867_784_1452 | 222 |
| 107 | 3300045976 | Ga0466967_1317364 | Ga0466967_1317364_38_706 | 222 |
| 108 | 3300048929 | Ga0496126_0324754 | Ga0496126_0324754_333_1010 | 222 |
| 109 | 3300049586 | Ga0501070_0363817 | Ga0501070_0363817_488_1156 | 222 |
| 110 | 3300050489 | nmdc:mga03683_15342_c1 | nmdc:mga03683_15342_c1_455_1123 | 222 |
| 111 | 3300050490 | nmdc:mga03n38_133_c1 | nmdc:mga03n38_133_c1_5568_6236 | 222 |
| 112 | 3300050490 | nmdc:mga03n38_158266_c1 | nmdc:mga03n38_158266_c1_128_796 | 222 |
| 113 | 3300050491 | nmdc:mga00v17_11301_c1 | nmdc:mga00v17_11301_c1_3765_4433 | 222 |
| 114 | 3300050491 | nmdc:mga00v17_173586_c1 | nmdc:mga00v17_173586_c1_266_943 | 222 |
| 115 | 3300050491 | nmdc:mga00v17_211095_c1 | nmdc:mga00v17_211095_c1_186_863 | 222 |
| 116 | 3300050491 | nmdc:mga00v17_220160_c1 | nmdc:mga00v17_220160_c1_411_1088 | 222 |
| 117 | 3300050491 | nmdc:mga00v17_2548_c1 | nmdc:mga00v17_2548_c1_7487_8155 | 222 |
| 118 | 3300050492 | nmdc:mga0yw44_224975_c1 | nmdc:mga0yw44_224975_c1_172_849 | 222 |
| 119 | 3300050496 | nmdc:mga07m45_740_c1 | nmdc:mga07m45_740_c1_7685_8353 | 222 |
| 120 | 3300050516 | nmdc:mga0sz30_2044_c1 | nmdc:mga0sz30_2044_c1_2962_3630 | 222 |
| 121 | 3300050516 | nmdc:mga0sz30_79544_c1 | nmdc:mga0sz30_79544_c1_257_934 | 222 |
| 122 | 3300002459 | JGI24751J29686_10009839 | JGI24751J29686_100098392 | 223 |
| 123 | 3300003792 | Ga0055540_1000136 | Ga0055540_100013642 | 223 |
| 124 | 3300005329 | Ga0070683_100161340 | Ga0070683_1001613402 | 223 |
| 125 | 3300005331 | Ga0070670_100559215 | Ga0070670_1005592152 | 223 |
| 126 | 3300005347 | Ga0070668_100122766 | Ga0070668_1001227662 | 223 |
| 127 | 3300005355 | Ga0070671_100052678 | Ga0070671_1000526782 | 223 |
| 128 | 3300005367 | Ga0070667_100001293 | Ga0070667_1000012935 | 223 |
| 129 | 3300005367 | Ga0070667_100005403 | Ga0070667_1000054032 | 223 |
| 130 | 3300005367 | Ga0070667_100271503 | Ga0070667_1002715032 | 223 |
| 131 | 3300005435 | Ga0070714_100112961 | Ga0070714_1001129612 | 223 |
| 132 | 3300005436 | Ga0070713_100071175 | Ga0070713_1000711752 | 223 |
| 133 | 3300005445 | Ga0070708_100615017 | Ga0070708_1006150171 | 223 |
| 134 | 3300005535 | Ga0070684_100316597 | Ga0070684_1003165972 | 223 |
| 135 | 3300005548 | Ga0070665_100004596 | Ga0070665_1000045966 | 223 |
| 136 | 3300005617 | Ga0068859_100493294 | Ga0068859_1004932942 | 223 |
| 137 | 3300005618 | Ga0068864_100251915 | Ga0068864_1002519152 | 223 |
| 138 | 3300005719 | Ga0068861_100224692 | Ga0068861_1002246922 | 223 |
| 139 | 3300005841 | Ga0068863_100083207 | Ga0068863_1000832072 | 223 |
| 140 | 3300005842 | Ga0068858_100260204 | Ga0068858_1002602041 | 223 |
| 141 | 3300005843 | Ga0068860_100606072 | Ga0068860_1006060722 | 223 |
| 142 | 3300006038 | Ga0075365_10089916 | Ga0075365_100899162 | 223 |
| 143 | 3300006042 | Ga0075368_10011989 | Ga0075368_100119892 | 223 |
| 144 | 3300006048 | Ga0075363_100000928 | Ga0075363_1000009283 | 223 |
| 145 | 3300006051 | Ga0075364_10025083 | Ga0075364_100250833 | 223 |
| 146 | 3300006178 | Ga0075367_10004066 | Ga0075367_100040663 | 223 |
| 147 | 3300006186 | Ga0075369_10107296 | Ga0075369_101072961 | 223 |
