F358992

General Info

Members Datasets Scaffolds Average Seq Length
247 179 494 213

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10016477|Ga0157373_100164776
Length 240
Sequence MFFNIFCGCVSFGPGNRQTGGKDMKIYWIKAQAPRRVLALVKHLGIDAQCIEVDLQVGGLKTSSYLALNPNGKAPTMVDGDVTLWESSAIMAYLCVKTGSDMWPVHRPAEQIEILRWLSWNDSHWSRAVGPFYFEHVIKPEFHLGEPDDSELTGAMPELMKLAAVLDDHLEQRDFVACGRLTIADFQLASMACDWRRSDMPLADFSHVVRWLDRLMDIPGWADPWPARVAGQPAPVLASA

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
65 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
66 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
145 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
146 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
147 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
151 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
152 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
153 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
172 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
175 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
176 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
177 2739367700 Dyella sp. YR388 Isolate Unclassified
178 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
179 2928963466 Dyella japonica 1073 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.17
Metatranscriptomes 1.62
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.81
Nodule 0
Rhizoplane 3.64
Rhizosphere 65.59
Stem 0
Stem Tuber 0
Unclassified 4.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10016477 3300013100 Bacteria 5390
2 JGI24739J22299_10031810 3300001989 Bacteria 1821
3 JGI24737J22298_10005270 3300001990 Bacteria 4472
4 JGI24735J21928_10005311 3300002067 Bacteria 4277
5 JGI25156J39149_1012477 3300002705 Bacteria 1864
6 JGI25162J39368_1000066 3300002737 Bacteria 130612
7 JGI25162J39368_1001441 3300002737 Bacteria 12720
8 JGI25162J39368_1002131 3300002737 Bacteria 8362
9 JGI25154J39366_1009578 3300002738 Bacteria 1185
10 JGI25157J39369_1000050 3300002741 Bacteria 114470
11 JGI25163J39215_1000224 3300002771 Bacteria 21198
12 JGI25164J39214_1000056 3300002772 Bacteria 114468
13 JGI25164J39214_1000923 3300002772 Bacteria 9729
14 JGI25151J46595_10000008 3300003187 Bacteria 334180
15 JGI25165J46597_1000009 3300003214 Bacteria 467965
16 JGI25165J46597_1001435 3300003214 Bacteria 12752
17 rootH1_10095801 3300003316 Bacteria 2793
18 rootH1_10142730 3300003316 Bacteria 1582
19 rootH2_10094653 3300003320 Bacteria 3795
20 rootH1_10045431 3300003323 Bacteria 4678
21 Ga0055538_1000797 3300003751 Bacteria 8653
22 Ga0055533_1000225 3300003756 Bacteria 38201
23 Ga0055527_1010872 3300003760 Bacteria 1046
24 Ga0055535_1000045 3300003761 Bacteria 140688
25 Ga0055542_1000079 3300003762 Bacteria 130623
26 Ga0055542_1001057 3300003762 Bacteria 17067
27 Ga0055529_1000122 3300003763 Bacteria 114462
