F358682

General Info

Members Datasets Scaffolds Average Seq Length
247 198 494 283

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1000113|Ga0055524_100011376
Length 296
Sequence MAIVVDKSHRWRVVLAHVFLICLVLVVIFPFLMILSISLRPGNFAAGSLIPEQISFEHWKLALGISYTAEDGRLVKPDFPVLLWLWNSVKVAGLTAIITLFLSTTAAYAFARMQFRGKQASLAGLMLMQMFPSVLALVAIYAIFDRIGNVFPTFGIDSHWSLLLAYSGGIALHVWTIKGYFDTIPVEIEEAAKVDGATPWQAFRLVLLPMAVPILMVVFLLAFIGAIIEYPVASILLHEEAKLTLAVGSKLFLYEQKYLWGDFAAAAILSGLPITVVFILAQKWMISGLTAGGIKG

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
49 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
50 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
59 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
90 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
99 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
105 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
116 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
117 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
118 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
119 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
120 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
121 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
122 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
151 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
152 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
153 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
156 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
161 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
165 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
166 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
167 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
168 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
171 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
172 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
178 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
179 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
180 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
181 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
182 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
183 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
184 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
185 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
186 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
187 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
188 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
189 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
190 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
191 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
192 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
193 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
194 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
195 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
196 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
197 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
198 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.9
Metatranscriptomes 0.4
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.15
Nodule 0.81
Rhizoplane 3.64
Rhizosphere 51.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1000113 3300003775 Bacteria 95090
2 JGI25152J39213_1004383 3300002773 Bacteria 4459
3 JGI25153J46596_10000223 3300003215 Bacteria 49001
4 rootH1_10022950 3300003316 Bacteria 10712
5 rootL2_10017017 3300003322 Bacteria 8202
6 Ga0055535_1000125 3300003761 Bacteria 81678
7 Ga0055535_1000978 3300003761 Bacteria 18662
8 Ga0055529_1000610 3300003763 Bacteria 27246
9 Ga0055526_1001680 3300003771 Bacteria 15499
10 Ga0055528_1023555 3300003790 Bacteria 1873
11 Ga0055530_10004487 3300003791 Bacteria 7162
12 Ga0055540_1000073 3300003792 Bacteria 117148
13 Ga0055531_10004192 3300003794 Bacteria 8892
14 Ga0065165_1002594 3300005262 Bacteria 14828
15 Ga0065714_10094623 3300005288 Bacteria 1810
16 Ga0070680_100075849 3300005336 Bacteria 2768
17 Ga0068868_100380771 3300005338 Bacteria 1214
18 Ga0070667_100370769 3300005367 Bacteria 1299
19 Ga0070705_100035398 3300005440 Bacteria 2799
20 Ga0070705_100368876 3300005440 Bacteria 1053
21 Ga0070700_100269856 3300005441 Bacteria 1229
22 Ga0070678_100110826 3300005456 Bacteria 2147
23 Ga0070662_100008199 3300005457 Bacteria 6807
24 Ga0070681_10591530 3300005458 Bacteria 1024
25 Ga0068867_100002265 3300005459 Bacteria 13532
26 Ga0070695_100092675 3300005545 Bacteria 2020
27 Ga0068852_100357088 3300005616 Bacteria 1428
28 Ga0068861_100038762 3300005719 Bacteria 3553
29 Ga0068860_100065326 3300005843 Bacteria 3455
30 Ga0068862_100343088 3300005844 Bacteria 1384
31 Ga0081539_10006095 3300005985 Bacteria 11772
32 Ga0070717_10044180 3300006028 Bacteria 3638
33 Ga0075363_100000645 3300006048 Bacteria 11561
34 Ga0075363_100094800 3300006048 Bacteria 1645
35 Ga0075362_10001765 3300006177 Bacteria 7041
36 Ga0075362_10023320 3300006177 Bacteria 2616
37 Ga0075367_10145887 3300006178 Bacteria 1468
38 Ga0075369_10075315 3300006186 Bacteria 1490
39 Ga0075366_10037698 3300006195 Bacteria 2855
40 Ga0075370_10005022 3300006353 Bacteria 6510
41 Ga0079104_1000056 3300006946 Bacteria 166276
42 Ga0105243_10001808 3300009148 Bacteria 18360
43 Ga0105243_10148006 3300009148 Bacteria 2011
44 Ga0105241_10214515 3300009174 Bacteria 1614
45 Ga0105237_10001002 3300009545 Bacteria 38009
46 Ga0105238_10020940 3300009551 Bacteria 6661
47 Ga0105249_10018717 3300009553 Bacteria 6168
48 Ga0105239_10000269 3300010375 Bacteria 76932
49 Ga0157369_10429948 3300013105 Bacteria 1368
50 Ga0157378_10751963 3300013297 Bacteria 998
51 Ga0182008_10001236 3300014497 Bacteria 17537
52 Ga0157377_10000013 3300014745 Bacteria 267125
53 Ga0182006_1000035 3300015261 Bacteria 232349
54 Ga0182007_10001662 3300015262 Bacteria 11780
55 Ga0182005_1000025 3300015265 Bacteria 235532
56 Ga0163161_10021644 3300017792 Bacteria 4519
57 Ga0213872_10000401 3300021361 Bacteria 36021
58 Ga0213872_10008102 3300021361 Bacteria 5103
59 Ga0224712_10098286 3300022467 Bacteria 1237
60 Ga0209672_104636 3300025228 Bacteria 2515
61 Ga0209258_100071 3300025242 Bacteria 278319
62 Ga0207425_1000121 3300025245 Bacteria 73749
63 Ga0209148_1007205 3300025254 Bacteria 2332
64 Ga0209759_1002194 3300025256 Bacteria 8939
65 Ga0209129_1000012 3300025258 Bacteria 541516
66 Ga0209129_1008383 3300025258 Bacteria 2885
67 Ga0209565_1008867 3300025263 Bacteria 2602
68 Ga0209455_1000030 3300025272 Bacteria 533479
69 Ga0209673_1006146 3300025273 Bacteria 5884
70 Ga0209675_1007424 3300025291 Bacteria 4205
71 Ga0209564_1000022 3300025295 Bacteria 555109
72 Ga0209758_1000099 3300025297 Bacteria 230054
73 Ga0209758_1000262 3300025297 Bacteria 104339
74 Ga0209050_1001462 3300025298 Bacteria 25279
75 Ga0209050_1004649 3300025298 Bacteria 9143
76 Ga0209256_1000049 3300025299 Bacteria 310696
77 Ga0209256_1008637 3300025299 Bacteria 4669
78 Ga0209256_1029302 3300025299 Bacteria 1537
79 Ga0209051_1000029 3300025303 Bacteria 403675
80 Ga0209051_1023771 3300025303 Bacteria 2539
81 Ga0209257_1000168 3300025304 Bacteria 171312
82 Ga0207695_10047459 3300025913 Bacteria 4545
83 Ga0207671_10027614 3300025914 Bacteria 4243
84 Ga0207660_10238537 3300025917 Bacteria 1432
85 Ga0207694_10013629 3300025924 Bacteria 6129
86 Ga0207706_10109276 3300025933 Bacteria 2433
87 Ga0207709_10003406 3300025935 Bacteria 9496
88 Ga0207709_10095961 3300025935 Bacteria 1949
89 Ga0207670_10281026 3300025936 Bacteria 1297
90 Ga0207689_10022430 3300025942 Bacteria 5309
91 Ga0207689_10178570 3300025942 Bacteria 1751
92 Ga0207667_10519661 3300025949 Bacteria 1206
93 Ga0207712_10009367 3300025961 Bacteria 6195
94 Ga0207677_10455767 3300026023 Bacteria 1097
95 Ga0207639_10022027 3300026041 Bacteria 4585
96 Ga0207708_10122447 3300026075 Bacteria 2027
97 Ga0207641_10216464 3300026088 Bacteria 1774
98 Ga0207648_10000006 3300026089 Bacteria 223855
99 Ga0207675_100064756 3300026118 Bacteria 3416
100 Ga0207675_100356812 3300026118 Bacteria 1433
101 Ga0207683_10119224 3300026121 Bacteria 2368
102 Ga0209281_1000125 3300027111 Bacteria 200371
103 Ga0268265_10127511 3300028380 Bacteria 2109
104 Ga0307515_10000184 3300028794 Bacteria 153952
105 Ga0307515_10006707 3300028794 Bacteria 22930
106 Ga0307515_10009636 3300028794 Bacteria 18637
107 Ga0307515_10012744 3300028794 Bacteria 15789
108 Ga0307515_10021321 3300028794 Bacteria 11496
109 Ga0307512_10115878 3300030522 Bacteria 1743
110 Ga0307513_10443436 3300031456 Bacteria 1024
111 Ga0307509_10000039 3300031507 Bacteria 185329
112 Ga0307509_10086653 3300031507 Bacteria 3220
113 Ga0307509_10090685 3300031507 Bacteria 3131
114 Ga0307509_10137863 3300031507 Bacteria 2382
115 Ga0307509_10337161 3300031507 Bacteria 1237
116 Ga0307408_100052437 3300031548 Bacteria 2942
117 Ga0307508_10000056 3300031616 Bacteria 126640
118 Ga0307508_10008138 3300031616 Bacteria 9719
119 Ga0307514_10057232 3300031649 Bacteria 2988
120 Ga0307516_10000181 3300031730 Bacteria 81531
121 Ga0307516_10015290 3300031730 Bacteria 8081
122 Ga0307516_10053556 3300031730 Bacteria 3945
123 Ga0307405_10028126 3300031731 Bacteria 3270
124 Ga0307410_10109157 3300031852 Bacteria 1999
125 Ga0307406_10005361 3300031901 Bacteria 7019
126 Ga0307412_10010509 3300031911 Bacteria 5334
127 Ga0307416_100281425 3300032002 Bacteria 1640
128 Ga0307414_10007456 3300032004 Bacteria 6144
129 Ga0307415_100101846 3300032126 Bacteria 2108
130 Ga0307507_10103117 3300033179 Bacteria 2376
131 Ga0307507_10104172 3300033179 Bacteria 2356
132 Ga0373949_0000165 3300035090 Bacteria 25128
133 Ga0373936_0000002 3300035113 Bacteria 452874
134 Ga0373961_0000009 3300035241 Bacteria 136228
135 Ga0373937_0144265 3300036401 Bacteria 2228
136 Ga0395899_0002658 3300037312 Bacteria 14407
137 Ga0395900_0018442 3300037418 Bacteria 7118
138 Ga0395905_0029665 3300037471 Bacteria 5155
139 Ga0436361_0037559 3300039447 Bacteria 1287
140 Ga0436361_0222258 3300039447 Bacteria 3678
141 Ga0436361_0915910 3300039447 Bacteria 35781
142 Ga0451791_1799978 3300041451 Bacteria 1062
143 Ga0451793_0092872 3300041452 Bacteria 2329
144 Ga0451797_0226748 3300041453 Bacteria 1901
145 Ga0451795_1007859 3300041456 Bacteria 2098
146 Ga0451798_0551507 3300041458 Bacteria 2488
147 Ga0451800_0304286 3300041459 Bacteria 2148
148 Ga0450919_004361 3300042121 Bacteria 1733
149 Ga0450923_025272 3300042125 Bacteria 1183
150 Ga0439434_0036788 3300042435 Bacteria 1498
151 Ga0450918_000126 3300042531 Bacteria 16451
152 Ga0450918_000189 3300042531 Bacteria 13732
153 Ga0466969_0002898 3300044656 Bacteria 9153
154 Ga0466972_0002554 3300044658 Bacteria 9008
155 Ga0466965_0019244 3300044683 Bacteria 3278
156 Ga0466966_0208221 3300044684 Bacteria 1182
157 Ga0466961_0000131 3300044693 Bacteria 50219
158 Ga0453684_0008302 3300044712 Bacteria 18693
159 Ga0453684_0032718 3300044712 Bacteria 7267
160 Ga0453684_0208530 3300044712 Bacteria 2273
161 Ga0466957_0068493 3300044842 Bacteria 2191
162 Ga0466957_0242537 3300044842 Bacteria 1196
163 Ga0466959_0001056 3300045049 Bacteria 16500
164 Ga0451576_0000458 3300045051 Bacteria 92512
165 Ga0451576_0182491 3300045051 Bacteria 2191
166 Ga0451576_0233154 3300045051 Bacteria 1922
167 Ga0495638_0032330 3300046460 Bacteria 3355
168 Ga0495606_0014490 3300046507 Bacteria 6147
169 Ga0495606_0117651 3300046507 Bacteria 1594
170 Ga0495610_0061936 3300046512 Bacteria 1776
171 Ga0495620_0089443 3300046515 Bacteria 1237
172 Ga0495632_0008899 3300046519 Bacteria 6100
173 Ga0495632_0017979 3300046519 Bacteria 3888
174 Ga0495622_0035664 3300046557 Bacteria 2319
175 Ga0495633_0000180 3300046558 Bacteria 82176
176 Ga0495625_0020350 3300046660 Bacteria 5126
177 Ga0495660_0007184 3300046810 Bacteria 6561
178 Ga0495672_0000198 3300047320 Bacteria 85895
179 Ga0495672_0046128 3300047320 Bacteria 2601
180 Ga0495686_0015698 3300047472 Bacteria 5161
181 Ga0496102_0017188 3300048905 Bacteria 6334
182 Ga0496114_0001111 3300048917 Bacteria 20325
183 Ga0496116_0007386 3300048919 Bacteria 9763
184 Ga0496117_0000045 3300048920 Bacteria 301047
185 Ga0496118_0000041 3300048921 Bacteria 301047
186 Ga0496121_0002756 3300048924 Bacteria 26123
187 Ga0496121_0003398 3300048924 Bacteria 22777
188 Ga0496123_0005400 3300048926 Bacteria 12880
189 Ga0496125_0029872 3300048928 Bacteria 4887
190 Ga0495678_076403 3300049459 Bacteria 1213
191 Ga0495682_0032017 3300049460 Bacteria 1942
192 Ga0501034_0025169 3300049571 Bacteria 6058
193 Ga0501034_0125333 3300049571 Bacteria 2554
194 Ga0501073_0279081 3300049589 Bacteria 1153
195 Ga0501074_0192801 3300049590 Bacteria 1453
196 Ga0501206_006018 3300049653 Bacteria 1571
197 nmdc:mga03683_139686_c1 3300050489 Bacteria 1088
198 nmdc:mga0k408_4361_c1 3300050493 Bacteria 7511
199 nmdc:mga06z11_93030_c1 3300050494 Bacteria 1640
200 nmdc:mga07m45_16125_c1 3300050496 Bacteria 3998
201 nmdc:mga07m45_40656_c1 3300050496 Bacteria 2602
202 Ga0500578_0018228 3300053086 Bacteria 4512
203 Ga0500646_0003617 3300053090 Bacteria 3960
204 Ga0500583_0002943 3300053092 Bacteria 5248
205 Ga0500566_0006972 3300053094 Bacteria 6691
206 Ga0500566_0061184 3300053094 Bacteria 2131
207 Ga0500640_007243 3300053095 Bacteria 4303
208 Ga0500554_001011 3300053102 Bacteria 5466
209 Ga0500562_010119 3300053108 Bacteria 2388
210 Ga0500572_006609 3300053111 Bacteria 2660
211 Ga0500595_000145 3300053119 Bacteria 46383
212 Ga0500614_001402 3300053123 Bacteria 5777
213 Ga0500614_007748 3300053123 Bacteria 2268
214 Ga0500559_0002495 3300053136 Bacteria 9461
215 Ga0500564_095355 3300053138 Bacteria 1321
216 Ga0500568_0040146 3300053139 Bacteria 1885
217 Ga0500603_010309 3300053150 Bacteria 2107
218 Ga0500603_044076 3300053150 Bacteria 1200
219 Ga0500604_0001827 3300053151 Bacteria 5925
220 Ga0500622_0000374 3300053156 Bacteria 43119
221 Ga0500622_0000539 3300053156 Bacteria 34997
222 Ga0500630_039948 3300053159 Bacteria 2291
223 Ga0500636_0066445 3300053177 Bacteria 2097
224 Ga0500637_0019444 3300053178 Bacteria 3664
225 Ga0500584_076690 3300053726 Bacteria 1443
226 Ga0500601_004853 3300053737 Bacteria 1472
227 Ga0500587_002753 3300053739 Bacteria 2485
228 Ga0590075_041621 3300059424 Bacteria 1174
229 2587728321 2585428057 Bacteria 6737412
230 2587730872 2585428057 Bacteria 6737412
231 2587735620 2585428058 Bacteria 6853932
232 2587755080 2585428062 Bacteria 6842168
233 2588293705 2588253510 Bacteria 6901809
234 2588295042 2588253510 Bacteria 6901809
235 2601669996 2600255292 Bacteria 6300551
236 2643970397 2643221592 Bacteria 6608788
237 2643971316 2643221592 Bacteria 6608788
238 2644142363 2643221625 Bacteria 6512927
239 2644244585 2643221644 Bacteria 6865017
240 2644246418 2643221644 Bacteria 6865017
241 2644275479 2643221648 Bacteria 6521465
242 2846038660 2846037992 Bacteria 4526407
243 2857550938 2857547612 Bacteria 6179999
244 2885082648 2885080285 Bacteria 6355622
245 2886850542 2886848708 Bacteria 5632523
246 2932413485 2932410948 Bacteria 6312192
247 2932417545 2932416698 Bacteria 6315112
248 Ga0055524_1000113
249 JGI25152J39213_1004383
250 JGI25153J46596_10000223
251 rootH1_10022950
252 rootL2_10017017
253 Ga0055535_1000125
254 Ga0055535_1000978
255 Ga0055529_1000610
256 Ga0055526_1001680
257 Ga0055528_1023555
258 Ga0055530_10004487
259 Ga0055540_1000073
260 Ga0055531_10004192
261 Ga0065165_1002594
262 Ga0065714_10094623
263 Ga0070680_100075849
264 Ga0068868_100380771
265 Ga0070667_100370769
266 Ga0070705_100035398
267 Ga0070705_100368876
268 Ga0070700_100269856
269 Ga0070678_100110826
270 Ga0070662_100008199
271 Ga0070681_10591530
272 Ga0068867_100002265
273 Ga0070695_100092675
274 Ga0068852_100357088
275 Ga0068861_100038762
276 Ga0068860_100065326
277 Ga0068862_100343088
278 Ga0081539_10006095
279 Ga0070717_10044180
280 Ga0075363_100000645
281 Ga0075363_100094800
282 Ga0075362_10001765
283 Ga0075362_10023320
284 Ga0075367_10145887
285 Ga0075369_10075315
286 Ga0075366_10037698
287 Ga0075370_10005022
288 Ga0079104_1000056
289 Ga0105243_10001808
290 Ga0105243_10148006
291 Ga0105241_10214515
292 Ga0105237_10001002
293 Ga0105238_10020940
294 Ga0105249_10018717
295 Ga0105239_10000269
296 Ga0157369_10429948
297 Ga0157378_10751963
298 Ga0182008_10001236
299 Ga0157377_10000013
300 Ga0182006_1000035
301 Ga0182007_10001662
302 Ga0182005_1000025
303 Ga0163161_10021644
304 Ga0213872_10000401
305 Ga0213872_10008102
306 Ga0224712_10098286
307 Ga0209672_104636
308 Ga0209258_100071
309 Ga0207425_1000121
310 Ga0209148_1007205
311 Ga0209759_1002194
312 Ga0209129_1000012
313 Ga0209129_1008383
314 Ga0209565_1008867
315 Ga0209455_1000030
316 Ga0209673_1006146
317 Ga0209675_1007424
318 Ga0209564_1000022
319 Ga0209758_1000099
320 Ga0209758_1000262
321 Ga0209050_1001462
322 Ga0209050_1004649
323 Ga0209256_1000049
324 Ga0209256_1008637
325 Ga0209256_1029302
326 Ga0209051_1000029
327 Ga0209051_1023771
328 Ga0209257_1000168
329 Ga0207695_10047459
330 Ga0207671_10027614
331 Ga0207660_10238537
332 Ga0207694_10013629
333 Ga0207706_10109276
334 Ga0207709_10003406
335 Ga0207709_10095961
336 Ga0207670_10281026
337 Ga0207689_10022430
338 Ga0207689_10178570
339 Ga0207667_10519661
340 Ga0207712_10009367
341 Ga0207677_10455767
342 Ga0207639_10022027
343 Ga0207708_10122447
344 Ga0207641_10216464
345 Ga0207648_10000006
346 Ga0207675_100064756
347 Ga0207675_100356812
348 Ga0207683_10119224
349 Ga0209281_1000125
350 Ga0268265_10127511
351 Ga0307515_10000184
352 Ga0307515_10006707
353 Ga0307515_10009636
354 Ga0307515_10012744
355 Ga0307515_10021321
356 Ga0307512_10115878
357 Ga0307513_10443436
358 Ga0307509_10000039
359 Ga0307509_10086653
360 Ga0307509_10090685
361 Ga0307509_10137863
362 Ga0307509_10337161
363 Ga0307408_100052437
364 Ga0307508_10000056
365 Ga0307508_10008138
366 Ga0307514_10057232
367 Ga0307516_10000181
368 Ga0307516_10015290
369 Ga0307516_10053556
370 Ga0307405_10028126
371 Ga0307410_10109157
372 Ga0307406_10005361
373 Ga0307412_10010509
374 Ga0307416_100281425
375 Ga0307414_10007456
376 Ga0307415_100101846
377 Ga0307507_10103117
378 Ga0307507_10104172
379 Ga0373949_0000165
380 Ga0373936_0000002
381 Ga0373961_0000009
382 Ga0373937_0144265
383 Ga0395899_0002658
384 Ga0395900_0018442
385 Ga0395905_0029665
386 Ga0436361_0037559
387 Ga0436361_0222258
388 Ga0436361_0915910
389 Ga0451791_1799978
390 Ga0451793_0092872
391 Ga0451797_0226748
392 Ga0451795_1007859
393 Ga0451798_0551507
394 Ga0451800_0304286
395 Ga0450919_004361
396 Ga0450923_025272
397 Ga0439434_0036788
398 Ga0450918_000126
399 Ga0450918_000189
400 Ga0466969_0002898
401 Ga0466972_0002554
402 Ga0466965_0019244
403 Ga0466966_0208221
404 Ga0466961_0000131
405 Ga0453684_0008302
406 Ga0453684_0032718
407 Ga0453684_0208530
408 Ga0466957_0068493
409 Ga0466957_0242537
410 Ga0466959_0001056
411 Ga0451576_0000458
412 Ga0451576_0182491
413 Ga0451576_0233154
414 Ga0495638_0032330
415 Ga0495606_0014490
416 Ga0495606_0117651
417 Ga0495610_0061936
418 Ga0495620_0089443
419 Ga0495632_0008899
420 Ga0495632_0017979
421 Ga0495622_0035664
422 Ga0495633_0000180
423 Ga0495625_0020350
424 Ga0495660_0007184
425 Ga0495672_0000198
426 Ga0495672_0046128
427 Ga0495686_0015698
428 Ga0496102_0017188
429 Ga0496114_0001111
430 Ga0496116_0007386
431 Ga0496117_0000045
432 Ga0496118_0000041
433 Ga0496121_0002756
434 Ga0496121_0003398
435 Ga0496123_0005400
436 Ga0496125_0029872
437 Ga0495678_076403
438 Ga0495682_0032017
439 Ga0501034_0025169
440 Ga0501034_0125333
441 Ga0501073_0279081
442 Ga0501074_0192801
443 Ga0501206_006018
444 nmdc:mga03683_139686_c1
445 nmdc:mga0k408_4361_c1
446 nmdc:mga06z11_93030_c1
447 nmdc:mga07m45_16125_c1
448 nmdc:mga07m45_40656_c1
449 Ga0500578_0018228
450 Ga0500646_0003617
451 Ga0500583_0002943
452 Ga0500566_0006972
453 Ga0500566_0061184
454 Ga0500640_007243
455 Ga0500554_001011
456 Ga0500562_010119
457 Ga0500572_006609
458 Ga0500595_000145
459 Ga0500614_001402
460 Ga0500614_007748
461 Ga0500559_0002495
462 Ga0500564_095355
463 Ga0500568_0040146
464 Ga0500603_010309
465 Ga0500603_044076
466 Ga0500604_0001827
467 Ga0500622_0000374
468 Ga0500622_0000539
469 Ga0500630_039948
470 Ga0500636_0066445
471 Ga0500637_0019444
472 Ga0500584_076690
473 Ga0500601_004853
474 Ga0500587_002753
475 Ga0590075_041621
476 2587728321
477 2587730872
478 2587735620
479 2587755080
480 2588293705
481 2588295042
482 2601669996
483 2643970397
484 2643971316
485 2644142363
486 2644244585
487 2644246418
488 2644275479
489 2846038660
490 2857550938
491 2885082648
492 2886850542
493 2932413485
494 2932417545

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

100

290

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7717 2 270
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.7643 12 282
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.7528 7 282
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7383 2 270
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.7364 7 282
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.78 8 272 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7797 7 272 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7751 7 268 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7743 7 272 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.764 8 272 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1F3VJK9-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8294 5 282 GO:0005886
GO:0015423
GO:0042956
AF-A0A382RBS6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8256 86 193 GO:0016020
GO:0055085
AF-A0A1F3VJK9-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.816 5 282 GO:0005886
GO:0015423
GO:0042956
AF-A0A418YBX9-F1-model_v4 Maltose/maltodextrin transport system permease protein MalG 0.8053 7 274 GO:0005886
GO:0015423
GO:0042956
AF-A0A1E3ZZ60-F1-model_v4 deleted 0.8025 15 282

Map