F358924

General Info

Members Datasets Scaffolds Average Seq Length
247 176 247 223

Family's Representative Sequence

Representative Sequence 3300006881|Ga0068865_100000056|Ga0068865_10000005644
Length 253
Sequence MAGVEDGKLPDNKFLHCCCEDVRVLDDRVIAIAGVGGGLGPVVAERLAAEGAIVAGAGRSQEALNSLAAELALPPERWDGRAVDLLDEDAARAWCAALVERFGRVDALLHLVGGWRGGEPLHEAPLSDWALLHDLLIRTVQHTTRAFHDQLVASRHGRFVLVSAKQAQNPTNANAAYAAEAWTLALADGFEPGGATANIVVVDAILTPRMRQENPAKEFPTFTPAEDIAAALAFLCSDAAAKMNGQRFALTMR

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
95 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
119 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
131 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
136 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
137 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.4
Nodule 0
Rhizoplane 11.34
Rhizosphere 87.45
Stem 0
Stem Tuber 0
Unclassified 0.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000629 3300002074 Bacteria 3779
2 JGI24034J26672_10000381 3300002239 Bacteria 5737
3 JGI24742J22300_10008619 3300002244 Bacteria 1683
4 Ga0070683_100003996 3300005329 Bacteria 12076
5 Ga0070683_100020951 3300005329 Bacteria 5829
6 Ga0070683_100026608 3300005329 Bacteria 5211
7 Ga0070683_100097025 3300005329 Bacteria 2773
8 Ga0070683_100182715 3300005329 Bacteria 1991
9 Ga0070670_100051942 3300005331 Bacteria 3520
10 Ga0070666_10002117 3300005335 Bacteria 12068
11 Ga0070682_100112944 3300005337 Bacteria 1814
12 Ga0068868_100003730 3300005338 Bacteria 10641
13 Ga0070691_10000186 3300005341 Bacteria 20683
14 Ga0070691_10086107 3300005341 Bacteria 1544
15 Ga0070687_100137299 3300005343 Bacteria 1419
16 Ga0070661_100000523 3300005344 Bacteria 29425
17 Ga0070661_100452167 3300005344 Bacteria 1022
18 Ga0070675_100000063 3300005354 Bacteria 64820
19 Ga0070674_100000001 3300005356 Bacteria 277173
20 Ga0070674_100100553 3300005356 Bacteria 2105
21 Ga0070688_100000134 3300005365 Bacteria 39823
22 Ga0070688_100000361 3300005365 Bacteria 23044
23 Ga0070659_100014283 3300005366 Bacteria 5930
24 Ga0070667_100006216 3300005367 Bacteria 9936
25 Ga0070667_100076757 3300005367 Bacteria 2853
26 Ga0070713_100000080 3300005436 Bacteria 60198
27 Ga0070701_10078746 3300005438 Bacteria 1779
28 Ga0070711_100002543 3300005439 Bacteria 10437
29 Ga0070700_100230790 3300005441 Bacteria 1317
30 Ga0070685_10000204 3300005466 Bacteria 39823
31 Ga0070685_10000485 3300005466 Bacteria 23044
32 Ga0070684_100035595 3300005535 Bacteria 4262
33 Ga0070684_100064694 3300005535 Bacteria 3208
34 Ga0070684_100696606 3300005535 Bacteria 947
35 Ga0068853_100238457 3300005539 Bacteria 1666
36 Ga0070672_100000003 3300005543 Bacteria 159532
37 Ga0070665_100012805 3300005548 Bacteria 8448
38 Ga0070665_100041685 3300005548 Bacteria 4616
39 Ga0070664_100058583 3300005564 Bacteria 3276
40 Ga0068857_100164519 3300005577 Bacteria 2014
41 Ga0068856_100000146 3300005614 Bacteria 71991
42 Ga0068856_100007489 3300005614 Bacteria 10654
43 Ga0068864_100000043 3300005618 Bacteria 162928
44 Ga0068866_10000014 3300005718 Bacteria 72482
45 Ga0068866_10005461 3300005718 Bacteria 5247
46 Ga0068851_10065308 3300005834 Bacteria 1872
47 Ga0068863_100002005 3300005841 Bacteria 20206
48 Ga0068863_100111786 3300005841 Bacteria 2602
49 Ga0068860_100018737 3300005843 Bacteria 6727
50 Ga0068860_100239790 3300005843 Bacteria 1763
51 Ga0068860_100321092 3300005843 Bacteria 1520
52 Ga0068862_100043803 3300005844 Bacteria 3815
53 Ga0081455_10013351 3300005937 Bacteria 8125
54 Ga0081455_10026481 3300005937 Bacteria 5331
55 Ga0081540_1000281 3300005983 Bacteria 52990
56 Ga0070716_100037858 3300006173 Bacteria 2668
57 Ga0097621_100127908 3300006237 Bacteria 2159
58 Ga0068865_100000056 3300006881 Bacteria 62122