| 148 | 3300006353 | Ga0075370_10064815 | Ga0075370_100648152 | 223 |
| 149 | 3300006931 | Ga0097620_100493280 | Ga0097620_1004932802 | 223 |
| 150 | 3300009092 | Ga0105250_10100918 | Ga0105250_101009181 | 223 |
| 151 | 3300009545 | Ga0105237_10000175 | Ga0105237_100001757 | 223 |
| 152 | 3300009545 | Ga0105237_10198227 | Ga0105237_101982272 | 223 |
| 153 | 3300009553 | Ga0105249_10280647 | Ga0105249_102806472 | 223 |
| 154 | 3300009553 | Ga0105249_10386125 | Ga0105249_103861252 | 223 |
| 155 | 3300010375 | Ga0105239_10003915 | Ga0105239_1000391514 | 223 |
| 156 | 3300010375 | Ga0105239_10105382 | Ga0105239_101053822 | 223 |
| 157 | 3300025303 | Ga0209051_1000011 | Ga0209051_1000011149 | 223 |
| 158 | 3300025925 | Ga0207650_10258850 | Ga0207650_102588502 | 223 |
| 159 | 3300025928 | Ga0207700_10667224 | Ga0207700_106672242 | 223 |
| 160 | 3300025929 | Ga0207664_10048409 | Ga0207664_100484092 | 223 |
| 161 | 3300025929 | Ga0207664_10201015 | Ga0207664_102010152 | 223 |
| 162 | 3300025961 | Ga0207712_10010322 | Ga0207712_100103222 | 223 |
| 163 | 3300025986 | Ga0207658_10001047 | Ga0207658_1000104716 | 223 |
| 164 | 3300025986 | Ga0207658_10013462 | Ga0207658_100134622 | 223 |
| 165 | 3300026088 | Ga0207641_10100906 | Ga0207641_101009063 | 223 |
| 166 | 3300026095 | Ga0207676_10041611 | Ga0207676_100416113 | 223 |
| 167 | 3300026118 | Ga0207675_100143798 | Ga0207675_1001437984 | 223 |
| 168 | 3300028379 | Ga0268266_10002908 | Ga0268266_1000290816 | 223 |
| 169 | 3300031251 | Ga0265327_10046265 | Ga0265327_100462654 | 223 |
| 170 | 3300031903 | Ga0307407_10133588 | Ga0307407_101335882 | 223 |
| 171 | 3300042005 | Ga0439448_0007020 | Ga0439448_0007020_282_974 | 223 |
| 172 | 3300044656 | Ga0466969_0158817 | Ga0466969_0158817_50_721 | 223 |
| 173 | 3300044683 | Ga0466965_0019818 | Ga0466965_0019818_1411_2103 | 223 |
| 174 | 3300044683 | Ga0466965_0074715 | Ga0466965_0074715_635_1306 | 223 |
| 175 | 3300044683 | Ga0466965_0173571 | Ga0466965_0173571_198_878 | 223 |
| 176 | 3300044693 | Ga0466961_0036420 | Ga0466961_0036420_1206_1877 | 223 |
| 177 | 3300044694 | Ga0466963_0245729 | Ga0466963_0245729_367_1047 | 223 |
| 178 | 3300044706 | Ga0466964_0074993 | Ga0466964_0074993_355_1026 | 223 |
| 179 | 3300044719 | Ga0466971_0042015 | Ga0466971_0042015_858_1538 | 223 |
| 180 | 3300044719 | Ga0466971_0247561 | Ga0466971_0247561_144_815 | 223 |
| 181 | 3300044735 | Ga0466968_0046284 | Ga0466968_0046284_529_1200 | 223 |
| 182 | 3300044765 | Ga0466970_0065791 | Ga0466970_0065791_472_1143 | 223 |
| 183 | 3300044842 | Ga0466957_0085819 | Ga0466957_0085819_781_1461 | 223 |
| 184 | 3300044901 | Ga0466960_0050762 | Ga0466960_0050762_1076_1756 | 223 |
| 185 | 3300045049 | Ga0466959_0012199 | Ga0466959_0012199_4168_4839 | 223 |
| 186 | 3300045836 | Ga0466958_0044205 | Ga0466958_0044205_1695_2366 | 223 |
| 187 | 3300045976 | Ga0466967_0095339 | Ga0466967_0095339_491_1171 | 223 |
| 188 | 3300045976 | Ga0466967_0183714 | Ga0466967_0183714_1262_1948 | 223 |
| 189 | 3300045976 | Ga0466967_0338982 | Ga0466967_0338982_651_1322 | 223 |
| 190 | 3300045976 | Ga0466967_0347845 | Ga0466967_0347845_579_1250 | 223 |
| 191 | 3300048903 | Ga0496100_0000041 | Ga0496100_0000041_18106_18798 | 223 |
| 192 | 3300048903 | Ga0496100_0097521 | Ga0496100_0097521_822_1493 | 223 |
| 193 | 3300048904 | Ga0496101_0000249 | Ga0496101_0000249_19204_19896 | 223 |
| 194 | 3300048904 | Ga0496101_0102477 | Ga0496101_0102477_727_1398 | 223 |
| 195 | 3300048905 | Ga0496102_0003474 | Ga0496102_0003474_1841_2512 | 223 |
| 196 | 3300048905 | Ga0496102_0118947 | Ga0496102_0118947_746_1438 | 223 |
| 197 | 3300048906 | Ga0496103_0000879 | Ga0496103_0000879_57_749 | 223 |
| 198 | 3300048906 | Ga0496103_0206216 | Ga0496103_0206216_461_1132 | 223 |
| 199 | 3300048907 | Ga0496104_0028123 | Ga0496104_0028123_2098_2769 | 223 |
| 200 | 3300048907 | Ga0496104_0893111 | Ga0496104_0893111_110_784 | 223 |
| 201 | 3300048908 | Ga0496105_0058718 | Ga0496105_0058718_2007_2678 | 223 |
| 202 | 3300048909 | Ga0496106_0000561 | Ga0496106_0000561_11884_12576 | 223 |
| 203 | 3300048910 | Ga0496107_0007655 | Ga0496107_0007655_2391_3083 | 223 |
| 204 | 3300048911 | Ga0496108_0003812 | Ga0496108_0003812_5347_6039 | 223 |
| 205 | 3300048911 | Ga0496108_0130813 | Ga0496108_0130813_163_834 | 223 |
| 206 | 3300048912 | Ga0496109_0000582 | Ga0496109_0000582_6710_7402 | 223 |
| 207 | 3300048912 | Ga0496109_0071793 | Ga0496109_0071793_2055_2726 | 223 |
| 208 | 3300048912 | Ga0496109_0282528 | Ga0496109_0282528_567_1238 | 223 |
| 209 | 3300048913 | Ga0496110_0001049 | Ga0496110_0001049_7639_8331 | 223 |
| 210 | 3300048913 | Ga0496110_0056567 | Ga0496110_0056567_1516_2187 | 223 |
| 211 | 3300048913 | Ga0496110_0391316 | Ga0496110_0391316_359_1030 | 223 |
| 212 | 3300048914 | Ga0496111_0029399 | Ga0496111_0029399_2463_3155 | 223 |
| 213 | 3300048914 | Ga0496111_0316251 | Ga0496111_0316251_27_698 | 223 |
| 214 | 3300048915 | Ga0496112_0004562 | Ga0496112_0004562_2450_3121 | 223 |
| 215 | 3300048916 | Ga0496113_0040541 | Ga0496113_0040541_2424_3116 | 223 |
| 216 | 3300048919 | Ga0496116_0004667 | Ga0496116_0004667_7639_8331 | 223 |
| 217 | 3300048920 | Ga0496117_0040390 | Ga0496117_0040390_1544_2236 | 223 |
| 218 | 3300048921 | Ga0496118_0009791 | Ga0496118_0009791_957_1649 | 223 |
| 219 | 3300048922 | Ga0496119_0006416 | Ga0496119_0006416_6958_7650 | 223 |
| 220 | 3300048924 | Ga0496121_0000016 | Ga0496121_0000016_80815_81507 | 223 |
| 221 | 3300048925 | Ga0496122_0000250 | Ga0496122_0000250_6238_6930 | 223 |
| 222 | 3300048926 | Ga0496123_0014352 | Ga0496123_0014352_5538_6230 | 223 |
| 223 | 3300048927 | Ga0496124_0000015 | Ga0496124_0000015_296883_297575 | 223 |
| 224 | 3300048928 | Ga0496125_0000021 | Ga0496125_0000021_163126_163818 | 223 |
| 225 | 3300048929 | Ga0496126_0000015 | Ga0496126_0000015_163126_163818 | 223 |
| 226 | 3300049569 | Ga0501032_0127336 | Ga0501032_0127336_565_1245 | 223 |
| 227 | 3300049572 | Ga0501036_0052665 | Ga0501036_0052665_592_1272 | 223 |
| 228 | 3300049573 | Ga0501037_0014047 | Ga0501037_0014047_563_1243 | 223 |
| 229 | 3300049574 | Ga0501038_0059894 | Ga0501038_0059894_748_1428 | 223 |
| 230 | 3300049579 | Ga0501043_0437442 | Ga0501043_0437442_38_718 | 223 |
| 231 | 3300049580 | Ga0501046_0004893 | Ga0501046_0004893_9112_9792 | 223 |
| 232 | 3300049581 | Ga0501047_0012600 | Ga0501047_0012600_7051_7731 | 223 |
| 233 | 3300049582 | Ga0501048_0057378 | Ga0501048_0057378_639_1346 | 223 |
| 234 | 3300049585 | Ga0501069_0024785 | Ga0501069_0024785_1373_2053 | 223 |
| 235 | 3300049586 | Ga0501070_0105683 | Ga0501070_0105683_418_1098 | 223 |
| 236 | 3300049589 | Ga0501073_0130890 | Ga0501073_0130890_406_1086 | 223 |
| 237 | 3300049742 | Ga0501080_0135100 | Ga0501080_0135100_49_729 | 223 |
| 238 | 3300049823 | Ga0501044_0003653 | Ga0501044_0003653_5121_5801 | 223 |
| 239 | 3300050489 | nmdc:mga03683_51365_c1 | nmdc:mga03683_51365_c1_754_1440 | 223 |
| 240 | 3300050490 | nmdc:mga03n38_15824_c1 | nmdc:mga03n38_15824_c1_263_949 | 223 |
| 241 | 3300050491 | nmdc:mga00v17_5887_c1 | nmdc:mga00v17_5887_c1_1718_2404 | 223 |
| 242 | 3300050494 | nmdc:mga06z11_11519_c1 | nmdc:mga06z11_11519_c1_1053_1739 | 223 |
| 243 | 3300050496 | nmdc:mga07m45_2902_c1 | nmdc:mga07m45_2902_c1_1573_2259 | 223 |
| 244 | 3300050516 | nmdc:mga0sz30_99920_c1 | nmdc:mga0sz30_99920_c1_555_1241 | 223 |
| 245 | 3300053079 | Ga0500610_0007360 | Ga0500610_0007360_2408_3088 | 223 |
| 246 | 3300061719 | Ga0466962_0188401 | Ga0466962_0188401_183_863 | 223 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fmf-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.9836 | 2 | 223 |
| 6e06-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase in complex with cytidine triphosphate solved by precipitant-ligand exchange (crystals grown in citrate precipitant) | 0.9817 | 2 | 221 |
| 3fmf-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.9759 | 2 | 221 |
| 3fmf-assembly2.cif.gz_C | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.9749 | 2 | 223 |
| 3fmf-assembly2.cif.gz_D | crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate | 0.9672 | 2 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3fmfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9759 | 2 | 221 | 3.40.50.300 |
| 3fmfB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9587 | 2 | 221 | 3.40.50.300 |
| af_Q2FVJ5_2_213_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8604 | 4 | 194 | 3.40.50.300 |
| af_Q58695_1_213_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8424 | 4 | 193 | 3.40.50.300 |
| af_A0A1D8PS31_1_209_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8133 | 1 | 209 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X8B3J5-F1-model_v4 | deleted | 0.9895 | 82 | 196 |
|
| AF-P45486-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.989 | 1 | 223 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A1B9D8C7-F1-model_v4 | Dethiobiotin synthase | 0.9887 | 46 | 223 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-A0A5A7ZK01-F1-model_v4 | ATP-dependent dethiobiotin synthetase BioD (EC 6.3.3.3) (DTB synthetase) (DTBS) (Dethiobiotin synthase) | 0.9872 | 1 | 221 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
| AF-D5P2S2-F1-model_v4 | Putative dethiobiotin synthase (EC 6.3.3.3) | 0.9863 | 66 | 223 |
GO:0000287
GO:0004141 GO:0005524 GO:0005829 GO:0009102 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar