F358560
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 246 | 174 | 223 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300053102|Ga0500554_031001|Ga0500554_031001_98_1099 |
| Length | 291 |
| Sequence | MPHDHPKDFGRAFAIGATLNIGFVIAETIAGLMTHSLALLADAGHNLSDVLGLFMAWGAVILAKRAPAGRHTYGLRKGTILASLTNAVVLLVAVGAIAWEAVRRFADPQPIQTGPVMIVAAIGIVINTATALMFMKGSKDDLNIRGAFLHMAADAAISAGVVLWATGWLWLDPVVSLGIVVVIVLGTWSLLRDSLDLALDAAPRGIDPKAVGDWLAGRPGVTEVHDLHIWAMSTTETAMTAHLVRPENPDNDRFLHDICGEMSKRFNIGHVTIQVESGGVATCHLAGADAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 6 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 9 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 10 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 11 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 12 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 13 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 14 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 15 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 16 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 17 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 18 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 19 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 20 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 21 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 22 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 23 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 51 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 52 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 53 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 72 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 104 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 105 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 106 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 110 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 114 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 115 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 116 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 117 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 118 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 119 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 120 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 147 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 148 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 149 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 150 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 151 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 154 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 155 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 156 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 158 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 159 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 160 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 161 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 162 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 163 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 164 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 165 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 166 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 167 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 168 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 169 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 170 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 171 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 172 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 173 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 174 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.65 |
| Metatranscriptomes | 0 |
| Isolates | 9.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 27.64 |
| Nodule | 0 |
| Rhizoplane | 2.03 |
| Rhizosphere | 61.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10053517 | 3300003215 | Bacteria | 1141 |
| 2 | Ga0055537_1001453 | 3300003773 | Bacteria | 9220 |
| 3 | Ga0055536_1002121 | 3300003781 | Bacteria | 11290 |
| 4 | Ga0055536_1002883 | 3300003781 | Bacteria | 9451 |
| 5 | Ga0055530_10001223 | 3300003791 | Bacteria | 19641 |
| 6 | Ga0055530_10001792 | 3300003791 | Bacteria | 14916 |
| 7 | Ga0055530_10004611 | 3300003791 | Bacteria | 7017 |
| 8 | Ga0055531_10001551 | 3300003794 | Bacteria | 16821 |
| 9 | Ga0055531_10003795 | 3300003794 | Bacteria | 9486 |
| 10 | Ga0055531_10023915 | 3300003794 | Bacteria | 2273 |
| 11 | Ga0065165_1000030 | 3300005262 | Bacteria | 218104 |
| 12 | Ga0065165_1001205 | 3300005262 | Bacteria | 29843 |
| 13 | Ga0070670_100069682 | 3300005331 | Bacteria | 3019 |
| 14 | Ga0070680_100131842 | 3300005336 | Bacteria | 2091 |
| 15 | Ga0070680_100243503 | 3300005336 | Bacteria | 1520 |
| 16 | Ga0070660_100433104 | 3300005339 | Bacteria | 1090 |
| 17 | Ga0070689_100082374 | 3300005340 | Bacteria | 2527 |
| 18 | Ga0070671_100000700 | 3300005355 | Bacteria | 24031 |
| 19 | Ga0070671_100063415 | 3300005355 | Bacteria | 3077 |
| 20 | Ga0070688_100069127 | 3300005365 | Bacteria | 2254 |
| 21 | Ga0070667_100019106 | 3300005367 | Bacteria | 5683 |
| 22 | Ga0068853_100294821 | 3300005539 | Bacteria | 1498 |
| 23 | Ga0068853_100318778 | 3300005539 | Bacteria | 1441 |
| 24 | Ga0070665_100095298 | 3300005548 | Bacteria | 2981 |
| 25 | Ga0068855_100549579 | 3300005563 | Bacteria | 1250 |
| 26 | Ga0068854_100006277 | 3300005578 | Bacteria | 7556 |
| 27 | Ga0068854_100139791 | 3300005578 | Bacteria | 1857 |
| 28 | Ga0068856_100019971 | 3300005614 | Bacteria | 6504 |
| 29 | Ga0068852_100001919 | 3300005616 | Bacteria | 14168 |
| 30 | Ga0068852_100151768 | 3300005616 | Bacteria | 2155 |
| 31 | Ga0068859_100004151 | 3300005617 | Bacteria | 14797 |
| 32 | Ga0068863_100000726 | 3300005841 | Bacteria | 33034 |
| 33 | Ga0068863_100326208 | 3300005841 | Bacteria | 1492 |
| 34 | Ga0068858_100001315 | 3300005842 | Bacteria | 25647 |
| 35 | Ga0068860_100059602 | 3300005843 | Bacteria | 3628 |
| 36 | Ga0081455_10001550 | 3300005937 | Bacteria | 28283 |
| 37 | Ga0081455_10043173 | 3300005937 | Bacteria | 3947 |
| 38 | Ga0081539_10010332 | 3300005985 | Bacteria | 7599 |
| 39 | Ga0070717_10034972 | 3300006028 | Bacteria | 4064 |
| 40 | Ga0075362_10001778 | 3300006177 | Bacteria | 7023 |
| 41 | Ga0075367_10010200 | 3300006178 | Bacteria | 4926 |
| 42 | Ga0075369_10007240 | 3300006186 | Bacteria | 4219 |
| 43 | Ga0075366_10013645 | 3300006195 | Bacteria | 4631 |
| 44 | Ga0075370_10095634 | 3300006353 | Bacteria | 1716 |
| 45 | Ga0068865_100000422 | 3300006881 | Bacteria | 23636 |
| 46 | Ga0097620_100004150 | 3300006931 | Bacteria | 14797 |
| 47 | Ga0105240_10000449 | 3300009093 | Bacteria | 75827 |
| 48 | Ga0105240_10240423 | 3300009093 | Bacteria | 2099 |
| 49 | Ga0105247_10222417 | 3300009101 | Bacteria | 1278 |
| 50 | Ga0105248_10016861 | 3300009177 | Bacteria | 8040 |
| 51 | Ga0105248_10146101 | 3300009177 | Bacteria | 2668 |
| 52 | Ga0105237_10080662 | 3300009545 | Bacteria | 3244 |
| 53 | Ga0105238_10011022 | 3300009551 | Bacteria | 9089 |
| 54 | Ga0105238_10053418 | 3300009551 | Bacteria | 4060 |
| 55 | Ga0105249_10205012 | 3300009553 | Bacteria | 1932 |
| 56 | Ga0105249_10304081 | 3300009553 | Bacteria | 1601 |
| 57 | Ga0105239_10000051 | 3300010375 | Bacteria | 169036 |
| 58 | Ga0157373_10085359 | 3300013100 | Bacteria | 2225 |
| 59 | Ga0157371_10029135 | 3300013102 | Bacteria | 3996 |
| 60 | Ga0163162_10177499 | 3300013306 | Bacteria | 2256 |
| 61 | Ga0163162_10271813 | 3300013306 | Bacteria | 1827 |
| 62 | Ga0157372_10793251 | 3300013307 | Bacteria | 1101 |
| 63 | Ga0163163_10004569 | 3300014325 | Bacteria | 11814 |
| 64 | Ga0157379_10022592 | 3300014968 | Bacteria | 5573 |
| 65 | Ga0209565_1000636 | 3300025263 | Bacteria | 22843 |
| 66 | Ga0209673_1002816 | 3300025273 | Bacteria | 11240 |
| 67 | Ga0209676_1000253 | 3300025292 | Bacteria | 113412 |
| 68 | Ga0209676_1000262 | 3300025292 | Bacteria | 111061 |
| 69 | Ga0209564_1031670 | 3300025295 | Bacteria | 1610 |
| 70 | Ga0209758_1000516 | 3300025297 | Bacteria | 62036 |
| 71 | Ga0209758_1011378 | 3300025297 | Bacteria | 5162 |
| 72 | Ga0209050_1000090 | 3300025298 | Bacteria | 253783 |
| 73 | Ga0209050_1000411 | 3300025298 | Bacteria | 79805 |
| 74 | Ga0209050_1000948 | 3300025298 | Bacteria | 37706 |
| 75 | Ga0209050_1046970 | 3300025298 | Bacteria | 1129 |
| 76 | Ga0209256_1002061 | 3300025299 | Bacteria | 17746 |
| 77 | Ga0209256_1006016 | 3300025299 | Bacteria | 6641 |
| 78 | Ga0209257_1000059 | 3300025304 | Bacteria | 378097 |
| 79 | Ga0209257_1000427 | 3300025304 | Bacteria | 81007 |
| 80 | Ga0209257_1001169 | 3300025304 | Bacteria | 33227 |
| 81 | Ga0209257_1003785 | 3300025304 | Bacteria | 12469 |
| 82 | Ga0209257_1010039 | 3300025304 | Bacteria | 4901 |
| 83 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 84 | Ga0207654_10123700 | 3300025911 | Bacteria | 1628 |
| 85 | Ga0207695_10000565 | 3300025913 | Bacteria | 75825 |
| 86 | Ga0207695_10008077 | 3300025913 | Bacteria | 13239 |
| 87 | Ga0207671_10070311 | 3300025914 | Bacteria | 2609 |
| 88 | Ga0207657_10032897 | 3300025919 | Bacteria | 4679 |
| 89 | Ga0207681_10003581 | 3300025923 | Bacteria | 9674 |
| 90 | Ga0207694_10025639 | 3300025924 | Bacteria | 4482 |
| 91 | Ga0207694_10028956 | 3300025924 | Bacteria | 4224 |
| 92 | Ga0207694_10247868 | 3300025924 | Bacteria | 1457 |
| 93 | Ga0207650_10050950 | 3300025925 | Bacteria | 3063 |
| 94 | Ga0207644_10005991 | 3300025931 | Bacteria | 7923 |
| 95 | Ga0207704_10008938 | 3300025938 | Bacteria | 4814 |
| 96 | Ga0207711_10011290 | 3300025941 | Bacteria | 7420 |
| 97 | Ga0207711_10086476 | 3300025941 | Bacteria | 2749 |
| 98 | Ga0207667_10469432 | 3300025949 | Bacteria | 1278 |
| 99 | Ga0207668_10113136 | 3300025972 | Bacteria | 2040 |
| 100 | Ga0207640_10000192 | 3300025981 | Bacteria | 43577 |
| 101 | Ga0207658_10007678 | 3300025986 | Bacteria | 7345 |
| 102 | Ga0207703_10001867 | 3300026035 | Bacteria | 18733 |
| 103 | Ga0207639_10156507 | 3300026041 | Bacteria | 1915 |
| 104 | Ga0207702_10004160 | 3300026078 | Bacteria | 12962 |
| 105 | Ga0207641_10002949 | 3300026088 | Bacteria | 15387 |
| 106 | Ga0207641_10125420 | 3300026088 | Bacteria | 2298 |
| 107 | Ga0207698_10000084 | 3300026142 | Bacteria | 62453 |
| 108 | Ga0207698_10310183 | 3300026142 | Bacteria | 1473 |
| 109 | Ga0209981_1006398 | 3300027378 | Bacteria | 1576 |
| 110 | Ga0209974_10003411 | 3300027876 | Bacteria | 5741 |
| 111 | Ga0268264_10018502 | 3300028381 | Bacteria | 5698 |
| 112 | Ga0307517_10061707 | 3300028786 | Bacteria | 3541 |
| 113 | Ga0307515_10013510 | 3300028794 | Bacteria | 15249 |
| 114 | Ga0307515_10046901 | 3300028794 | Bacteria | 6589 |
| 115 | Ga0265340_10001670 | 3300031247 | Bacteria | 12768 |
| 116 | Ga0307513_10003803 | 3300031456 | Bacteria | 20342 |
| 117 | Ga0307513_10026601 | 3300031456 | Bacteria | 6665 |
| 118 | Ga0307405_10003498 | 3300031731 | Bacteria | 7227 |
| 119 | Ga0316577_10003812 | 3300031733 | Bacteria | 7679 |
| 120 | Ga0307510_10048543 | 3300033180 | Bacteria | 4528 |
| 121 | Ga0373927_0000880 | 3300035695 | Bacteria | 22844 |
| 122 | Ga0316582_0046496 | 3300036647 | Bacteria | 2737 |
| 123 | Ga0373925_0001027 | 3300037068 | Bacteria | 25268 |
| 124 | Ga0395899_0000091 | 3300037312 | Bacteria | 154780 |
| 125 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 126 | Ga0395905_0073216 | 3300037471 | Bacteria | 3211 |
| 127 | Ga0395905_0127991 | 3300037471 | Bacteria | 2388 |
| 128 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 129 | Ga0451807_1460733 | 3300041486 | Bacteria | 2588 |
| 130 | Ga0439459_0018398 | 3300042438 | Bacteria | 1313 |
| 131 | Ga0451577_0149540 | 3300042876 | Unclassified | 2101 |
| 132 | Ga0466965_0124292 | 3300044683 | Bacteria | 1334 |
| 133 | Ga0451576_0177870 | 3300045051 | Bacteria | 2221 |
| 134 | Ga0495627_004036 | 3300046453 | Bacteria | 6258 |
| 135 | Ga0495590_0000213 | 3300046457 | Bacteria | 31568 |
| 136 | Ga0495629_0011287 | 3300046459 | Bacteria | 6491 |
| 137 | Ga0495638_0001503 | 3300046460 | Bacteria | 21003 |
| 138 | Ga0495638_0001702 | 3300046460 | Bacteria | 19352 |
| 139 | Ga0495638_0139354 | 3300046460 | Bacteria | 1417 |
| 140 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 141 | Ga0495607_0076020 | 3300046501 | Bacteria | 1859 |
| 142 | Ga0495583_0000003 | 3300046506 | Bacteria | 709273 |
| 143 | Ga0495610_0002431 | 3300046512 | Bacteria | 15665 |
| 144 | Ga0495610_0006012 | 3300046512 | Bacteria | 8480 |
| 145 | Ga0495610_0010562 | 3300046512 | Bacteria | 5726 |
| 146 | Ga0495616_0002189 | 3300046513 | Bacteria | 13072 |
| 147 | Ga0495631_0009134 | 3300046518 | Bacteria | 4964 |
| 148 | Ga0495632_0010499 | 3300046519 | Bacteria | 5476 |
| 149 | Ga0495637_0023258 | 3300046520 | Bacteria | 2819 |
| 150 | Ga0495637_0040285 | 3300046520 | Bacteria | 2012 |
| 151 | Ga0495637_0052615 | 3300046520 | Bacteria | 1699 |
| 152 | Ga0495648_0000391 | 3300046524 | Bacteria | 48012 |
| 153 | Ga0495648_0156671 | 3300046524 | Bacteria | 1182 |
| 154 | Ga0495597_0052436 | 3300046542 | Bacteria | 1796 |
| 155 | Ga0495597_0096614 | 3300046542 | Bacteria | 1249 |
| 156 | Ga0495668_0000291 | 3300046616 | Bacteria | 68802 |
| 157 | Ga0495668_0005011 | 3300046616 | Bacteria | 9144 |
| 158 | Ga0495668_0013198 | 3300046616 | Bacteria | 4882 |
| 159 | Ga0495668_0021022 | 3300046616 | Bacteria | 3747 |
| 160 | Ga0495668_0034078 | 3300046616 | Bacteria | 2859 |
| 161 | Ga0495625_0000854 | 3300046660 | Bacteria | 41503 |
| 162 | Ga0495625_0031911 | 3300046660 | Bacteria | 3913 |
| 163 | Ga0495625_0040770 | 3300046660 | Bacteria | 3383 |
| 164 | Ga0495625_0050612 | 3300046660 | Bacteria | 2980 |
| 165 | Ga0495669_0000087 | 3300046684 | Bacteria | 61330 |
| 166 | Ga0495669_0000141 | 3300046684 | Bacteria | 45672 |
| 167 | Ga0495589_0002866 | 3300046794 | Bacteria | 9548 |
| 168 | Ga0495660_0121426 | 3300046810 | Bacteria | 1321 |
| 169 | Ga0495660_0137356 | 3300046810 | Bacteria | 1220 |
| 170 | Ga0495672_0002175 | 3300047320 | Bacteria | 18269 |
| 171 | Ga0495683_0008469 | 3300047323 | Bacteria | 5500 |
| 172 | Ga0495677_0020098 | 3300047445 | Bacteria | 2420 |
| 173 | Ga0495679_006471 | 3300047446 | Bacteria | 5034 |
| 174 | Ga0495673_0000102 | 3300047469 | Bacteria | 173343 |
| 175 | Ga0495673_0000440 | 3300047469 | Bacteria | 46059 |
| 176 | Ga0495673_0005029 | 3300047469 | Bacteria | 8099 |
| 177 | Ga0495686_0004110 | 3300047472 | Bacteria | 12116 |
| 178 | Ga0495686_0009130 | 3300047472 | Bacteria | 7184 |
| 179 | Ga0495686_0014098 | 3300047472 | Bacteria | 5517 |
| 180 | Ga0495686_0030378 | 3300047472 | Bacteria | 3509 |
| 181 | Ga0496100_0312367 | 3300048903 | Bacteria | 1179 |
| 182 | Ga0496112_0072564 | 3300048915 | Bacteria | 3403 |
| 183 | Ga0496115_0006315 | 3300048918 | Bacteria | 8674 |
| 184 | Ga0496115_0105834 | 3300048918 | Bacteria | 2309 |
| 185 | Ga0496117_0072457 | 3300048920 | Bacteria | 2303 |
| 186 | Ga0496125_0082808 | 3300048928 | Bacteria | 2444 |
| 187 | Ga0496126_0005632 | 3300048929 | Bacteria | 14243 |
| 188 | Ga0496126_0048146 | 3300048929 | Bacteria | 3898 |
| 189 | Ga0495678_000563 | 3300049459 | Bacteria | 35633 |
| 190 | Ga0501044_0434212 | 3300049823 | Bacteria | 1222 |
| 191 | nmdc:mga03683_1127_c1 | 3300050489 | Bacteria | 7836 |
| 192 | nmdc:mga03n38_1732_c2 | 3300050490 | Bacteria | 6150 |
| 193 | nmdc:mga06z11_2550_c1 | 3300050494 | Bacteria | 6968 |
| 194 | nmdc:mga0sz30_1789_c1 | 3300050516 | Bacteria | 7638 |
| 195 | Ga0500578_0000077 | 3300053086 | Bacteria | 108269 |
| 196 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 197 | Ga0500643_005040 | 3300053087 | Bacteria | 5778 |
| 198 | Ga0500643_033992 | 3300053087 | Bacteria | 1538 |
| 199 | Ga0500644_0000484 | 3300053088 | Bacteria | 17526 |
| 200 | Ga0500651_0125403 | 3300053093 | Bacteria | 1556 |
| 201 | Ga0500554_031001 | 3300053102 | Bacteria | 1575 |
| 202 | Ga0500555_023541 | 3300053103 | Bacteria | 1766 |
| 203 | Ga0500556_0001178 | 3300053104 | Bacteria | 12481 |
| 204 | Ga0500556_0025666 | 3300053104 | Bacteria | 1949 |
| 205 | Ga0500562_000468 | 3300053108 | Bacteria | 9787 |
| 206 | Ga0500562_006395 | 3300053108 | Bacteria | 2970 |
| 207 | Ga0500594_0000065 | 3300053118 | Bacteria | 33136 |
| 208 | Ga0500595_007155 | 3300053119 | Bacteria | 4656 |
| 209 | Ga0500608_000092 | 3300053122 | Bacteria | 37052 |
| 210 | Ga0500608_084091 | 3300053122 | Bacteria | 1497 |
| 211 | Ga0500618_000206 | 3300053125 | Bacteria | 46857 |
| 212 | Ga0500559_0000212 | 3300053136 | Bacteria | 46705 |
| 213 | Ga0500559_0002654 | 3300053136 | Bacteria | 9110 |
| 214 | Ga0500559_0016604 | 3300053136 | Bacteria | 3109 |
| 215 | Ga0500564_000040 | 3300053138 | Bacteria | 35132 |
| 216 | Ga0500577_0001326 | 3300053142 | Bacteria | 6335 |
| 217 | Ga0500622_0006971 | 3300053156 | Bacteria | 6469 |
| 218 | Ga0500645_001126 | 3300053730 | Bacteria | 14562 |
| 219 | Ga0500645_003887 | 3300053730 | Bacteria | 5904 |
| 220 | Ga0500645_004645 | 3300053730 | Bacteria | 5227 |
| 221 | Ga0500645_009567 | 3300053730 | Bacteria | 3250 |
| 222 | Ga0500645_023482 | 3300053730 | Bacteria | 1890 |
| 223 | Ga0500609_010835 | 3300053731 | Bacteria | 1230 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031247 | Ga0265340_10001670 | Ga0265340_100016705 | 255 |
| 2 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_470908_471819 | 258 |
| 3 | 3300027876 | Ga0209974_10003411 | Ga0209974_100034113 | 260 |
| 4 | 3300005841 | Ga0068863_100326208 | Ga0068863_1003262082 | 262 |
| 5 | 3300006177 | Ga0075362_10001778 | Ga0075362_100017788 | 262 |
| 6 | 3300009553 | Ga0105249_10304081 | Ga0105249_103040813 | 262 |
| 7 | 3300013102 | Ga0157371_10029135 | Ga0157371_100291353 | 262 |
| 8 | 3300025972 | Ga0207668_10113136 | Ga0207668_101131362 | 262 |
| 9 | 3300026088 | Ga0207641_10125420 | Ga0207641_101254202 | 262 |
| 10 | 3300050489 | nmdc:mga03683_1127_c1 | nmdc:mga03683_1127_c1_6549_7490 | 262 |
| 11 | 3300005616 | Ga0068852_100151768 | Ga0068852_1001517682 | 263 |
| 12 | 3300046459 | Ga0495629_0011287 | Ga0495629_0011287_515_1465 | 263 |
| 13 | 3300053087 | Ga0500643_033992 | Ga0500643_033992_473_1420 | 264 |
| 14 | 3300053104 | Ga0500556_0025666 | Ga0500556_0025666_967_1923 | 264 |
| 15 | 3300053108 | Ga0500562_006395 | Ga0500562_006395_1769_2725 | 264 |
| 16 | 3300009093 | Ga0105240_10000449 | Ga0105240_1000044913 | 265 |
| 17 | 3300025913 | Ga0207695_10000565 | Ga0207695_1000056558 | 265 |
| 18 | 3300048929 | Ga0496126_0048146 | Ga0496126_0048146_1124_2059 | 267 |
| 19 | 3300049823 | Ga0501044_0434212 | Ga0501044_0434212_371_1210 | 267 |
| 20 | 3300037471 | Ga0395905_0127991 | Ga0395905_0127991_961_1965 | 268 |
| 21 | 3300005336 | Ga0070680_100131842 | Ga0070680_1001318422 | 270 |
| 22 | 3300005339 | Ga0070660_100433104 | Ga0070660_1004331041 | 270 |
| 23 | 3300013100 | Ga0157373_10085359 | Ga0157373_100853594 | 270 |
| 24 | 3300025919 | Ga0207657_10032897 | Ga0207657_100328973 | 270 |
| 25 | 3300036647 | Ga0316582_0046496 | Ga0316582_0046496_1824_2717 | 270 |
| 26 | 3300046684 | Ga0495669_0000141 | Ga0495669_0000141_27416_28387 | 270 |
| 27 | 3300047445 | Ga0495677_0020098 | Ga0495677_0020098_1242_2213 | 270 |
| 28 | iso_pu_bacteria | 2896253425 | 2896254466 | 270 |
| 29 | 3300005578 | Ga0068854_100006277 | Ga0068854_1000062773 | 272 |
| 30 | 3300005614 | Ga0068856_100019971 | Ga0068856_1000199711 | 272 |
| 31 | 3300005616 | Ga0068852_100001919 | Ga0068852_10000191910 | 272 |
| 32 | 3300005937 | Ga0081455_10001550 | Ga0081455_100015507 | 272 |
| 33 | 3300005937 | Ga0081455_10043173 | Ga0081455_100431732 | 272 |
| 34 | 3300005985 | Ga0081539_10010332 | Ga0081539_100103325 | 272 |
| 35 | 3300009177 | Ga0105248_10146101 | Ga0105248_101461012 | 272 |
| 36 | 3300009551 | Ga0105238_10053418 | Ga0105238_100534184 | 272 |
| 37 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009406 | 272 |
| 38 | 3300025913 | Ga0207695_10008077 | Ga0207695_100080774 | 272 |
| 39 | 3300025924 | Ga0207694_10028956 | Ga0207694_100289562 | 272 |
| 40 | 3300025981 | Ga0207640_10000192 | Ga0207640_100001923 | 272 |
| 41 | 3300026078 | Ga0207702_10004160 | Ga0207702_100041602 | 272 |
| 42 | 3300026142 | Ga0207698_10000084 | Ga0207698_1000008429 | 272 |
| 43 | 3300031733 | Ga0316577_10003812 | Ga0316577_100038123 | 272 |
| 44 | 3300046684 | Ga0495669_0000087 | Ga0495669_0000087_9414_10373 | 272 |
| 45 | 3300005539 | Ga0068853_100294821 | Ga0068853_1002948212 | 273 |
| 46 | 3300026041 | Ga0207639_10156507 | Ga0207639_101565071 | 273 |
| 47 | 3300046616 | Ga0495668_0034078 | Ga0495668_0034078_317_1324 | 273 |
| 48 | 3300053102 | Ga0500554_031001 | Ga0500554_031001_98_1099 | 273 |
| 49 | 3300005365 | Ga0070688_100069127 | Ga0070688_1000691273 | 274 |
| 50 | 3300006881 | Ga0068865_100000422 | Ga0068865_10000042219 | 274 |
| 51 | 3300009553 | Ga0105249_10205012 | Ga0105249_102050122 | 274 |
| 52 | 3300013306 | Ga0163162_10177499 | Ga0163162_101774992 | 274 |
| 53 | 3300025938 | Ga0207704_10008938 | Ga0207704_100089382 | 274 |
| 54 | 3300048918 | Ga0496115_0006315 | Ga0496115_0006315_5059_6048 | 274 |
| 55 | 3300053087 | Ga0500643_005040 | Ga0500643_005040_3121_4086 | 274 |
| 56 | 3300053730 | Ga0500645_001126 | Ga0500645_001126_11273_12238 | 274 |
| 57 | 3300005336 | Ga0070680_100243503 | Ga0070680_1002435032 | 275 |
| 58 | 3300046512 | Ga0495610_0002431 | Ga0495610_0002431_8044_9039 | 275 |
| 59 | 3300006178 | Ga0075367_10010200 | Ga0075367_100102004 | 276 |
| 60 | 3300006353 | Ga0075370_10095634 | Ga0075370_100956342 | 276 |
| 61 | 3300010375 | Ga0105239_10000051 | Ga0105239_1000005145 | 276 |
| 62 | 3300031731 | Ga0307405_10003498 | Ga0307405_100034983 | 276 |
| 63 | 3300045051 | Ga0451576_0177870 | Ga0451576_0177870_273_1208 | 276 |
| 64 | 3300048920 | Ga0496117_0072457 | Ga0496117_0072457_319_1179 | 276 |
| 65 | 3300050490 | nmdc:mga03n38_1732_c2 | nmdc:mga03n38_1732_c2_3606_4562 | 276 |
| 66 | 3300050494 | nmdc:mga06z11_2550_c1 | nmdc:mga06z11_2550_c1_1162_2118 | 276 |
| 67 | 3300053730 | Ga0500645_004645 | Ga0500645_004645_2955_3911 | 276 |
| 68 | 3300005355 | Ga0070671_100063415 | Ga0070671_1000634152 | 277 |
| 69 | 3300005563 | Ga0068855_100549579 | Ga0068855_1005495792 | 277 |
| 70 | 3300025949 | Ga0207667_10469432 | Ga0207667_104694321 | 277 |
| 71 | 3300041486 | Ga0451807_1460733 | Ga0451807_1460733_839_1759 | 277 |
| 72 | 3300046520 | Ga0495637_0052615 | Ga0495637_0052615_651_1661 | 277 |
| 73 | 3300046810 | Ga0495660_0137356 | Ga0495660_0137356_48_1076 | 277 |
| 74 | 3300047472 | Ga0495686_0014098 | Ga0495686_0014098_316_1182 | 277 |
| 75 | 3300053730 | Ga0500645_003887 | Ga0500645_003887_4344_5330 | 277 |
| 76 | 3300053730 | Ga0500645_023482 | Ga0500645_023482_552_1529 | 277 |
| 77 | 3300003773 | Ga0055537_1001453 | Ga0055537_10014532 | 278 |
| 78 | 3300005262 | Ga0065165_1001205 | Ga0065165_10012053 | 278 |
| 79 | 3300005340 | Ga0070689_100082374 | Ga0070689_1000823743 | 278 |
| 80 | 3300005539 | Ga0068853_100318778 | Ga0068853_1003187782 | 278 |
| 81 | 3300005578 | Ga0068854_100139791 | Ga0068854_1001397912 | 278 |
| 82 | 3300025263 | Ga0209565_1000636 | Ga0209565_100063612 | 278 |
| 83 | 3300025273 | Ga0209673_1002816 | Ga0209673_10028161 | 278 |
| 84 | 3300025295 | Ga0209564_1031670 | Ga0209564_10316701 | 278 |
| 85 | 3300025297 | Ga0209758_1011378 | Ga0209758_10113782 | 278 |
| 86 | 3300025298 | Ga0209050_1046970 | Ga0209050_10469701 | 278 |
| 87 | 3300025299 | Ga0209256_1002061 | Ga0209256_10020619 | 278 |
| 88 | 3300025299 | Ga0209256_1006016 | Ga0209256_10060163 | 278 |
| 89 | 3300025304 | Ga0209257_1000427 | Ga0209257_100042736 | 278 |
| 90 | 3300028794 | Ga0307515_10013510 | Ga0307515_1001351010 | 278 |
| 91 | 3300033180 | Ga0307510_10048543 | Ga0307510_100485432 | 278 |
| 92 | 3300042438 | Ga0439459_0018398 | Ga0439459_0018398_43_1038 | 278 |
| 93 | 3300042876 | Ga0451577_0149540 | Ga0451577_0149540_1069_2049 | 278 |
| 94 | 3300046460 | Ga0495638_0001503 | Ga0495638_0001503_4064_5068 | 278 |
| 95 | 3300046471 | Ga0495650_0000024 | Ga0495650_0000024_165659_166669 | 278 |
| 96 | 3300046501 | Ga0495607_0076020 | Ga0495607_0076020_313_1311 | 278 |
| 97 | 3300046506 | Ga0495583_0000003 | Ga0495583_0000003_97117_98166 | 278 |
| 98 | 3300046512 | Ga0495610_0006012 | Ga0495610_0006012_3542_4555 | 278 |
| 99 | 3300046513 | Ga0495616_0002189 | Ga0495616_0002189_5802_6806 | 278 |
| 100 | 3300046519 | Ga0495632_0010499 | Ga0495632_0010499_1257_2255 | 278 |
| 101 | 3300046520 | Ga0495637_0023258 | Ga0495637_0023258_979_1989 | 278 |
| 102 | 3300046524 | Ga0495648_0156671 | Ga0495648_0156671_90_1088 | 278 |
| 103 | 3300046542 | Ga0495597_0096614 | Ga0495597_0096614_167_1168 | 278 |
| 104 | 3300046616 | Ga0495668_0013198 | Ga0495668_0013198_2756_3754 | 278 |
| 105 | 3300046660 | Ga0495625_0000854 | Ga0495625_0000854_12718_13734 | 278 |
| 106 | 3300046660 | Ga0495625_0031911 | Ga0495625_0031911_2666_3682 | 278 |
| 107 | 3300046660 | Ga0495625_0040770 | Ga0495625_0040770_2365_3354 | 278 |
| 108 | 3300046810 | Ga0495660_0121426 | Ga0495660_0121426_209_1204 | 278 |
| 109 | 3300047320 | Ga0495672_0002175 | Ga0495672_0002175_13175_14176 | 278 |
| 110 | 3300047323 | Ga0495683_0008469 | Ga0495683_0008469_4317_5315 | 278 |
| 111 | 3300047446 | Ga0495679_006471 | Ga0495679_006471_2772_3785 | 278 |
| 112 | 3300047469 | Ga0495673_0005029 | Ga0495673_0005029_6920_7933 | 278 |
| 113 | 3300047472 | Ga0495686_0030378 | Ga0495686_0030378_2332_3342 | 278 |
| 114 | 3300048918 | Ga0496115_0105834 | Ga0496115_0105834_1212_2228 | 278 |
| 115 | 3300053093 | Ga0500651_0125403 | Ga0500651_0125403_37_1032 | 278 |
| 116 | 3300053103 | Ga0500555_023541 | Ga0500555_023541_668_1672 | 278 |
| 117 | 3300053104 | Ga0500556_0001178 | Ga0500556_0001178_7881_8891 | 278 |
| 118 | 3300053108 | Ga0500562_000468 | Ga0500562_000468_1235_2164 | 278 |
| 119 | 3300053122 | Ga0500608_084091 | Ga0500608_084091_349_1374 | 278 |
| 120 | 3300053125 | Ga0500618_000206 | Ga0500618_000206_18135_19148 | 278 |
| 121 | 3300053136 | Ga0500559_0000212 | Ga0500559_0000212_2327_3343 | 278 |
| 122 | 3300053136 | Ga0500559_0002654 | Ga0500559_0002654_508_1545 | 278 |
| 123 | 3300053730 | Ga0500645_009567 | Ga0500645_009567_1746_2756 | 278 |
| 124 | 3300053731 | Ga0500609_010835 | Ga0500609_010835_134_1138 | 278 |
| 125 | iso_pu_bacteria | 2582581280 | 2585153913 | 278 |
| 126 | iso_pu_bacteria | 2582581293 | 2585194906 | 278 |
| 127 | iso_pu_bacteria | 2643221545 | 2643747298 | 278 |
| 128 | iso_pu_bacteria | 2643221552 | 2643779893 | 278 |
| 129 | iso_pu_bacteria | 2643221584 | 2643929919 | 278 |
| 130 | iso_pu_bacteria | 2643221691 | 2644507504 | 278 |
| 131 | iso_pu_bacteria | 2818991435 | 2819540488 | 278 |
| 132 | iso_pu_bacteria | 2818991454 | 2819649450 | 278 |
| 133 | 3300003215 | JGI25153J46596_10053517 | JGI25153J46596_100535171 | 279 |
| 134 | 3300003781 | Ga0055536_1002121 | Ga0055536_10021217 | 279 |
| 135 | 3300003781 | Ga0055536_1002883 | Ga0055536_10028835 | 279 |
| 136 | 3300003791 | Ga0055530_10001223 | Ga0055530_1000122315 | 279 |
| 137 | 3300003791 | Ga0055530_10001792 | Ga0055530_1000179211 | 279 |
| 138 | 3300003791 | Ga0055530_10004611 | Ga0055530_100046113 | 279 |
| 139 | 3300003794 | Ga0055531_10001551 | Ga0055531_100015513 | 279 |
| 140 | 3300003794 | Ga0055531_10003795 | Ga0055531_100037955 | 279 |
| 141 | 3300003794 | Ga0055531_10023915 | Ga0055531_100239152 | 279 |
| 142 | 3300005262 | Ga0065165_1000030 | Ga0065165_1000030167 | 279 |
| 143 | 3300005331 | Ga0070670_100069682 | Ga0070670_1000696823 | 279 |
| 144 | 3300005355 | Ga0070671_100000700 | Ga0070671_1000007003 | 279 |
| 145 | 3300005367 | Ga0070667_100019106 | Ga0070667_1000191065 | 279 |
| 146 | 3300005548 | Ga0070665_100095298 | Ga0070665_1000952982 | 279 |
| 147 | 3300005617 | Ga0068859_100004151 | Ga0068859_1000041514 | 279 |
| 148 | 3300005841 | Ga0068863_100000726 | Ga0068863_10000072617 | 279 |
| 149 | 3300005842 | Ga0068858_100001315 | Ga0068858_10000131519 | 279 |
| 150 | 3300005843 | Ga0068860_100059602 | Ga0068860_1000596023 | 279 |
| 151 | 3300006028 | Ga0070717_10034972 | Ga0070717_100349724 | 279 |
| 152 | 3300006186 | Ga0075369_10007240 | Ga0075369_100072403 | 279 |
| 153 | 3300006195 | Ga0075366_10013645 | Ga0075366_100136454 | 279 |
| 154 | 3300006931 | Ga0097620_100004150 | Ga0097620_1000041504 | 279 |
| 155 | 3300009093 | Ga0105240_10240423 | Ga0105240_102404232 | 279 |
| 156 | 3300009101 | Ga0105247_10222417 | Ga0105247_102224171 | 279 |
| 157 | 3300009177 | Ga0105248_10016861 | Ga0105248_100168618 | 279 |
| 158 | 3300009545 | Ga0105237_10080662 | Ga0105237_100806625 | 279 |
| 159 | 3300009551 | Ga0105238_10011022 | Ga0105238_1001102211 | 279 |
| 160 | 3300013306 | Ga0163162_10271813 | Ga0163162_102718132 | 279 |
| 161 | 3300013307 | Ga0157372_10793251 | Ga0157372_107932512 | 279 |
| 162 | 3300014325 | Ga0163163_10004569 | Ga0163163_100045692 | 279 |
| 163 | 3300014968 | Ga0157379_10022592 | Ga0157379_100225925 | 279 |
| 164 | 3300025292 | Ga0209676_1000253 | Ga0209676_100025366 | 279 |
| 165 | 3300025292 | Ga0209676_1000262 | Ga0209676_100026297 | 279 |
| 166 | 3300025297 | Ga0209758_1000516 | Ga0209758_100051631 | 279 |
| 167 | 3300025298 | Ga0209050_1000090 | Ga0209050_100009065 | 279 |
| 168 | 3300025298 | Ga0209050_1000411 | Ga0209050_100041170 | 279 |
| 169 | 3300025298 | Ga0209050_1000948 | Ga0209050_100094820 | 279 |
| 170 | 3300025304 | Ga0209257_1000059 | Ga0209257_100005912 | 279 |
| 171 | 3300025304 | Ga0209257_1001169 | Ga0209257_100116915 | 279 |
| 172 | 3300025304 | Ga0209257_1003785 | Ga0209257_100378510 | 279 |
| 173 | 3300025304 | Ga0209257_1010039 | Ga0209257_10100395 | 279 |
| 174 | 3300025911 | Ga0207654_10123700 | Ga0207654_101237002 | 279 |
| 175 | 3300025914 | Ga0207671_10070311 | Ga0207671_100703112 | 279 |
| 176 | 3300025923 | Ga0207681_10003581 | Ga0207681_100035812 | 279 |
| 177 | 3300025924 | Ga0207694_10025639 | Ga0207694_100256393 | 279 |
| 178 | 3300025924 | Ga0207694_10247868 | Ga0207694_102478682 | 279 |
| 179 | 3300025925 | Ga0207650_10050950 | Ga0207650_100509502 | 279 |
| 180 | 3300025931 | Ga0207644_10005991 | Ga0207644_100059915 | 279 |
| 181 | 3300025941 | Ga0207711_10011290 | Ga0207711_100112904 | 279 |
| 182 | 3300025941 | Ga0207711_10086476 | Ga0207711_100864763 | 279 |
| 183 | 3300025986 | Ga0207658_10007678 | Ga0207658_100076783 | 279 |
| 184 | 3300026035 | Ga0207703_10001867 | Ga0207703_1000186713 | 279 |
| 185 | 3300026088 | Ga0207641_10002949 | Ga0207641_100029493 | 279 |
| 186 | 3300026142 | Ga0207698_10310183 | Ga0207698_103101832 | 279 |
| 187 | 3300027378 | Ga0209981_1006398 | Ga0209981_10063982 | 279 |
| 188 | 3300028381 | Ga0268264_10018502 | Ga0268264_100185023 | 279 |
| 189 | 3300028786 | Ga0307517_10061707 | Ga0307517_100617072 | 279 |
| 190 | 3300028794 | Ga0307515_10046901 | Ga0307515_100469015 | 279 |
| 191 | 3300031456 | Ga0307513_10003803 | Ga0307513_1000380310 | 279 |
| 192 | 3300031456 | Ga0307513_10026601 | Ga0307513_100266012 | 279 |
| 193 | 3300035695 | Ga0373927_0000880 | Ga0373927_0000880_3294_4277 | 279 |
| 194 | 3300037068 | Ga0373925_0001027 | Ga0373925_0001027_5841_6824 | 279 |
| 195 | 3300037312 | Ga0395899_0000091 | Ga0395899_0000091_79544_80554 | 279 |
| 196 | 3300037418 | Ga0395900_0000008 | Ga0395900_0000008_405223_406233 | 279 |
| 197 | 3300037471 | Ga0395905_0073216 | Ga0395905_0073216_413_1423 | 279 |
| 198 | 3300038443 | Ga0395901_0000008 | Ga0395901_0000008_74227_75237 | 279 |
| 199 | 3300044683 | Ga0466965_0124292 | Ga0466965_0124292_307_1308 | 279 |
| 200 | 3300046453 | Ga0495627_004036 | Ga0495627_004036_5158_6165 | 279 |
| 201 | 3300046457 | Ga0495590_0000213 | Ga0495590_0000213_20643_21638 | 279 |
| 202 | 3300046460 | Ga0495638_0001702 | Ga0495638_0001702_5235_6230 | 279 |
| 203 | 3300046460 | Ga0495638_0139354 | Ga0495638_0139354_162_1166 | 279 |
| 204 | 3300046512 | Ga0495610_0010562 | Ga0495610_0010562_4612_5607 | 279 |
| 205 | 3300046518 | Ga0495631_0009134 | Ga0495631_0009134_1443_2438 | 279 |
| 206 | 3300046520 | Ga0495637_0040285 | Ga0495637_0040285_58_1053 | 279 |
| 207 | 3300046524 | Ga0495648_0000391 | Ga0495648_0000391_17179_18192 | 279 |
| 208 | 3300046542 | Ga0495597_0052436 | Ga0495597_0052436_708_1703 | 279 |
| 209 | 3300046616 | Ga0495668_0000291 | Ga0495668_0000291_52294_53301 | 279 |
| 210 | 3300046616 | Ga0495668_0005011 | Ga0495668_0005011_3244_4239 | 279 |
| 211 | 3300046616 | Ga0495668_0021022 | Ga0495668_0021022_1458_2468 | 279 |
| 212 | 3300046660 | Ga0495625_0050612 | Ga0495625_0050612_33_1031 | 279 |
| 213 | 3300046794 | Ga0495589_0002866 | Ga0495589_0002866_8225_9223 | 279 |
| 214 | 3300047469 | Ga0495673_0000102 | Ga0495673_0000102_22620_23624 | 279 |
| 215 | 3300047469 | Ga0495673_0000440 | Ga0495673_0000440_29408_30421 | 279 |
| 216 | 3300047472 | Ga0495686_0004110 | Ga0495686_0004110_6502_7497 | 279 |
| 217 | 3300047472 | Ga0495686_0009130 | Ga0495686_0009130_1216_2202 | 279 |
| 218 | 3300048903 | Ga0496100_0312367 | Ga0496100_0312367_83_1066 | 279 |
| 219 | 3300048915 | Ga0496112_0072564 | Ga0496112_0072564_1736_2743 | 279 |
| 220 | 3300048928 | Ga0496125_0082808 | Ga0496125_0082808_362_1369 | 279 |
| 221 | 3300048929 | Ga0496126_0005632 | Ga0496126_0005632_1509_2510 | 279 |
| 222 | 3300049459 | Ga0495678_000563 | Ga0495678_000563_4815_5822 | 279 |
| 223 | 3300050516 | nmdc:mga0sz30_1789_c1 | nmdc:mga0sz30_1789_c1_1013_2017 | 279 |
| 224 | 3300053086 | Ga0500578_0000077 | Ga0500578_0000077_77396_78403 | 279 |
| 225 | 3300053088 | Ga0500644_0000484 | Ga0500644_0000484_3411_4424 | 279 |
| 226 | 3300053118 | Ga0500594_0000065 | Ga0500594_0000065_22114_23121 | 279 |
| 227 | 3300053119 | Ga0500595_007155 | Ga0500595_007155_1007_1879 | 279 |
| 228 | 3300053122 | Ga0500608_000092 | Ga0500608_000092_32550_33548 | 279 |
| 229 | 3300053136 | Ga0500559_0016604 | Ga0500559_0016604_234_1244 | 279 |
| 230 | 3300053138 | Ga0500564_000040 | Ga0500564_000040_4288_5301 | 279 |
| 231 | 3300053142 | Ga0500577_0001326 | Ga0500577_0001326_3959_4966 | 279 |
| 232 | 3300053156 | Ga0500622_0006971 | Ga0500622_0006971_3211_4218 | 279 |
| 233 | iso_pu_bacteria | 2510917020 | 2511122948 | 279 |
| 234 | iso_pu_bacteria | 2582581279 | 2585148857 | 279 |
| 235 | iso_pu_bacteria | 2585428106 | 2587917034 | 279 |
| 236 | iso_pu_bacteria | 2643221583 | 2643924549 | 279 |
| 237 | iso_pu_bacteria | 2643221640 | 2644223761 | 279 |
| 238 | iso_pu_bacteria | 2643221642 | 2644236151 | 279 |
| 239 | iso_pu_bacteria | 2791355048 | 2792458527 | 279 |
| 240 | iso_pu_bacteria | 2843744320 | 2843745184 | 279 |
| 241 | iso_pu_bacteria | 2849560528 | 2849564024 | 279 |
| 242 | iso_pu_bacteria | 2851153111 | 2851157512 | 279 |
| 243 | iso_pu_bacteria | 2857504554 | 2857506157 | 279 |
| 244 | iso_pu_bacteria | 2884960567 | 2884963429 | 279 |
| 245 | iso_pu_bacteria | 2898329390 | 2898332147 | 279 |
| 246 | iso_pu_bacteria | 2928531327 | 2928534650 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8f6k-assembly1.cif.gz_D | cryo-em structure of a zinc-loaded h263a/d287a mutant of the yiip-fab complex | 0.7084 | 4 | 263 |
| 5vrf-assembly1.cif.gz_A | cryoem structure of the zinc transporter yiip from helical crystals | 0.6903 | 4 | 266 |
| 8f6j-assembly1.cif.gz_A | cryo-em structure of a zinc-loaded d287a mutant of the yiip-fab complex | 0.6858 | 1 | 265 |
| 8f6k-assembly1.cif.gz_C | cryo-em structure of a zinc-loaded h263a/d287a mutant of the yiip-fab complex | 0.6841 | 1 | 263 |
| 6xpf-assembly1.cif.gz_A | cryo-em structure of human znt8 wt, in the absence of zinc, determined in heterogeneous conformations- one subunit in an inward-facing and the other in an outward-facing conformation | 0.6777 | 5 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75757_17_213_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9256 | 1 | 193 | 1.20.1510.10 |
| af_O35149_110_332_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9106 | 5 | 194 | 1.20.1510.10 |
| af_Q9M271_29_255_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9074 | 1 | 194 | 1.20.1510.10 |
| af_P75757_17_213_1.20.1510.10 | Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain | 0.9034 | 1 | 193 | 1.20.1510.10 |
| af_I1LJX9_58_316_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8846 | 2 | 192 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F5FB86-F1-model_v4 | Cation transporter | 0.9475 | 5 | 188 |
GO:0005385
GO:0005886 |
| AF-A0A4Y8CC03-F1-model_v4 | Cation transporter | 0.9406 | 5 | 188 |
GO:0005385
GO:0005886 |
| AF-A0A2G9YP09-F1-model_v4 | Cation transporter | 0.9388 | 8 | 183 |
GO:0005385
GO:0005886 |
| AF-A0A2G0E7G7-F1-model_v4 | Cation transporter | 0.9234 | 2 | 177 |
GO:0005385
GO:0005886 |
| AF-A0A6L6JIN2-F1-model_v4 | Cation transporter | 0.9214 | 5 | 188 |
GO:0005385
GO:0005886 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar