F358560

General Info

Members Datasets Scaffolds Average Seq Length
246 174 223 297

Family's Representative Sequence

Representative Sequence 3300053102|Ga0500554_031001|Ga0500554_031001_98_1099
Length 291
Sequence MPHDHPKDFGRAFAIGATLNIGFVIAETIAGLMTHSLALLADAGHNLSDVLGLFMAWGAVILAKRAPAGRHTYGLRKGTILASLTNAVVLLVAVGAIAWEAVRRFADPQPIQTGPVMIVAAIGIVINTATALMFMKGSKDDLNIRGAFLHMAADAAISAGVVLWATGWLWLDPVVSLGIVVVIVLGTWSLLRDSLDLALDAAPRGIDPKAVGDWLAGRPGVTEVHDLHIWAMSTTETAMTAHLVRPENPDNDRFLHDICGEMSKRFNIGHVTIQVESGGVATCHLAGADAV

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2851153111 Caulobacter radicis 736 Isolate Unclassified
19 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
20 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
21 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
105 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
106 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
125 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
126 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
150 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
158 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
159 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
160 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
161 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
162 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
163 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
164 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
165 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
168 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
169 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
170 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
171 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
172 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
173 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
174 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.65
Metatranscriptomes 0
Isolates 9.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.64
Nodule 0
Rhizoplane 2.03
Rhizosphere 61.38
Stem 0
Stem Tuber 0
Unclassified 8.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10053517 3300003215 Bacteria 1141
2 Ga0055537_1001453 3300003773 Bacteria 9220
3 Ga0055536_1002121 3300003781 Bacteria 11290
4 Ga0055536_1002883 3300003781 Bacteria 9451
5 Ga0055530_10001223 3300003791 Bacteria 19641
6 Ga0055530_10001792 3300003791 Bacteria 14916
7 Ga0055530_10004611 3300003791 Bacteria 7017
8 Ga0055531_10001551 3300003794 Bacteria 16821
9 Ga0055531_10003795 3300003794 Bacteria 9486
10 Ga0055531_10023915 3300003794 Bacteria 2273
11 Ga0065165_1000030 3300005262 Bacteria 218104
12 Ga0065165_1001205 3300005262 Bacteria 29843
13 Ga0070670_100069682 3300005331 Bacteria 3019
14 Ga0070680_100131842 3300005336 Bacteria 2091
15 Ga0070680_100243503 3300005336 Bacteria 1520
16 Ga0070660_100433104 3300005339 Bacteria 1090
17 Ga0070689_100082374 3300005340 Bacteria 2527
18 Ga0070671_100000700 3300005355 Bacteria 24031
19 Ga0070671_100063415 3300005355 Bacteria 3077
20 Ga0070688_100069127 3300005365 Bacteria 2254
21 Ga0070667_100019106 3300005367 Bacteria 5683
22 Ga0068853_100294821 3300005539 Bacteria 1498
23 Ga0068853_100318778 3300005539 Bacteria 1441
24 Ga0070665_100095298 3300005548 Bacteria 2981
25 Ga0068855_100549579 3300005563 Bacteria 1250
26 Ga0068854_100006277 3300005578 Bacteria 7556
27 Ga0068854_100139791 3300005578 Bacteria 1857
28 Ga0068856_100019971 3300005614 Bacteria 6504
29 Ga0068852_100001919 3300005616 Bacteria 14168
30 Ga0068852_100151768 3300005616 Bacteria 2155
31 Ga0068859_100004151 3300005617 Bacteria 14797
32 Ga0068863_100000726 3300005841 Bacteria 33034
33 Ga0068863_100326208 3300005841 Bacteria 1492
34 Ga0068858_100001315 3300005842 Bacteria 25647
35 Ga0068860_100059602 3300005843 Bacteria 3628
36 Ga0081455_10001550 3300005937 Bacteria 28283
37 Ga0081455_10043173 3300005937 Bacteria 3947
38 Ga0081539_10010332 3300005985 Bacteria 7599
39 Ga0070717_10034972 3300006028 Bacteria 4064
40 Ga0075362_10001778 3300006177 Bacteria 7023
41 Ga0075367_10010200 3300006178 Bacteria 4926
42 Ga0075369_10007240 3300006186 Bacteria 4219
43 Ga0075366_10013645 3300006195 Bacteria 4631
44 Ga0075370_10095634 3300006353 Bacteria 1716
45 Ga0068865_100000422 3300006881 Bacteria 23636
46 Ga0097620_100004150 3300006931 Bacteria 14797
47 Ga0105240_10000449 3300009093 Bacteria 75827
48 Ga0105240_10240423 3300009093 Bacteria 2099
49 Ga0105247_10222417 3300009101 Bacteria 1278
50 Ga0105248_10016861 3300009177 Bacteria 8040
51 Ga0105248_10146101 3300009177 Bacteria 2668
52 Ga0105237_10080662 3300009545 Bacteria 3244
53 Ga0105238_10011022 3300009551 Bacteria 9089
54 Ga0105238_10053418 3300009551 Bacteria 4060
55 Ga0105249_10205012 3300009553 Bacteria 1932
56 Ga0105249_10304081 3300009553 Bacteria 1601
57 Ga0105239_10000051 3300010375 Bacteria 169036
58 Ga0157373_10085359 3300013100 Bacteria 2225
59 Ga0157371_10029135 3300013102 Bacteria 3996
60 Ga0163162_10177499 3300013306 Bacteria 2256
61 Ga0163162_10271813 3300013306 Bacteria 1827
62 Ga0157372_10793251 3300013307 Bacteria 1101
63 Ga0163163_10004569 3300014325 Bacteria 11814
64 Ga0157379_10022592 3300014968 Bacteria 5573
65 Ga0209565_1000636 3300025263 Bacteria 22843
66 Ga0209673_1002816 3300025273 Bacteria 11240
67 Ga0209676_1000253 3300025292 Bacteria 113412
68 Ga0209676_1000262 3300025292 Bacteria 111061
69 Ga0209564_1031670 3300025295 Bacteria 1610
70 Ga0209758_1000516 3300025297 Bacteria 62036
71 Ga0209758_1011378 3300025297 Bacteria 5162
72 Ga0209050_1000090 3300025298 Bacteria 253783
73 Ga0209050_1000411 3300025298 Bacteria 79805
74 Ga0209050_1000948 3300025298 Bacteria 37706
75 Ga0209050_1046970 3300025298 Bacteria 1129
76 Ga0209256_1002061 3300025299 Bacteria 17746
77 Ga0209256_1006016 3300025299 Bacteria 6641
78 Ga0209257_1000059 3300025304 Bacteria 378097
79 Ga0209257_1000427 3300025304 Bacteria 81007
80 Ga0209257_1001169 3300025304 Bacteria 33227
81 Ga0209257_1003785 3300025304 Bacteria 12469
82 Ga0209257_1010039 3300025304 Bacteria 4901
83 Ga0207705_10000009 3300025909 Bacteria 576128
84 Ga0207654_10123700 3300025911 Bacteria 1628
85 Ga0207695_10000565 3300025913 Bacteria 75825
86 Ga0207695_10008077 3300025913 Bacteria 13239
87 Ga0207671_10070311 3300025914 Bacteria 2609
88 Ga0207657_10032897 3300025919 Bacteria 4679
89 Ga0207681_10003581 3300025923 Bacteria 9674
90 Ga0207694_10025639 3300025924 Bacteria 4482
91 Ga0207694_10028956 3300025924 Bacteria 4224
92 Ga0207694_10247868 3300025924 Bacteria 1457
93 Ga0207650_10050950 3300025925 Bacteria 3063
94 Ga0207644_10005991 3300025931 Bacteria 7923
95 Ga0207704_10008938 3300025938 Bacteria 4814
96 Ga0207711_10011290 3300025941 Bacteria 7420
97 Ga0207711_10086476 3300025941 Bacteria 2749
98 Ga0207667_10469432 3300025949 Bacteria 1278
99 Ga0207668_10113136 3300025972 Bacteria 2040
100 Ga0207640_10000192 3300025981 Bacteria 43577
101 Ga0207658_10007678 3300025986 Bacteria 7345
102 Ga0207703_10001867 3300026035 Bacteria 18733
103 Ga0207639_10156507 3300026041 Bacteria 1915
104 Ga0207702_10004160 3300026078 Bacteria 12962
105 Ga0207641_10002949 3300026088 Bacteria 15387
106 Ga0207641_10125420 3300026088 Bacteria 2298
107 Ga0207698_10000084 3300026142 Bacteria 62453
108 Ga0207698_10310183 3300026142 Bacteria 1473
109 Ga0209981_1006398 3300027378 Bacteria 1576
110 Ga0209974_10003411 3300027876 Bacteria 5741
111 Ga0268264_10018502 3300028381 Bacteria 5698
112 Ga0307517_10061707 3300028786 Bacteria 3541
113 Ga0307515_10013510 3300028794 Bacteria 15249
114 Ga0307515_10046901 3300028794 Bacteria 6589
115 Ga0265340_10001670 3300031247 Bacteria 12768
116 Ga0307513_10003803 3300031456 Bacteria 20342
117 Ga0307513_10026601 3300031456 Bacteria 6665
118 Ga0307405_10003498 3300031731 Bacteria 7227
119 Ga0316577_10003812 3300031733 Bacteria 7679
120 Ga0307510_10048543 3300033180 Bacteria 4528
121 Ga0373927_0000880 3300035695 Bacteria 22844
122 Ga0316582_0046496 3300036647 Bacteria 2737
123 Ga0373925_0001027 3300037068 Bacteria 25268
124 Ga0395899_0000091 3300037312 Bacteria 154780
125 Ga0395900_0000008 3300037418 Bacteria 480459
126 Ga0395905_0073216 3300037471 Bacteria 3211
127 Ga0395905_0127991 3300037471 Bacteria 2388
128 Ga0395901_0000008 3300038443 Bacteria 495962
129 Ga0451807_1460733 3300041486 Bacteria 2588
130 Ga0439459_0018398 3300042438 Bacteria 1313
131 Ga0451577_0149540 3300042876 Unclassified 2101
132 Ga0466965_0124292 3300044683 Bacteria 1334
133 Ga0451576_0177870 3300045051 Bacteria 2221
134 Ga0495627_004036 3300046453 Bacteria 6258
135 Ga0495590_0000213 3300046457 Bacteria 31568
136 Ga0495629_0011287 3300046459 Bacteria 6491
137 Ga0495638_0001503 3300046460 Bacteria 21003
138 Ga0495638_0001702 3300046460 Bacteria 19352
139 Ga0495638_0139354 3300046460 Bacteria 1417
140 Ga0495650_0000024 3300046471 Bacteria 496674
141 Ga0495607_0076020 3300046501 Bacteria 1859
142 Ga0495583_0000003 3300046506 Bacteria 709273
143 Ga0495610_0002431 3300046512 Bacteria 15665
144 Ga0495610_0006012 3300046512 Bacteria 8480
145 Ga0495610_0010562 3300046512 Bacteria 5726
146 Ga0495616_0002189 3300046513 Bacteria 13072
147 Ga0495631_0009134 3300046518 Bacteria 4964
148 Ga0495632_0010499 3300046519 Bacteria 5476
149 Ga0495637_0023258 3300046520 Bacteria 2819
150 Ga0495637_0040285 3300046520 Bacteria 2012
151 Ga0495637_0052615 3300046520 Bacteria 1699
152 Ga0495648_0000391 3300046524 Bacteria 48012
153 Ga0495648_0156671 3300046524 Bacteria 1182
154 Ga0495597_0052436 3300046542 Bacteria 1796
155 Ga0495597_0096614 3300046542 Bacteria 1249
156 Ga0495668_0000291 3300046616 Bacteria 68802
157 Ga0495668_0005011 3300046616 Bacteria 9144
158 Ga0495668_0013198 3300046616 Bacteria 4882
159 Ga0495668_0021022 3300046616 Bacteria 3747
160 Ga0495668_0034078 3300046616 Bacteria 2859
161 Ga0495625_0000854 3300046660 Bacteria 41503
162 Ga0495625_0031911 3300046660 Bacteria 3913
163 Ga0495625_0040770 3300046660 Bacteria 3383
164 Ga0495625_0050612 3300046660 Bacteria 2980
165 Ga0495669_0000087 3300046684 Bacteria 61330
166 Ga0495669_0000141 3300046684 Bacteria 45672
167 Ga0495589_0002866 3300046794 Bacteria 9548
168 Ga0495660_0121426 3300046810 Bacteria 1321
169 Ga0495660_0137356 3300046810 Bacteria 1220
170 Ga0495672_0002175 3300047320 Bacteria 18269
171 Ga0495683_0008469 3300047323 Bacteria 5500
172 Ga0495677_0020098 3300047445 Bacteria 2420
173 Ga0495679_006471 3300047446 Bacteria 5034
174 Ga0495673_0000102 3300047469 Bacteria 173343
175 Ga0495673_0000440 3300047469 Bacteria 46059
176 Ga0495673_0005029 3300047469 Bacteria 8099
177 Ga0495686_0004110 3300047472 Bacteria 12116
178 Ga0495686_0009130 3300047472 Bacteria 7184
179 Ga0495686_0014098 3300047472 Bacteria 5517
180 Ga0495686_0030378 3300047472 Bacteria 3509
181 Ga0496100_0312367 3300048903 Bacteria 1179
182 Ga0496112_0072564 3300048915 Bacteria 3403
183 Ga0496115_0006315 3300048918 Bacteria 8674
184 Ga0496115_0105834 3300048918 Bacteria 2309
185 Ga0496117_0072457 3300048920 Bacteria 2303
186 Ga0496125_0082808 3300048928 Bacteria 2444
187 Ga0496126_0005632 3300048929 Bacteria 14243
188 Ga0496126_0048146 3300048929 Bacteria 3898
189 Ga0495678_000563 3300049459 Bacteria 35633
190 Ga0501044_0434212 3300049823 Bacteria 1222
191 nmdc:mga03683_1127_c1 3300050489 Bacteria 7836
192 nmdc:mga03n38_1732_c2 3300050490 Bacteria 6150
193 nmdc:mga06z11_2550_c1 3300050494 Bacteria 6968
194 nmdc:mga0sz30_1789_c1 3300050516 Bacteria 7638
195 Ga0500578_0000077 3300053086 Bacteria 108269
196 Ga0500643_000001 3300053087 Bacteria 1440111
197 Ga0500643_005040 3300053087 Bacteria 5778
198 Ga0500643_033992 3300053087 Bacteria 1538
199 Ga0500644_0000484 3300053088 Bacteria 17526
200 Ga0500651_0125403 3300053093 Bacteria 1556
201 Ga0500554_031001 3300053102 Bacteria 1575
202 Ga0500555_023541 3300053103 Bacteria 1766
203 Ga0500556_0001178 3300053104 Bacteria 12481
204 Ga0500556_0025666 3300053104 Bacteria 1949
205 Ga0500562_000468 3300053108 Bacteria 9787
206 Ga0500562_006395 3300053108 Bacteria 2970
207 Ga0500594_0000065 3300053118 Bacteria 33136
208 Ga0500595_007155 3300053119 Bacteria 4656
209 Ga0500608_000092 3300053122 Bacteria 37052
210 Ga0500608_084091 3300053122 Bacteria 1497
211 Ga0500618_000206 3300053125 Bacteria 46857
212 Ga0500559_0000212 3300053136 Bacteria 46705
213 Ga0500559_0002654 3300053136 Bacteria 9110
214 Ga0500559_0016604 3300053136 Bacteria 3109
215 Ga0500564_000040 3300053138 Bacteria 35132
216 Ga0500577_0001326 3300053142 Bacteria 6335
217 Ga0500622_0006971 3300053156 Bacteria 6469
218 Ga0500645_001126 3300053730 Bacteria 14562
219 Ga0500645_003887 3300053730 Bacteria 5904
220 Ga0500645_004645 3300053730 Bacteria 5227
221 Ga0500645_009567 3300053730 Bacteria 3250
222 Ga0500645_023482 3300053730 Bacteria 1890
223 Ga0500609_010835 3300053731 Bacteria 1230

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031247 Ga0265340_10001670 Ga0265340_100016705 255
2 3300053087 Ga0500643_000001 Ga0500643_000001_470908_471819 258
3 3300027876 Ga0209974_10003411 Ga0209974_100034113 260
4 3300005841 Ga0068863_100326208 Ga0068863_1003262082 262
5 3300006177 Ga0075362_10001778 Ga0075362_100017788 262
6 3300009553 Ga0105249_10304081 Ga0105249_103040813 262
7 3300013102 Ga0157371_10029135 Ga0157371_100291353 262
8 3300025972 Ga0207668_10113136 Ga0207668_101131362 262
9 3300026088 Ga0207641_10125420 Ga0207641_101254202 262
10 3300050489 nmdc:mga03683_1127_c1 nmdc:mga03683_1127_c1_6549_7490 262
11 3300005616 Ga0068852_100151768 Ga0068852_1001517682 263
12 3300046459 Ga0495629_0011287 Ga0495629_0011287_515_1465 263
13 3300053087 Ga0500643_033992 Ga0500643_033992_473_1420 264
14 3300053104 Ga0500556_0025666 Ga0500556_0025666_967_1923 264
15 3300053108 Ga0500562_006395 Ga0500562_006395_1769_2725 264
16 3300009093 Ga0105240_10000449 Ga0105240_1000044913 265
17 3300025913 Ga0207695_10000565 Ga0207695_1000056558 265
18 3300048929 Ga0496126_0048146 Ga0496126_0048146_1124_2059 267
19 3300049823 Ga0501044_0434212 Ga0501044_0434212_371_1210 267
20 3300037471 Ga0395905_0127991 Ga0395905_0127991_961_1965 268
21 3300005336 Ga0070680_100131842 Ga0070680_1001318422 270
22 3300005339 Ga0070660_100433104 Ga0070660_1004331041 270
23 3300013100 Ga0157373_10085359 Ga0157373_100853594 270
24 3300025919 Ga0207657_10032897 Ga0207657_100328973 270
25 3300036647 Ga0316582_0046496 Ga0316582_0046496_1824_2717 270
26 3300046684 Ga0495669_0000141 Ga0495669_0000141_27416_28387 270
27 3300047445 Ga0495677_0020098 Ga0495677_0020098_1242_2213 270
28 iso_pu_bacteria 2896253425 2896254466 270
29 3300005578 Ga0068854_100006277 Ga0068854_1000062773 272
30 3300005614 Ga0068856_100019971 Ga0068856_1000199711 272
31 3300005616 Ga0068852_100001919 Ga0068852_10000191910 272
32 3300005937 Ga0081455_10001550 Ga0081455_100015507 272
33 3300005937 Ga0081455_10043173 Ga0081455_100431732 272
34 3300005985 Ga0081539_10010332 Ga0081539_100103325 272
35 3300009177 Ga0105248_10146101 Ga0105248_101461012 272
36 3300009551 Ga0105238_10053418 Ga0105238_100534184 272
37 3300025909 Ga0207705_10000009 Ga0207705_10000009406 272
38 3300025913 Ga0207695_10008077 Ga0207695_100080774 272
39 3300025924 Ga0207694_10028956 Ga0207694_100289562 272
40 3300025981 Ga0207640_10000192 Ga0207640_100001923 272
41 3300026078 Ga0207702_10004160 Ga0207702_100041602 272
42 3300026142 Ga0207698_10000084 Ga0207698_1000008429 272
43 3300031733 Ga0316577_10003812 Ga0316577_100038123 272
44 3300046684 Ga0495669_0000087 Ga0495669_0000087_9414_10373 272
45 3300005539 Ga0068853_100294821 Ga0068853_1002948212 273
46 3300026041 Ga0207639_10156507 Ga0207639_101565071 273
47 3300046616 Ga0495668_0034078 Ga0495668_0034078_317_1324 273
48 3300053102 Ga0500554_031001 Ga0500554_031001_98_1099 273
49 3300005365 Ga0070688_100069127 Ga0070688_1000691273 274
50 3300006881 Ga0068865_100000422 Ga0068865_10000042219 274
51 3300009553 Ga0105249_10205012 Ga0105249_102050122 274
52 3300013306 Ga0163162_10177499 Ga0163162_101774992 274
53 3300025938 Ga0207704_10008938 Ga0207704_100089382 274
54 3300048918 Ga0496115_0006315 Ga0496115_0006315_5059_6048 274
55 3300053087 Ga0500643_005040 Ga0500643_005040_3121_4086 274
56 3300053730 Ga0500645_001126 Ga0500645_001126_11273_12238 274
57 3300005336 Ga0070680_100243503 Ga0070680_1002435032 275
58 3300046512 Ga0495610_0002431 Ga0495610_0002431_8044_9039 275
59 3300006178 Ga0075367_10010200 Ga0075367_100102004 276
60 3300006353 Ga0075370_10095634 Ga0075370_100956342 276
61 3300010375 Ga0105239_10000051 Ga0105239_1000005145 276
62 3300031731 Ga0307405_10003498 Ga0307405_100034983 276
63 3300045051 Ga0451576_0177870 Ga0451576_0177870_273_1208 276
64 3300048920 Ga0496117_0072457 Ga0496117_0072457_319_1179 276
65 3300050490 nmdc:mga03n38_1732_c2 nmdc:mga03n38_1732_c2_3606_4562 276
66 3300050494 nmdc:mga06z11_2550_c1 nmdc:mga06z11_2550_c1_1162_2118 276
67 3300053730 Ga0500645_004645 Ga0500645_004645_2955_3911 276
68 3300005355 Ga0070671_100063415 Ga0070671_1000634152 277
69 3300005563 Ga0068855_100549579 Ga0068855_1005495792 277
70 3300025949 Ga0207667_10469432 Ga0207667_104694321 277
71 3300041486 Ga0451807_1460733 Ga0451807_1460733_839_1759 277
72 3300046520 Ga0495637_0052615 Ga0495637_0052615_651_1661 277
73 3300046810 Ga0495660_0137356 Ga0495660_0137356_48_1076 277
74 3300047472 Ga0495686_0014098 Ga0495686_0014098_316_1182 277
75 3300053730 Ga0500645_003887 Ga0500645_003887_4344_5330 277
76 3300053730 Ga0500645_023482 Ga0500645_023482_552_1529 277
77 3300003773 Ga0055537_1001453 Ga0055537_10014532 278
78 3300005262 Ga0065165_1001205 Ga0065165_10012053 278
79 3300005340 Ga0070689_100082374 Ga0070689_1000823743 278
80 3300005539 Ga0068853_100318778 Ga0068853_1003187782 278
81 3300005578 Ga0068854_100139791 Ga0068854_1001397912 278
82 3300025263 Ga0209565_1000636 Ga0209565_100063612 278
83 3300025273 Ga0209673_1002816 Ga0209673_10028161 278
84 3300025295 Ga0209564_1031670 Ga0209564_10316701 278
85 3300025297 Ga0209758_1011378 Ga0209758_10113782 278
86 3300025298 Ga0209050_1046970 Ga0209050_10469701 278
87 3300025299 Ga0209256_1002061 Ga0209256_10020619 278
88 3300025299 Ga0209256_1006016 Ga0209256_10060163 278
89 3300025304 Ga0209257_1000427 Ga0209257_100042736 278
90 3300028794 Ga0307515_10013510 Ga0307515_1001351010 278
91 3300033180 Ga0307510_10048543 Ga0307510_100485432 278
92 3300042438 Ga0439459_0018398 Ga0439459_0018398_43_1038 278
93 3300042876 Ga0451577_0149540 Ga0451577_0149540_1069_2049 278
94 3300046460 Ga0495638_0001503 Ga0495638_0001503_4064_5068 278
95 3300046471 Ga0495650_0000024 Ga0495650_0000024_165659_166669 278
96 3300046501 Ga0495607_0076020 Ga0495607_0076020_313_1311 278
97 3300046506 Ga0495583_0000003 Ga0495583_0000003_97117_98166 278
98 3300046512 Ga0495610_0006012 Ga0495610_0006012_3542_4555 278
99 3300046513 Ga0495616_0002189 Ga0495616_0002189_5802_6806 278
100 3300046519 Ga0495632_0010499 Ga0495632_0010499_1257_2255 278
101 3300046520 Ga0495637_0023258 Ga0495637_0023258_979_1989 278
102 3300046524 Ga0495648_0156671 Ga0495648_0156671_90_1088 278
103 3300046542 Ga0495597_0096614 Ga0495597_0096614_167_1168 278
104 3300046616 Ga0495668_0013198 Ga0495668_0013198_2756_3754 278
105 3300046660 Ga0495625_0000854 Ga0495625_0000854_12718_13734 278
106 3300046660 Ga0495625_0031911 Ga0495625_0031911_2666_3682 278
107 3300046660 Ga0495625_0040770 Ga0495625_0040770_2365_3354 278
108 3300046810 Ga0495660_0121426 Ga0495660_0121426_209_1204 278
109 3300047320 Ga0495672_0002175 Ga0495672_0002175_13175_14176 278
110 3300047323 Ga0495683_0008469 Ga0495683_0008469_4317_5315 278
111 3300047446 Ga0495679_006471 Ga0495679_006471_2772_3785 278
112 3300047469 Ga0495673_0005029 Ga0495673_0005029_6920_7933 278
113 3300047472 Ga0495686_0030378 Ga0495686_0030378_2332_3342 278
114 3300048918 Ga0496115_0105834 Ga0496115_0105834_1212_2228 278
115 3300053093 Ga0500651_0125403 Ga0500651_0125403_37_1032 278
116 3300053103 Ga0500555_023541 Ga0500555_023541_668_1672 278
117 3300053104 Ga0500556_0001178 Ga0500556_0001178_7881_8891 278
118 3300053108 Ga0500562_000468 Ga0500562_000468_1235_2164 278
119 3300053122 Ga0500608_084091 Ga0500608_084091_349_1374 278
120 3300053125 Ga0500618_000206 Ga0500618_000206_18135_19148 278
121 3300053136 Ga0500559_0000212 Ga0500559_0000212_2327_3343 278
122 3300053136 Ga0500559_0002654 Ga0500559_0002654_508_1545 278
123 3300053730 Ga0500645_009567 Ga0500645_009567_1746_2756 278
124 3300053731 Ga0500609_010835 Ga0500609_010835_134_1138 278
125 iso_pu_bacteria 2582581280 2585153913 278
126 iso_pu_bacteria 2582581293 2585194906 278
127 iso_pu_bacteria 2643221545 2643747298 278
128 iso_pu_bacteria 2643221552 2643779893 278
129 iso_pu_bacteria 2643221584 2643929919 278
130 iso_pu_bacteria 2643221691 2644507504 278
131 iso_pu_bacteria 2818991435 2819540488 278
132 iso_pu_bacteria 2818991454 2819649450 278
133 3300003215 JGI25153J46596_10053517 JGI25153J46596_100535171 279
134 3300003781 Ga0055536_1002121 Ga0055536_10021217 279
135 3300003781 Ga0055536_1002883 Ga0055536_10028835 279
136 3300003791 Ga0055530_10001223 Ga0055530_1000122315 279
137 3300003791 Ga0055530_10001792 Ga0055530_1000179211 279
138 3300003791 Ga0055530_10004611 Ga0055530_100046113 279
139 3300003794 Ga0055531_10001551 Ga0055531_100015513 279
140 3300003794 Ga0055531_10003795 Ga0055531_100037955 279
141 3300003794 Ga0055531_10023915 Ga0055531_100239152 279
142 3300005262 Ga0065165_1000030 Ga0065165_1000030167 279
143 3300005331 Ga0070670_100069682 Ga0070670_1000696823 279
144 3300005355 Ga0070671_100000700 Ga0070671_1000007003 279
145 3300005367 Ga0070667_100019106 Ga0070667_1000191065 279
146 3300005548 Ga0070665_100095298 Ga0070665_1000952982 279
147 3300005617 Ga0068859_100004151 Ga0068859_1000041514 279
148 3300005841 Ga0068863_100000726 Ga0068863_10000072617 279
149 3300005842 Ga0068858_100001315 Ga0068858_10000131519 279
150 3300005843 Ga0068860_100059602 Ga0068860_1000596023 279
151 3300006028 Ga0070717_10034972 Ga0070717_100349724 279
152 3300006186 Ga0075369_10007240 Ga0075369_100072403 279
153 3300006195 Ga0075366_10013645 Ga0075366_100136454 279
154 3300006931 Ga0097620_100004150 Ga0097620_1000041504 279
155 3300009093 Ga0105240_10240423 Ga0105240_102404232 279
156 3300009101 Ga0105247_10222417 Ga0105247_102224171 279
157 3300009177 Ga0105248_10016861 Ga0105248_100168618 279
158 3300009545 Ga0105237_10080662 Ga0105237_100806625 279
159 3300009551 Ga0105238_10011022 Ga0105238_1001102211 279
160 3300013306 Ga0163162_10271813 Ga0163162_102718132 279
161 3300013307 Ga0157372_10793251 Ga0157372_107932512 279
162 3300014325 Ga0163163_10004569 Ga0163163_100045692 279
163 3300014968 Ga0157379_10022592 Ga0157379_100225925 279
164 3300025292 Ga0209676_1000253 Ga0209676_100025366 279
165 3300025292 Ga0209676_1000262 Ga0209676_100026297 279
166 3300025297 Ga0209758_1000516 Ga0209758_100051631 279
167 3300025298 Ga0209050_1000090 Ga0209050_100009065 279
168 3300025298 Ga0209050_1000411 Ga0209050_100041170 279
169 3300025298 Ga0209050_1000948 Ga0209050_100094820 279
170 3300025304 Ga0209257_1000059 Ga0209257_100005912 279
171 3300025304 Ga0209257_1001169 Ga0209257_100116915 279
172 3300025304 Ga0209257_1003785 Ga0209257_100378510 279
173 3300025304 Ga0209257_1010039 Ga0209257_10100395 279
174 3300025911 Ga0207654_10123700 Ga0207654_101237002 279
175 3300025914 Ga0207671_10070311 Ga0207671_100703112 279
176 3300025923 Ga0207681_10003581 Ga0207681_100035812 279
177 3300025924 Ga0207694_10025639 Ga0207694_100256393 279
178 3300025924 Ga0207694_10247868 Ga0207694_102478682 279
179 3300025925 Ga0207650_10050950 Ga0207650_100509502 279
180 3300025931 Ga0207644_10005991 Ga0207644_100059915 279
181 3300025941 Ga0207711_10011290 Ga0207711_100112904 279
182 3300025941 Ga0207711_10086476 Ga0207711_100864763 279
183 3300025986 Ga0207658_10007678 Ga0207658_100076783 279
184 3300026035 Ga0207703_10001867 Ga0207703_1000186713 279
185 3300026088 Ga0207641_10002949 Ga0207641_100029493 279
186 3300026142 Ga0207698_10310183 Ga0207698_103101832 279
187 3300027378 Ga0209981_1006398 Ga0209981_10063982 279
188 3300028381 Ga0268264_10018502 Ga0268264_100185023 279
189 3300028786 Ga0307517_10061707 Ga0307517_100617072 279
190 3300028794 Ga0307515_10046901 Ga0307515_100469015 279
191 3300031456 Ga0307513_10003803 Ga0307513_1000380310 279
192 3300031456 Ga0307513_10026601 Ga0307513_100266012 279
193 3300035695 Ga0373927_0000880 Ga0373927_0000880_3294_4277 279
194 3300037068 Ga0373925_0001027 Ga0373925_0001027_5841_6824 279
195 3300037312 Ga0395899_0000091 Ga0395899_0000091_79544_80554 279
196 3300037418 Ga0395900_0000008 Ga0395900_0000008_405223_406233 279
197 3300037471 Ga0395905_0073216 Ga0395905_0073216_413_1423 279
198 3300038443 Ga0395901_0000008 Ga0395901_0000008_74227_75237 279
199 3300044683 Ga0466965_0124292 Ga0466965_0124292_307_1308 279
200 3300046453 Ga0495627_004036 Ga0495627_004036_5158_6165 279
201 3300046457 Ga0495590_0000213 Ga0495590_0000213_20643_21638 279
202 3300046460 Ga0495638_0001702 Ga0495638_0001702_5235_6230 279
203 3300046460 Ga0495638_0139354 Ga0495638_0139354_162_1166 279
204 3300046512 Ga0495610_0010562 Ga0495610_0010562_4612_5607 279
205 3300046518 Ga0495631_0009134 Ga0495631_0009134_1443_2438 279
206 3300046520 Ga0495637_0040285 Ga0495637_0040285_58_1053 279
207 3300046524 Ga0495648_0000391 Ga0495648_0000391_17179_18192 279
208 3300046542 Ga0495597_0052436 Ga0495597_0052436_708_1703 279
209 3300046616 Ga0495668_0000291 Ga0495668_0000291_52294_53301 279
210 3300046616 Ga0495668_0005011 Ga0495668_0005011_3244_4239 279
211 3300046616 Ga0495668_0021022 Ga0495668_0021022_1458_2468 279
212 3300046660 Ga0495625_0050612 Ga0495625_0050612_33_1031 279
213 3300046794 Ga0495589_0002866 Ga0495589_0002866_8225_9223 279
214 3300047469 Ga0495673_0000102 Ga0495673_0000102_22620_23624 279
215 3300047469 Ga0495673_0000440 Ga0495673_0000440_29408_30421 279
216 3300047472 Ga0495686_0004110 Ga0495686_0004110_6502_7497 279
217 3300047472 Ga0495686_0009130 Ga0495686_0009130_1216_2202 279
218 3300048903 Ga0496100_0312367 Ga0496100_0312367_83_1066 279
219 3300048915 Ga0496112_0072564 Ga0496112_0072564_1736_2743 279
220 3300048928 Ga0496125_0082808 Ga0496125_0082808_362_1369 279
221 3300048929 Ga0496126_0005632 Ga0496126_0005632_1509_2510 279
222 3300049459 Ga0495678_000563 Ga0495678_000563_4815_5822 279
223 3300050516 nmdc:mga0sz30_1789_c1 nmdc:mga0sz30_1789_c1_1013_2017 279
224 3300053086 Ga0500578_0000077 Ga0500578_0000077_77396_78403 279
225 3300053088 Ga0500644_0000484 Ga0500644_0000484_3411_4424 279
226 3300053118 Ga0500594_0000065 Ga0500594_0000065_22114_23121 279
227 3300053119 Ga0500595_007155 Ga0500595_007155_1007_1879 279
228 3300053122 Ga0500608_000092 Ga0500608_000092_32550_33548 279
229 3300053136 Ga0500559_0016604 Ga0500559_0016604_234_1244 279
230 3300053138 Ga0500564_000040 Ga0500564_000040_4288_5301 279
231 3300053142 Ga0500577_0001326 Ga0500577_0001326_3959_4966 279
232 3300053156 Ga0500622_0006971 Ga0500622_0006971_3211_4218 279
233 iso_pu_bacteria 2510917020 2511122948 279
234 iso_pu_bacteria 2582581279 2585148857 279
235 iso_pu_bacteria 2585428106 2587917034 279
236 iso_pu_bacteria 2643221583 2643924549 279
237 iso_pu_bacteria 2643221640 2644223761 279
238 iso_pu_bacteria 2643221642 2644236151 279
239 iso_pu_bacteria 2791355048 2792458527 279
240 iso_pu_bacteria 2843744320 2843745184 279
241 iso_pu_bacteria 2849560528 2849564024 279
242 iso_pu_bacteria 2851153111 2851157512 279
243 iso_pu_bacteria 2857504554 2857506157 279
244 iso_pu_bacteria 2884960567 2884963429 279
245 iso_pu_bacteria 2898329390 2898332147 279
246 iso_pu_bacteria 2928531327 2928534650 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01545

Cation_efflux

Cation efflux family

14

197

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f6k-assembly1.cif.gz_D cryo-em structure of a zinc-loaded h263a/d287a mutant of the yiip-fab complex 0.7084 4 263
5vrf-assembly1.cif.gz_A cryoem structure of the zinc transporter yiip from helical crystals 0.6903 4 266
8f6j-assembly1.cif.gz_A cryo-em structure of a zinc-loaded d287a mutant of the yiip-fab complex 0.6858 1 265
8f6k-assembly1.cif.gz_C cryo-em structure of a zinc-loaded h263a/d287a mutant of the yiip-fab complex 0.6841 1 263
6xpf-assembly1.cif.gz_A cryo-em structure of human znt8 wt, in the absence of zinc, determined in heterogeneous conformations- one subunit in an inward-facing and the other in an outward-facing conformation 0.6777 5 265
ID Description Score Start End Superfamily
af_P75757_17_213_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9256 1 193 1.20.1510.10
af_O35149_110_332_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9106 5 194 1.20.1510.10
af_Q9M271_29_255_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9074 1 194 1.20.1510.10
af_P75757_17_213_1.20.1510.10 Mainly Alpha;Up-down Bundle;Alpha-lytic protease prodomain-like;Cation efflux protein transmembrane domain 0.9034 1 193 1.20.1510.10
af_I1LJX9_58_316_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8846 2 192 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1F5FB86-F1-model_v4 Cation transporter 0.9475 5 188 GO:0005385
GO:0005886
AF-A0A4Y8CC03-F1-model_v4 Cation transporter 0.9406 5 188 GO:0005385
GO:0005886
AF-A0A2G9YP09-F1-model_v4 Cation transporter 0.9388 8 183 GO:0005385
GO:0005886
AF-A0A2G0E7G7-F1-model_v4 Cation transporter 0.9234 2 177 GO:0005385
GO:0005886
AF-A0A6L6JIN2-F1-model_v4 Cation transporter 0.9214 5 188 GO:0005385
GO:0005886
GO:0046872

Feature Viewer

pLDDT pTM Quality
77.11 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map