59 Ga0105251_10060041 3300009011 Bacteria 1792
60 Ga0105240_10612438 3300009093 Bacteria 1198
61 Ga0105245_10000319 3300009098 Bacteria 45611
62 Ga0105247_10001918 3300009101 Bacteria 14511
63 Ga0105243_10002128 3300009148 Bacteria 16741
64 Ga0105242_10000078 3300009176 Bacteria 66874
65 Ga0105248_10000210 3300009177 Bacteria 67204
66 Ga0105249_10189218 3300009553 Bacteria 2008
67 Ga0105239_10045619 3300010375 Bacteria 4804
68 Ga0157370_10028018 3300013104 Bacteria 5547
69 Ga0157369_10000348 3300013105 Bacteria 61516
70 Ga0157374_10062173 3300013296 Bacteria 3499
71 Ga0157374_10124644 3300013296 Bacteria 2489
72 Ga0157378_10001651 3300013297 Bacteria 20170
73 Ga0157378_10013385 3300013297 Bacteria 7170
74 Ga0163162_10116044 3300013306 Bacteria 2778
75 Ga0157372_10000435 3300013307 Bacteria 45997
76 Ga0157375_10000393 3300013308 Bacteria 39838
77 Ga0157375_10136206 3300013308 Bacteria 2580
78 Ga0157380_10000092 3300014326 Bacteria 48994
79 Ga0157377_10485665 3300014745 Bacteria 860
80 Ga0157379_10100718 3300014968 Bacteria 2593
81 Ga0157379_10118376 3300014968 Bacteria 2382
82 Ga0207656_10048166 3300025321 Bacteria 1834
83 Ga0207713_1050209 3300025735 Bacteria 1666
84 Ga0207642_10000001 3300025899 Bacteria 714030
85 Ga0207642_10000022 3300025899 Bacteria 54810
86 Ga0207710_10001110 3300025900 Bacteria 13755
87 Ga0207680_10000617 3300025903 Bacteria 16789
88 Ga0207685_10000001 3300025905 Bacteria 604473
89 Ga0207705_10040109 3300025909 Bacteria 3357
90 Ga0207695_10248504 3300025913 Bacteria 1678
91 Ga0207663_10013396 3300025916 Bacteria 4457
92 Ga0207662_10119558 3300025918 Bacteria 1651
93 Ga0207649_10000570 3300025920 Bacteria 25347
94 Ga0207681_10098677 3300025923 Bacteria 2102
95 Ga0207650_10040522 3300025925 Bacteria 3409
96 Ga0207659_10000054 3300025926 Bacteria 76823
97 Ga0207687_10000027 3300025927 Bacteria 168505
98 Ga0207700_10000013 3300025928 Bacteria 230462
99 Ga0207690_10016366 3300025932 Bacteria 4509
100 Ga0207686_10000105 3300025934 Bacteria 68972
101 Ga0207669_10000002 3300025937 Bacteria 377651
102 Ga0207669_10000181 3300025937 Bacteria 29189
103 Ga0207704_10000092 3300025938 Bacteria 52383
104 Ga0207691_10000005 3300025940 Bacteria 163117
105 Ga0207711_10000165 3300025941 Bacteria 70923
106 Ga0207711_10432252 3300025941 Bacteria 1225
107 Ga0207661_10000155 3300025944 Bacteria 44064
108 Ga0207661_10002008 3300025944 Bacteria 14019
109 Ga0207661_10002770 3300025944 Bacteria 12078
110 Ga0207661_10031358 3300025944 Bacteria 4105
111 Ga0207679_10072113 3300025945 Bacteria 2608
112 Ga0207658_10004710 3300025986 Bacteria 9447
113 Ga0207658_10113125 3300025986 Bacteria 2150
114 Ga0207677_10003983 3300026023 Bacteria 7878
115 Ga0207703_10127286 3300026035 Bacteria 2195
116 Ga0207639_10207301 3300026041 Bacteria 1685
117 Ga0207702_10000485 3300026078 Bacteria 44756
118 Ga0207702_10013612 3300026078 Bacteria 6755
119 Ga0207641_10001990 3300026088 Bacteria 19516
120 Ga0207641_10070502 3300026088 Bacteria 3003
121 Ga0207648_10005689 3300026089 Bacteria 12502
122 Ga0207676_10000042 3300026095 Bacteria 163475
123 Ga0207675_100253573 3300026118 Bacteria 1703
124 Ga0268266_10003036 3300028379 Bacteria 17229
125 Ga0268264_10107499 3300028381 Bacteria 2437
126 Ga0268264_10296317 3300028381 Bacteria 1521
127 Ga0265337_1000177 3300028556 Bacteria 33520
128 Ga0265326_10000038 3300028558 Bacteria 88362
129 Ga0265319_1000693 3300028563 Bacteria 21962
130 Ga0265322_10000006 3300028654 Bacteria 231685
131 Ga0265336_10018449 3300028666 Bacteria 2261
132 Ga0265338_10003560 3300028800 Bacteria 21774
133 Ga0265338_10129980 3300028800 Bacteria 1991
134 Ga0265324_10000681 3300029957 Bacteria 22833
135 Ga0265328_10002887 3300031239 Bacteria 7663
136 Ga0265320_10000001 3300031240 Bacteria 847191
137 Ga0265325_10048249 3300031241 Bacteria 2201
138 Ga0265339_10184426 3300031249 Bacteria 1037
139 Ga0265331_10000612 3300031250 Bacteria 31246
140 Ga0265331_10052193 3300031250 Bacteria 1954
141 Ga0265327_10000003 3300031251 Bacteria 852750
142 Ga0265316_10021679 3300031344 Bacteria 5436
143 Ga0265316_10276914 3300031344 Bacteria 1227
144 Ga0307408_100719287 3300031548 Bacteria 899
145 Ga0265314_10000103 3300031711 Bacteria 127956
146 Ga0451807_1332026 3300041486 Bacteria 1218
147 Ga0466963_0048261 3300044694 Bacteria 2812
148 Ga0466958_0021660 3300045836 Bacteria 3759
149 Ga0466967_0000003 3300045976 Bacteria 169144
150 Ga0466967_0145895 3300045976 Bacteria 2208
151 Ga0495592_0299792 3300046454 Bacteria 1045
152 Ga0495603_0001082 3300046455 Bacteria 15798
153 Ga0495629_0000091 3300046459 Bacteria 78697
154 Ga0495629_0004513 3300046459 Bacteria 10413
155 Ga0495641_0028564 3300046461 Bacteria 2698
156 Ga0495641_0030585 3300046461 Bacteria 2580
157 Ga0495653_0350858 3300046463 Bacteria 949
158 Ga0495662_0026076 3300046476 Bacteria 2823
159 Ga0495664_0088818 3300046477 Bacteria 1858
160 Ga0495594_0000017 3300046499 Bacteria 88992
161 Ga0495606_0001247 3300046507 Bacteria 35545
162 Ga0495608_0000010 3300046511 Bacteria 258660
163 Ga0495608_0061762 3300046511 Bacteria 2463
164 Ga0495620_0001409 3300046515 Bacteria 14438
165 Ga0495628_0003462 3300046516 Bacteria 14124
166 Ga0495628_0025860 3300046516 Bacteria 4793
167 Ga0495630_0000378 3300046517 Bacteria 35012
168 Ga0495630_0001454 3300046517 Bacteria 16406
169 Ga0495630_0521038 3300046517 Bacteria 911
170 Ga0495652_0000022 3300046529 Bacteria 178368
171 Ga0495652_0017480 3300046529 Bacteria 6399
172 Ga0495587_0000695 3300046536 Bacteria 22556
173 Ga0495587_0053828 3300046536 Bacteria 2372
174 Ga0495621_0000841 3300046539 Bacteria 7812
175 Ga0495645_0073469 3300046543 Bacteria 2464
176 Ga0495622_0000057 3300046557 Bacteria 97942
177 Ga0495667_0000086 3300046559 Bacteria 67148
178 Ga0495634_0003560 3300046642 Bacteria 12465
179 Ga0495588_0000175 3300046674 Bacteria 80911
180 Ga0495657_0000005 3300046675 Bacteria 254860
181 Ga0495599_0001408 3300046678 Bacteria 13756
182 Ga0495647_0000188 3300046681 Bacteria 16321
183 Ga0495658_0008541 3300046683 Bacteria 5079
184 Ga0495669_0000514 3300046684 Bacteria 17635
185 Ga0495613_0000087 3300046689 Bacteria 88644
186 Ga0495613_0000654 3300046689 Bacteria 27451
187 Ga0495624_0000259 3300046690 Bacteria 41997
188 Ga0495624_0000365 3300046690 Bacteria 35973
189 Ga0495600_0013923 3300046809 Bacteria 5068
190 Ga0495600_0282162 3300046809 Bacteria 1051
191 Ga0495604_0000081 3300047317 Bacteria 82621
192 Ga0495604_0000460 3300047317 Bacteria 36155
193 Ga0495604_0087167 3300047317 Bacteria 2326
194 Ga0495674_0000115 3300047319 Bacteria 60282
195 Ga0495674_0044110 3300047319 Bacteria 3966
196 Ga0495672_0086384 3300047320 Bacteria 1735
197 Ga0495676_0000480 3300047321 Bacteria 32772
198 Ga0495680_0126723 3300047322 Bacteria 1879
199 Ga0495675_0000004 3300047444 Bacteria 211049
200 Ga0495675_0291845 3300047444 Bacteria 970
201 Ga0495685_060422 3300047447 Bacteria 1278
202 Ga0495593_0035503 3300047673 Bacteria 2707
203 Ga0495602_0000150 3300048088 Bacteria 64538
204 Ga0495602_0001468 3300048088 Bacteria 23411
205 Ga0495602_0142228 3300048088 Bacteria 1898
206 Ga0496100_0000035 3300048903 Bacteria 97592
207 Ga0496101_0000087 3300048904 Bacteria 101601
208 Ga0496102_0000132 3300048905 Bacteria 103176
209 Ga0496102_0379100 3300048905 Bacteria 1331
210 Ga0496104_0063904 3300048907 Bacteria 3492
211 Ga0496105_0000351 3300048908 Bacteria 30325
212 Ga0496106_0000068 3300048909 Bacteria 83053
213 Ga0496107_0000018 3300048910 Bacteria 158433
214 Ga0496108_0000395 3300048911 Bacteria 36064
215 Ga0496108_0001764 3300048911 Bacteria 17210
216 Ga0496109_0000062 3300048912 Bacteria 112843
217 Ga0496109_0000081 3300048912 Bacteria 99723
218 Ga0496109_0000131 3300048912 Bacteria 76860
219 Ga0496109_0052832 3300048912 Bacteria 3705
220 Ga0496109_0683963 3300048912 Bacteria 963
221 Ga0496109_0946342 3300048912 Bacteria 799
222 Ga0496110_0043233 3300048913 Bacteria 3934
223 Ga0496111_0022236 3300048914 Bacteria 4436
224 Ga0496112_0001814 3300048915 Bacteria 16806
225 Ga0496113_0000156 3300048916 Bacteria 30011
226 Ga0496113_0011317 3300048916 Bacteria 5945
227 Ga0496113_0269782 3300048916 Bacteria 1360
228 Ga0496114_0000003 3300048917 Bacteria 630981
229 Ga0496114_0133761 3300048917 Bacteria 2143
230 Ga0496115_0000005 3300048918 Bacteria 290756
231 Ga0496115_0000856 3300048918 Bacteria 22091
232 Ga0496115_0000909 3300048918 Bacteria 21471
233 Ga0496121_0220347 3300048924 Bacteria 1337
234 Ga0496124_0234567 3300048927 Bacteria 1369
235 Ga0501042_0057445 3300049578 Bacteria 2777
236 Ga0501070_0121854 3300049586 Bacteria 2155
237 Ga0495601_0000065 3300053077 Bacteria 58386
238 Ga0495601_0168679 3300053077 Bacteria 1430
239 Ga0495612_0003791 3300053078 Bacteria 6285
240 Ga0495612_0009235 3300053078 Bacteria 4000
241 Ga0495655_0000009 3300053083 Bacteria 150662
242 Ga0495655_0000645 3300053083 Bacteria 5671
243 Ga0495595_0000005 3300053084 Bacteria 258660
244 Ga0495595_0005266 3300053084 Bacteria 5228
245 Ga0495619_0000030 3300053085 Bacteria 157134
246 Ga0495619_0008844 3300053085 Bacteria 6366
247 Ga0500628_000022 3300053129 Bacteria 77990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100026608 Ga0070683_1000266085 180
2 3300005535 Ga0070684_100696606 Ga0070684_1006966062 180
3 3300005439 Ga0070711_100002543 Ga0070711_1000025435 192
4 3300025916 Ga0207663_10013396 Ga0207663_100133963 192
5 3300048912 Ga0496109_0946342 Ga0496109_0946342_15_671 192
6 3300046809 Ga0495600_0282162 Ga0495600_0282162_259_984 199
7 3300005843 Ga0068860_100018737 Ga0068860_1000187376 201
8 3300005366 Ga0070659_100014283 Ga0070659_1000142836 202
9 3300025932 Ga0207690_10016366 Ga0207690_100163663 202
10 3300049586 Ga0501070_0121854 Ga0501070_0121854_897_1646 202
11 3300026089 Ga0207648_10005689 Ga0207648_100056895 203
12 3300005341 Ga0070691_10000186 Ga0070691_100001865 204
13 3300005365 Ga0070688_100000361 Ga0070688_1000003615 205
14 3300005466 Ga0070685_10000485 Ga0070685_100004855 205
15 3300005614 Ga0068856_100007489 Ga0068856_10000748910 205
16 3300025927 Ga0207687_10000027 Ga0207687_1000002734 205
17 3300026078 Ga0207702_10013612 Ga0207702_100136124 205
18 3300048911 Ga0496108_0001764 Ga0496108_0001764_1593_2300 205
19 3300048912 Ga0496109_0000081 Ga0496109_0000081_65456_66163 205
20 3300049578 Ga0501042_0057445 Ga0501042_0057445_25_741 205
21 3300013308 Ga0157375_10136206 Ga0157375_101362065 206
22 3300046684 Ga0495669_0000514 Ga0495669_0000514_3822_4538 207
23 3300005329 Ga0070683_100020951 Ga0070683_1000209516 208
24 3300005329 Ga0070683_100182715 Ga0070683_1001827152 208
25 3300005344 Ga0070661_100452167 Ga0070661_1004521672 208
26 3300005577 Ga0068857_100164519 Ga0068857_1001645192 208
27 3300025944 Ga0207661_10002008 Ga0207661_1000200818 208
28 3300048912 Ga0496109_0052832 Ga0496109_0052832_624_1340 208
29 3300048914 Ga0496111_0022236 Ga0496111_0022236_281_997 208
30 3300005367 Ga0070667_100006216 Ga0070667_1000062165 209
31 3300005436 Ga0070713_100000080 Ga0070713_10000008026 209
32 3300005844 Ga0068862_100043803 Ga0068862_1000438033 209
33 3300006237 Ga0097621_100127908 Ga0097621_1001279083 209
34 3300009148 Ga0105243_10002128 Ga0105243_1000212811 209
35 3300013296 Ga0157374_10124644 Ga0157374_101246444 209
36 3300025928 Ga0207700_10000013 Ga0207700_10000013195 209
37 3300025986 Ga0207658_10004710 Ga0207658_100047104 209
38 3300031548 Ga0307408_100719287 Ga0307408_1007192871 209
39 3300041486 Ga0451807_1332026 Ga0451807_1332026_138_854 209
40 3300046515 Ga0495620_0001409 Ga0495620_0001409_6553_7269 209
41 3300046539 Ga0495621_0000841 Ga0495621_0000841_6276_7022 209
42 3300047447 Ga0495685_060422 Ga0495685_060422_486_1202 209
43 3300048911 Ga0496108_0000395 Ga0496108_0000395_21131_21847 209
44 3300048912 Ga0496109_0000131 Ga0496109_0000131_9584_10300 209
45 3300048915 Ga0496112_0001814 Ga0496112_0001814_8026_8733 209
46 3300048916 Ga0496113_0000156 Ga0496113_0000156_16097_16804 209
47 3300048916 Ga0496113_0269782 Ga0496113_0269782_619_1335 209
48 3300053085 Ga0495619_0008844 Ga0495619_0008844_3393_4109 209
49 3300005329 Ga0070683_100097025 Ga0070683_1000970252 210
50 3300005331 Ga0070670_100051942 Ga0070670_1000519423 210
51 3300005335 Ga0070666_10002117 Ga0070666_100021178 210
52 3300005338 Ga0068868_100003730 Ga0068868_10000373013 210
53 3300005344 Ga0070661_100000523 Ga0070661_10000052318 210
54 3300005354 Ga0070675_100000063 Ga0070675_10000006324 210
55 3300005356 Ga0070674_100100553 Ga0070674_1001005532 210
56 3300005365 Ga0070688_100000134 Ga0070688_1000001345 210
57 3300005466 Ga0070685_10000204 Ga0070685_100002045 210
58 3300005539 Ga0068853_100238457 Ga0068853_1002384572 210
59 3300005543 Ga0070672_100000003 Ga0070672_100000003143 210
60 3300005548 Ga0070665_100012805 Ga0070665_1000128052 210
61 3300005564 Ga0070664_100058583 Ga0070664_1000585832 210
62 3300005614 Ga0068856_100000146 Ga0068856_10000014621 210
63 3300005618 Ga0068864_100000043 Ga0068864_10000004336 210
64 3300005834 Ga0068851_10065308 Ga0068851_100653081 210
65 3300009098 Ga0105245_10000319 Ga0105245_1000031925 210
66 3300010375 Ga0105239_10045619 Ga0105239_100456194 210
67 3300013105 Ga0157369_10000348 Ga0157369_1000034858 210
68 3300013297 Ga0157378_10001651 Ga0157378_1000165112 210
69 3300013297 Ga0157378_10013385 Ga0157378_100133858 210
70 3300013308 Ga0157375_10000393 Ga0157375_1000039336 210
71 3300014326 Ga0157380_10000092 Ga0157380_1000009241 210
72 3300025321 Ga0207656_10048166 Ga0207656_100481661 210
73 3300025903 Ga0207680_10000617 Ga0207680_1000061710 210
74 3300025909 Ga0207705_10040109 Ga0207705_100401094 210
75 3300025920 Ga0207649_10000570 Ga0207649_1000057022 210
76 3300025926 Ga0207659_10000054 Ga0207659_1000005456 210
77 3300025940 Ga0207691_10000005 Ga0207691_10000005143 210
78 3300025941 Ga0207711_10432252 Ga0207711_104322522 210
79 3300025944 Ga0207661_10000155 Ga0207661_1000015526 210
80 3300025945 Ga0207679_10072113 Ga0207679_100721133 210
81 3300026023 Ga0207677_10003983 Ga0207677_100039834 210
82 3300026041 Ga0207639_10207301 Ga0207639_102073012 210
83 3300026078 Ga0207702_10000485 Ga0207702_1000048540 210
84 3300026095 Ga0207676_10000042 Ga0207676_10000042131 210
85 3300028379 Ga0268266_10003036 Ga0268266_1000303621 210
86 3300028556 Ga0265337_1000177 Ga0265337_10001778 210
87 3300028558 Ga0265326_10000038 Ga0265326_1000003890 210
88 3300028654 Ga0265322_10000006 Ga0265322_10000006222 210
89 3300028666 Ga0265336_10018449 Ga0265336_100184493 210
90 3300028800 Ga0265338_10129980 Ga0265338_101299804 210
91 3300029957 Ga0265324_10000681 Ga0265324_100006818 210
92 3300031239 Ga0265328_10002887 Ga0265328_100028873 210
93 3300031240 Ga0265320_10000001 Ga0265320_10000001691 210
94 3300031249 Ga0265339_10184426 Ga0265339_101844262 210
95 3300031250 Ga0265331_10000612 Ga0265331_1000061234 210
96 3300031251 Ga0265327_10000003 Ga0265327_10000003691 210
97 3300031344 Ga0265316_10021679 Ga0265316_100216793 210
98 3300031711 Ga0265314_10000103 Ga0265314_100001038 210
99 3300045976 Ga0466967_0000003 Ga0466967_0000003_93742_94449 210
100 3300046459 Ga0495629_0000091 Ga0495629_0000091_23642_24352 210
101 3300046461 Ga0495641_0028564 Ga0495641_0028564_1048_1758 210
102 3300046507 Ga0495606_0001247 Ga0495606_0001247_26985_27695 210
103 3300046517 Ga0495630_0000378 Ga0495630_0000378_5120_5830 210
104 3300046642 Ga0495634_0003560 Ga0495634_0003560_1249_1962 210
105 3300046674 Ga0495588_0000175 Ga0495588_0000175_3428_4138 210
106 3300046681 Ga0495647_0000188 Ga0495647_0000188_13235_13945 210
107 3300046690 Ga0495624_0000259 Ga0495624_0000259_19866_20576 210
108 3300047317 Ga0495604_0087167 Ga0495604_0087167_197_907 210
109 3300047320 Ga0495672_0086384 Ga0495672_0086384_180_890 210
110 3300048088 Ga0495602_0001468 Ga0495602_0001468_3713_4423 210
111 3300048088 Ga0495602_0142228 Ga0495602_0142228_923_1630 210
112 3300048907 Ga0496104_0063904 Ga0496104_0063904_64_774 210
113 3300048912 Ga0496109_0000062 Ga0496109_0000062_84514_85224 210
114 3300048912 Ga0496109_0683963 Ga0496109_0683963_169_882 210
115 3300048913 Ga0496110_0043233 Ga0496110_0043233_1329_2039 210
116 3300048927 Ga0496124_0234567 Ga0496124_0234567_460_1170 210
117 3300053078 Ga0495612_0009235 Ga0495612_0009235_1792_2502 210
118 3300053083 Ga0495655_0000645 Ga0495655_0000645_320_1030 210
119 3300053084 Ga0495595_0005266 Ga0495595_0005266_3119_3829 210
120 3300005337 Ga0070682_100112944 Ga0070682_1001129442 211
121 3300005341 Ga0070691_10086107 Ga0070691_100861074 211
122 3300005343 Ga0070687_100137299 Ga0070687_1001372992 211
123 3300005367 Ga0070667_100076757 Ga0070667_1000767574 211
124 3300005441 Ga0070700_100230790 Ga0070700_1002307902 211
125 3300005548 Ga0070665_100041685 Ga0070665_1000416852 211
126 3300005841 Ga0068863_100002005 Ga0068863_10000200512 211
127 3300005843 Ga0068860_100239790 Ga0068860_1002397902 211
128 3300005937 Ga0081455_10013351 Ga0081455_100133517 211
129 3300009176 Ga0105242_10000078 Ga0105242_1000007852 211
130 3300013296 Ga0157374_10062173 Ga0157374_100621732 211
131 3300013306 Ga0163162_10116044 Ga0163162_101160445 211
132 3300014745 Ga0157377_10485665 Ga0157377_104856651 211
133 3300014968 Ga0157379_10100718 Ga0157379_101007184 211
134 3300025918 Ga0207662_10119558 Ga0207662_101195582 211
135 3300025923 Ga0207681_10098677 Ga0207681_100986772 211
136 3300025934 Ga0207686_10000105 Ga0207686_1000010554 211
137 3300025986 Ga0207658_10113125 Ga0207658_101131252 211
138 3300026088 Ga0207641_10001990 Ga0207641_100019906 211
139 3300028381 Ga0268264_10107499 Ga0268264_101074993 211
140 3300044694 Ga0466963_0048261 Ga0466963_0048261_1098_1814 211
141 3300045976 Ga0466967_0145895 Ga0466967_0145895_406_1122 211
142 3300046459 Ga0495629_0004513 Ga0495629_0004513_5810_6523 211
143 3300046463 Ga0495653_0350858 Ga0495653_0350858_127_843 211
144 3300046476 Ga0495662_0026076 Ga0495662_0026076_866_1582 211
145 3300046511 Ga0495608_0061762 Ga0495608_0061762_1325_2035 211
146 3300046517 Ga0495630_0521038 Ga0495630_0521038_152_862 211
147 3300046529 Ga0495652_0017480 Ga0495652_0017480_705_1415 211
148 3300046536 Ga0495587_0053828 Ga0495587_0053828_513_1229 211
149 3300046543 Ga0495645_0073469 Ga0495645_0073469_644_1354 211
150 3300047321 Ga0495676_0000480 Ga0495676_0000480_7160_7870 211
151 3300047322 Ga0495680_0126723 Ga0495680_0126723_395_1108 211
152 3300048903 Ga0496100_0000035 Ga0496100_0000035_50349_51059 211
153 3300048904 Ga0496101_0000087 Ga0496101_0000087_54393_55103 211
154 3300048909 Ga0496106_0000068 Ga0496106_0000068_28389_29099 211
155 3300048910 Ga0496107_0000018 Ga0496107_0000018_121998_122708 211
156 3300048916 Ga0496113_0011317 Ga0496113_0011317_4712_5425 211
157 3300048917 Ga0496114_0000003 Ga0496114_0000003_14347_15066 211
158 3300048918 Ga0496115_0000856 Ga0496115_0000856_17337_18056 211
159 3300048924 Ga0496121_0220347 Ga0496121_0220347_308_1027 211
160 3300002074 JGI24748J21848_1000629 JGI24748J21848_10006295 212
161 3300002239 JGI24034J26672_10000381 JGI24034J26672_100003811 212
162 3300002244 JGI24742J22300_10008619 JGI24742J22300_100086193 212
163 3300005329 Ga0070683_100003996 Ga0070683_1000039969 212
164 3300005356 Ga0070674_100000001 Ga0070674_100000001130 212
165 3300005438 Ga0070701_10078746 Ga0070701_100787463 212
166 3300005535 Ga0070684_100035595 Ga0070684_1000355952 212
167 3300005535 Ga0070684_100064694 Ga0070684_1000646946 212
168 3300005718 Ga0068866_10000014 Ga0068866_1000001435 212
169 3300005718 Ga0068866_10005461 Ga0068866_100054614 212
170 3300005841 Ga0068863_100111786 Ga0068863_1001117862 212
171 3300005843 Ga0068860_100321092 Ga0068860_1003210923 212
172 3300005937 Ga0081455_10026481 Ga0081455_100264813 212
173 3300005983 Ga0081540_1000281 Ga0081540_10002815 212
174 3300006173 Ga0070716_100037858 Ga0070716_1000378582 212
175 3300006881 Ga0068865_100000056 Ga0068865_10000005644 212
176 3300009011 Ga0105251_10060041 Ga0105251_100600414 212
177 3300009093 Ga0105240_10612438 Ga0105240_106124381 212
178 3300009101 Ga0105247_10001918 Ga0105247_100019186 212
179 3300009177 Ga0105248_10000210 Ga0105248_1000021039 212
180 3300009553 Ga0105249_10189218 Ga0105249_101892182 212
181 3300013104 Ga0157370_10028018 Ga0157370_100280187 212
182 3300013307 Ga0157372_10000435 Ga0157372_1000043540 212
183 3300014968 Ga0157379_10118376 Ga0157379_101183763 212
184 3300025735 Ga0207713_1050209 Ga0207713_10502094 212
185 3300025899 Ga0207642_10000001 Ga0207642_10000001715 212
186 3300025899 Ga0207642_10000022 Ga0207642_1000002212 212
187 3300025900 Ga0207710_10001110 Ga0207710_100011106 212
188 3300025905 Ga0207685_10000001 Ga0207685_10000001151 212
189 3300025913 Ga0207695_10248504 Ga0207695_102485042 212
190 3300025925 Ga0207650_10040522 Ga0207650_100405225 212
191 3300025937 Ga0207669_10000002 Ga0207669_10000002219 212
192 3300025937 Ga0207669_10000181 Ga0207669_1000018130 212
193 3300025938 Ga0207704_10000092 Ga0207704_1000009230 212
194 3300025941 Ga0207711_10000165 Ga0207711_1000016522 212
195 3300025944 Ga0207661_10002770 Ga0207661_100027703 212
196 3300025944 Ga0207661_10031358 Ga0207661_100313582 212
197 3300026035 Ga0207703_10127286 Ga0207703_101272862 212
198 3300026088 Ga0207641_10070502 Ga0207641_100705025 212
199 3300026118 Ga0207675_100253573 Ga0207675_1002535734 212
200 3300028381 Ga0268264_10296317 Ga0268264_102963172 212
201 3300028563 Ga0265319_1000693 Ga0265319_100069325 212
202 3300028800 Ga0265338_10003560 Ga0265338_1000356024 212
203 3300031241 Ga0265325_10048249 Ga0265325_100482494 212
204 3300031250 Ga0265331_10052193 Ga0265331_100521933 212
205 3300031344 Ga0265316_10276914 Ga0265316_102769142 212
206 3300045836 Ga0466958_0021660 Ga0466958_0021660_2598_3314 212
207 3300046454 Ga0495592_0299792 Ga0495592_0299792_34_750 212
208 3300046455 Ga0495603_0001082 Ga0495603_0001082_11712_12425 212
209 3300046461 Ga0495641_0030585 Ga0495641_0030585_1122_1832 212
210 3300046477 Ga0495664_0088818 Ga0495664_0088818_1123_1836 212
211 3300046499 Ga0495594_0000017 Ga0495594_0000017_78279_79001 212
212 3300046511 Ga0495608_0000010 Ga0495608_0000010_86901_87623 212
213 3300046516 Ga0495628_0003462 Ga0495628_0003462_5707_6423 212
214 3300046516 Ga0495628_0025860 Ga0495628_0025860_1659_2375 212
215 3300046517 Ga0495630_0001454 Ga0495630_0001454_7935_8651 212
216 3300046529 Ga0495652_0000022 Ga0495652_0000022_12362_13078 212
217 3300046536 Ga0495587_0000695 Ga0495587_0000695_2490_3212 212
218 3300046557 Ga0495622_0000057 Ga0495622_0000057_87165_87887 212
219 3300046559 Ga0495667_0000086 Ga0495667_0000086_44341_45057 212
220 3300046675 Ga0495657_0000005 Ga0495657_0000005_167238_167960 212
221 3300046678 Ga0495599_0001408 Ga0495599_0001408_8415_9137 212
222 3300046683 Ga0495658_0008541 Ga0495658_0008541_2263_2979 212
223 3300046689 Ga0495613_0000087 Ga0495613_0000087_9118_9834 212
224 3300046689 Ga0495613_0000654 Ga0495613_0000654_5755_6471 212
225 3300046690 Ga0495624_0000365 Ga0495624_0000365_10436_11146 212
226 3300046809 Ga0495600_0013923 Ga0495600_0013923_3179_3895 212
227 3300047317 Ga0495604_0000081 Ga0495604_0000081_71341_72057 212
228 3300047317 Ga0495604_0000460 Ga0495604_0000460_14253_14969 212
229 3300047319 Ga0495674_0000115 Ga0495674_0000115_31412_32128 212
230 3300047319 Ga0495674_0044110 Ga0495674_0044110_1218_1934 212
231 3300047444 Ga0495675_0000004 Ga0495675_0000004_78041_78763 212
232 3300047444 Ga0495675_0291845 Ga0495675_0291845_51_767 212
233 3300047673 Ga0495593_0035503 Ga0495593_0035503_198_914 212
234 3300048088 Ga0495602_0000150 Ga0495602_0000150_25271_25987 212
235 3300048905 Ga0496102_0000132 Ga0496102_0000132_25411_26151 212
236 3300048905 Ga0496102_0379100 Ga0496102_0379100_27_743 212
237 3300048908 Ga0496105_0000351 Ga0496105_0000351_11650_12366 212
238 3300048917 Ga0496114_0133761 Ga0496114_0133761_318_1031 212
239 3300048918 Ga0496115_0000005 Ga0496115_0000005_174474_175187 212
240 3300048918 Ga0496115_0000909 Ga0496115_0000909_11677_12393 212
241 3300053077 Ga0495601_0000065 Ga0495601_0000065_53437_54153 212
242 3300053077 Ga0495601_0168679 Ga0495601_0168679_634_1350 212
243 3300053078 Ga0495612_0003791 Ga0495612_0003791_1367_2083 212
244 3300053083 Ga0495655_0000009 Ga0495655_0000009_54356_55096 212
245 3300053084 Ga0495595_0000005 Ga0495595_0000005_171038_171760 212
246 3300053085 Ga0495619_0000030 Ga0495619_0000030_125698_126420 212
247 3300053129 Ga0500628_000022 Ga0500628_000022_31197_31937 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

28

218

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

34

251

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3svt-assembly1.cif.gz_B structure of a short-chain type dehydrogenase/reductase from mycobacterium ulcerans 0.8847 3 210
6xex-assembly1.cif.gz_B structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a/v139q 0.8846 1 210
4rf5-assembly1.cif.gz_A crystal structure of ketoreductase from lactobacillus kefir, e145s mutant 0.8835 1 212
3lf2-assembly1.cif.gz_A nadph bound structure of the short chain oxidoreductase q9hya2 from pseudomonas aeruginosa pao1 containing an atypical catalytic center 0.8832 7 212
4rf3-assembly1.cif.gz_A crystal structure of ketoreductase from lactobacillus kefir, mutant a94f 0.8824 1 212
ID Description Score Start End Superfamily
af_B0G160_35_582_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9143 9 38 3.50.50.60
af_Q0ISZ5_12_118_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8899 3 95 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8821 7 89 3.40.50.720
3lf2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8819 8 211 3.40.50.720
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8809 6 87 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A522MVQ0-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9246 5 143 GO:0016491
AF-A0A524J9L3-F1-model_v4 SDR family oxidoreductase 0.9234 2 178 GO:0016491
AF-A0A842Q5T5-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9223 3 143
AF-A0A5N8VR36-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9138 1 129 GO:0016020
GO:0016491
AF-A0A399YYU8-F1-model_v4 SDR family oxidoreductase 0.9135 2 212 GO:0016491

Feature Viewer

pLDDT pTM Quality
86.92 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map