28 Ga0065712_10247310 3300005290 Bacteria 968
29 Ga0070680_100504376 3300005336 Bacteria 1035
30 Ga0070689_100001372 3300005340 Bacteria 15465
31 Ga0070688_100026082 3300005365 Bacteria 3468
32 Ga0070667_100259930 3300005367 Bacteria 1554
33 Ga0070714_100000439 3300005435 Bacteria 30200
34 Ga0070714_100250378 3300005435 Bacteria 1638
35 Ga0070710_10084295 3300005437 Bacteria 1862
36 Ga0070663_100246073 3300005455 Bacteria 1414
37 Ga0070681_10141804 3300005458 Bacteria 2332
38 Ga0070681_10380868 3300005458 Bacteria 1321
39 Ga0070706_100794391 3300005467 Bacteria 876
40 Ga0070679_100073735 3300005530 Bacteria 3404
41 Ga0068853_100004383 3300005539 Bacteria 10927
42 Ga0070665_100125118 3300005548 Bacteria 2573
43 Ga0068855_100020705 3300005563 Bacteria 7887
44 Ga0068855_100024004 3300005563 Bacteria 7300
45 Ga0068857_100160143 3300005577 Bacteria 2042
46 Ga0068856_100327681 3300005614 Unclassified 1549
47 Ga0068859_100588478 3300005617 Bacteria 1206
48 Ga0068864_100092570 3300005618 Bacteria 2669
49 Ga0068861_101073872 3300005719 Bacteria 772
50 Ga0068863_100008424 3300005841 Bacteria 10068
51 Ga0068863_100014125 3300005841 Bacteria 7692
52 Ga0068860_100323214 3300005843 Bacteria 1515
53 Ga0068860_100649911 3300005843 Bacteria 1062
54 Ga0068862_100028987 3300005844 Bacteria 4663
55 Ga0070717_10002605 3300006028 Bacteria 12717
56 Ga0070716_100208573 3300006173 Bacteria 1304
57 Ga0070712_100084695 3300006175 Bacteria 2306
58 Ga0075366_10046140 3300006195 Bacteria 2582
59 Ga0097620_100588502 3300006931 Bacteria 1206
60 Ga0099794_10272055 3300007265 Bacteria 875
61 Ga0105240_10000123 3300009093 Bacteria 160908
62 Ga0105240_10001969 3300009093 Bacteria 33947
63 Ga0105238_10051483 3300009551 Bacteria 4142
64 Ga0105249_10054035 3300009553 Bacteria 3672
65 Ga0105249_10060375 3300009553 Bacteria 3478
66 Ga0105249_10267044 3300009553 Bacteria 1703
67 Ga0105148_107405 3300009978 Bacteria 814
68 Ga0105239_10000090 3300010375 Bacteria 127911
69 Ga0105239_10006908 3300010375 Bacteria 13093
70 Ga0157373_10024546 3300013100 Bacteria 4366
71 Ga0157371_10689008 3300013102 Bacteria 764
72 Ga0157370_10021678 3300013104 Bacteria 6401
73 Ga0157369_10111073 3300013105 Bacteria 2913
74 Ga0157369_10113603 3300013105 Bacteria 2877
75 Ga0157375_10667723 3300013308 Bacteria 1195
76 Ga0163163_10692235 3300014325 Bacteria 1083
77 Ga0182008_10031586 3300014497 Bacteria 2665
78 Ga0182008_10038537 3300014497 Bacteria 2390
79 Ga0157376_10044260 3300014969 Bacteria 3658
80 Ga0182006_1027564 3300015261 Bacteria 2317
81 Ga0182007_10065485 3300015262 Bacteria 1191
82 Ga0183369_1003 3300015685 Bacteria 726443
83 Ga0183368_1002 3300015687 Bacteria 1865598
84 Ga0209760_100327 3300025207 Bacteria 14335
85 Ga0209784_100013 3300025224 Bacteria 518664
86 Ga0209674_100014 3300025226 Bacteria 704989
87 Ga0209672_102696 3300025228 Bacteria 4129
88 Ga0207427_100030 3300025231 Bacteria 358045
89 Ga0207427_100101 3300025231 Bacteria 120866
90 Ga0207427_100645 3300025231 Bacteria 16905
91 Ga0209437_100012 3300025233 Bacteria 792625
92 Ga0209437_100090 3300025233 Bacteria 247138
93 Ga0209437_100162 3300025233 Bacteria 147864
94 Ga0209258_100019 3300025242 Bacteria 566728
95 Ga0209258_101702 3300025242 Bacteria 6875
96 Ga0209258_101890 3300025242 Bacteria 6245
97 Ga0209646_1000901 3300025246 Bacteria 9637
98 Ga0209646_1018212 3300025246 Bacteria 1030
99 Ga0209026_1000015 3300025250 Bacteria 395555
100 Ga0209148_1000001 3300025254 Bacteria 2545271
101 Ga0209148_1000005 3300025254 Bacteria 1806504
102 Ga0209759_1000367 3300025256 Bacteria 56530
103 Ga0209759_1005419 3300025256 Bacteria 4476
104 Ga0209233_1000002 3300025261 Bacteria 2501366
105 Ga0209233_1000077 3300025261 Bacteria 349570
106 Ga0209233_1015675 3300025261 Bacteria 2106
107 Ga0209455_1000027 3300025272 Bacteria 566710
108 Ga0209455_1008483 3300025272 Bacteria 2789
109 Ga0207692_10165376 3300025898 Bacteria 1278
110 Ga0207647_10007558 3300025904 Bacteria 7841
111 Ga0207684_10731067 3300025910 Bacteria 840
112 Ga0207695_10000312 3300025913 Bacteria 117260
113 Ga0207695_10004667 3300025913 Bacteria 18566
114 Ga0207693_10265965 3300025915 Bacteria 1344
115 Ga0207650_10613026 3300025925 Bacteria 916
116 Ga0207664_10003938 3300025929 Bacteria 9986
117 Ga0207670_10001001 3300025936 Bacteria 14944
118 Ga0207665_10100577 3300025939 Bacteria 2017
119 Ga0207711_10444847 3300025941 Bacteria 1206
120 Ga0207667_10033630 3300025949 Bacteria 5511
121 Ga0207667_10318750 3300025949 Bacteria 1588
122 Ga0207712_10305773 3300025961 Bacteria 1307
123 Ga0207639_10018371 3300026041 Bacteria 4968
124 Ga0207678_10302241 3300026067 Bacteria 1375
125 Ga0207678_10345499 3300026067 Bacteria 1283
126 Ga0207641_10015688 3300026088 Bacteria 6208
127 Ga0207676_10088590 3300026095 Bacteria 2534
128 Ga0207674_10223282 3300026116 Bacteria 1832
129 Ga0207675_100797920 3300026118 Bacteria 957
130 Ga0265354_1001019 3300028016 Bacteria 4366
131 Ga0268266_10096622 3300028379 Bacteria 2597
132 Ga0268265_10405183 3300028380 Bacteria 1262
133 Ga0268265_10526578 3300028380 Bacteria 1118
134 Ga0268264_10099137 3300028381 Bacteria 2528
135 Ga0265338_10037137 3300028800 Bacteria 4644
136 Ga0314311_1039021 3300030733 Unclassified 849
137 Ga0265762_1009026 3300030760 Bacteria 1777
138 Ga0265770_1000051 3300030878 Bacteria 12358
139 Ga0265760_10000676 3300031090 Bacteria 9709
140 Ga0265760_10137667 3300031090 Bacteria 793
141 Ga0265332_10139775 3300031238 Bacteria 1015
142 Ga0265340_10003708 3300031247 Bacteria 8602
143 Ga0265339_10000783 3300031249 Bacteria 24576
144 Ga0307408_100024038 3300031548 Bacteria 4156
145 Ga0265342_10000224 3300031712 Bacteria 64135
146 Ga0307516_10000288 3300031730 Bacteria 65317
147 Ga0307516_10044582 3300031730 Bacteria 4386
148 Ga0307405_10091603 3300031731 Bacteria 2015
149 Ga0307406_10000553 3300031901 Bacteria 21521
150 Ga0307406_10041090 3300031901 Bacteria 2880
151 Ga0373936_0003382 3300035113 Bacteria 5979
152 Ga0373933_0046371 3300035724 Plasmid 2581
153 Ga0395899_0108427 3300037312 Bacteria 1998
154 Ga0395899_0210331 3300037312 Bacteria 1352
155 Ga0395900_0000439 3300037418 Bacteria 59811
156 Ga0395900_0153517 3300037418 Bacteria 2352
157 Ga0395898_0000853 3300037466 Bacteria 50024
158 Ga0395898_0106722 3300037466 Bacteria 2686
159 Ga0395905_0000038 3300037471 Bacteria 253600
160 Ga0395905_0059133 3300037471 Bacteria 3583
161 Ga0436364_0534772 3300037853 Bacteria 5313
162 Ga0395901_0009119 3300038443 Bacteria 10047
163 Ga0439436_0004537 3300041404 Bacteria 4258
164 Ga0439436_0015169 3300041404 Unclassified 2319
165 Ga0451793_1918916 3300041452 Unclassified 1548
166 Ga0451807_0167431 3300041486 Unclassified 2241
167 Ga0439431_0090554 3300041997 Bacteria 833
168 Ga0439445_0000859 3300042004 Bacteria 6443
169 Ga0439448_0053532 3300042005 Bacteria 1325
170 Ga0439455_0030757 3300042012 Bacteria 1334
171 Ga0466959_0050907 3300045049 Bacteria 3040
172 Ga0451576_0813521 3300045051 Bacteria 981
173 Ga0495629_0279562 3300046459 Unclassified 1146
174 Ga0495638_0000650 3300046460 Bacteria 38037
175 Ga0495638_0000657 3300046460 Bacteria 37781
176 Ga0495650_0000849 3300046471 Bacteria 36705
177 Ga0495606_0002283 3300046507 Bacteria 22684
178 Ga0495652_0004657 3300046529 Bacteria 13082
179 Ga0495646_0006259 3300046680 Bacteria 7548
180 Ga0495658_0281919 3300046683 Bacteria 1049
181 Ga0495649_0011318 3300046694 Bacteria 5237
182 Ga0495649_0061144 3300046694 Bacteria 2025
183 Ga0495680_0071897 3300047322 Bacteria 2632
184 Ga0495679_101693 3300047446 Bacteria 798
185 Ga0496104_0338909 3300048907 Bacteria 1416
186 Ga0496105_0008837 3300048908 Bacteria 7847
187 Ga0496107_0063897 3300048910 Bacteria 2668
188 Ga0496115_0000170 3300048918 Bacteria 60309
189 Ga0496115_0001755 3300048918 Bacteria 15546
190 Ga0496115_0065038 3300048918 Bacteria 2945
191 Ga0496115_0153973 3300048918 Bacteria 1899
192 Ga0496116_0131303 3300048919 Bacteria 1427
193 Ga0496117_0036910 3300048920 Bacteria 3648
194 Ga0496117_0081225 3300048920 Bacteria 2128
195 Ga0496117_0084866 3300048920 Bacteria 2064
196 Ga0496118_0000779 3300048921 Bacteria 51068
197 Ga0496118_0012592 3300048921 Bacteria 8097
198 Ga0496118_0170480 3300048921 Bacteria 1330
199 Ga0496119_0000218 3300048922 Bacteria 81458
200 Ga0496120_0000322 3300048923 Bacteria 79400
201 Ga0496121_0000883 3300048924 Bacteria 54178
202 Ga0496121_0025126 3300048924 Bacteria 5667
203 Ga0496126_0002101 3300048929 Bacteria 27893
204 Ga0496126_0040031 3300048929 Bacteria 4346
205 Ga0496126_0220190 3300048929 Bacteria 1594
206 Ga0495678_025594 3300049459 Bacteria 2532
207 Ga0495682_0019181 3300049460 Bacteria 2573
208 Ga0501031_0046969 3300049568 Bacteria 2815
209 Ga0501032_0356779 3300049569 Bacteria 941
210 Ga0501033_0001461 3300049570 Bacteria 20955
211 Ga0501033_0128899 3300049570 Bacteria 1833
212 Ga0501033_0477453 3300049570 Bacteria 864
213 Ga0501034_0636595 3300049571 Bacteria 969
214 Ga0501036_0019026 3300049572 Bacteria 5762
215 Ga0501036_0197719 3300049572 Bacteria 1691
216 Ga0501037_0021419 3300049573 Bacteria 4776
217 Ga0501037_0215716 3300049573 Bacteria 1352
218 Ga0501038_0043788 3300049574 Bacteria 3891
219 Ga0501039_0075277 3300049575 Bacteria 2624
220 Ga0501043_0001543 3300049579 Bacteria 20071
221 Ga0501046_0432732 3300049580 Bacteria 947
222 Ga0501047_0118987 3300049581 Bacteria 2523
223 Ga0501047_0212492 3300049581 Bacteria 1792
224 Ga0501048_0057583 3300049582 Bacteria 2756
225 Ga0501070_0641564 3300049586 Bacteria 844
226 Ga0501225_0001030 3300049705 Bacteria 8743
227 Ga0501080_0149803 3300049742 Bacteria 2157
228 Ga0501035_0048793 3300049822 Bacteria 3795
229 Ga0501035_0250625 3300049822 Bacteria 1504
230 Ga0501035_0310692 3300049822 Bacteria 1326
231 Ga0501035_0320422 3300049822 Bacteria 1302
232 Ga0501035_0325620 3300049822 Bacteria 1290
233 Ga0501035_0480695 3300049822 Bacteria 1024
234 Ga0501044_0000183 3300049823 Bacteria 77954
235 Ga0501044_0077165 3300049823 Bacteria 3379
236 Ga0501044_0144769 3300049823 Bacteria 2363
237 Ga0501044_0448814 3300049823 Bacteria 1196
238 Ga0500643_024708 3300053087 Bacteria 1904
239 Ga0500555_010965 3300053103 Unclassified 2602
240 Ga0500595_005479 3300053119 Bacteria 5538
241 Ga0500564_011769 3300053138 Unclassified 3870
242 Ga0500636_0089523 3300053177 Bacteria 1764
243 Ga0500636_0259646 3300053177 Unclassified 880
244 Ga0500661_006428 3300055283 Unclassified 2186
245 2739733971 2739367700 Bacteria 4747630
246 2852683610 2852680915 Bacteria 4100189
247 2928966131 2928963466 Bacteria 5165703
248 Ga0157373_10016477
249 JGI24739J22299_10031810
250 JGI24737J22298_10005270
251 JGI24735J21928_10005311
252 JGI25156J39149_1012477
253 JGI25162J39368_1000066
254 JGI25162J39368_1001441
255 JGI25162J39368_1002131
256 JGI25154J39366_1009578
257 JGI25157J39369_1000050
258 JGI25163J39215_1000224
259 JGI25164J39214_1000056
260 JGI25164J39214_1000923
261 JGI25151J46595_10000008
262 JGI25165J46597_1000009
263 JGI25165J46597_1001435
264 rootH1_10095801
265 rootH1_10142730
266 rootH2_10094653
267 rootH1_10045431
268 Ga0055538_1000797
269 Ga0055533_1000225
270 Ga0055527_1010872
271 Ga0055535_1000045
272 Ga0055542_1000079
273 Ga0055542_1001057
274 Ga0055529_1000122
275 Ga0065712_10247310
276 Ga0070680_100504376
277 Ga0070689_100001372
278 Ga0070688_100026082
279 Ga0070667_100259930
280 Ga0070714_100000439
281 Ga0070714_100250378
282 Ga0070710_10084295
283 Ga0070663_100246073
284 Ga0070681_10141804
285 Ga0070681_10380868
286 Ga0070706_100794391
287 Ga0070679_100073735
288 Ga0068853_100004383
289 Ga0070665_100125118
290 Ga0068855_100020705
291 Ga0068855_100024004
292 Ga0068857_100160143
293 Ga0068856_100327681
294 Ga0068859_100588478
295 Ga0068864_100092570
296 Ga0068861_101073872
297 Ga0068863_100008424
298 Ga0068863_100014125
299 Ga0068860_100323214
300 Ga0068860_100649911
301 Ga0068862_100028987
302 Ga0070717_10002605
303 Ga0070716_100208573
304 Ga0070712_100084695
305 Ga0075366_10046140
306 Ga0097620_100588502
307 Ga0099794_10272055
308 Ga0105240_10000123
309 Ga0105240_10001969
310 Ga0105238_10051483
311 Ga0105249_10054035
312 Ga0105249_10060375
313 Ga0105249_10267044
314 Ga0105148_107405
315 Ga0105239_10000090
316 Ga0105239_10006908
317 Ga0157373_10024546
318 Ga0157371_10689008
319 Ga0157370_10021678
320 Ga0157369_10111073
321 Ga0157369_10113603
322 Ga0157375_10667723
323 Ga0163163_10692235
324 Ga0182008_10031586
325 Ga0182008_10038537
326 Ga0157376_10044260
327 Ga0182006_1027564
328 Ga0182007_10065485
329 Ga0183369_1003
330 Ga0183368_1002
331 Ga0209760_100327
332 Ga0209784_100013
333 Ga0209674_100014
334 Ga0209672_102696
335 Ga0207427_100030
336 Ga0207427_100101
337 Ga0207427_100645
338 Ga0209437_100012
339 Ga0209437_100090
340 Ga0209437_100162
341 Ga0209258_100019
342 Ga0209258_101702
343 Ga0209258_101890
344 Ga0209646_1000901
345 Ga0209646_1018212
346 Ga0209026_1000015
347 Ga0209148_1000001
348 Ga0209148_1000005
349 Ga0209759_1000367
350 Ga0209759_1005419
351 Ga0209233_1000002
352 Ga0209233_1000077
353 Ga0209233_1015675
354 Ga0209455_1000027
355 Ga0209455_1008483
356 Ga0207692_10165376
357 Ga0207647_10007558
358 Ga0207684_10731067
359 Ga0207695_10000312
360 Ga0207695_10004667
361 Ga0207693_10265965
362 Ga0207650_10613026
363 Ga0207664_10003938
364 Ga0207670_10001001
365 Ga0207665_10100577
366 Ga0207711_10444847
367 Ga0207667_10033630
368 Ga0207667_10318750
369 Ga0207712_10305773
370 Ga0207639_10018371
371 Ga0207678_10302241
372 Ga0207678_10345499
373 Ga0207641_10015688
374 Ga0207676_10088590
375 Ga0207674_10223282
376 Ga0207675_100797920
377 Ga0265354_1001019
378 Ga0268266_10096622
379 Ga0268265_10405183
380 Ga0268265_10526578
381 Ga0268264_10099137
382 Ga0265338_10037137
383 Ga0314311_1039021
384 Ga0265762_1009026
385 Ga0265770_1000051
386 Ga0265760_10000676
387 Ga0265760_10137667
388 Ga0265332_10139775
389 Ga0265340_10003708
390 Ga0265339_10000783
391 Ga0307408_100024038
392 Ga0265342_10000224
393 Ga0307516_10000288
394 Ga0307516_10044582
395 Ga0307405_10091603
396 Ga0307406_10000553
397 Ga0307406_10041090
398 Ga0373936_0003382
399 Ga0373933_0046371
400 Ga0395899_0108427
401 Ga0395899_0210331
402 Ga0395900_0000439
403 Ga0395900_0153517
404 Ga0395898_0000853
405 Ga0395898_0106722
406 Ga0395905_0000038
407 Ga0395905_0059133
408 Ga0436364_0534772
409 Ga0395901_0009119
410 Ga0439436_0004537
411 Ga0439436_0015169
412 Ga0451793_1918916
413 Ga0451807_0167431
414 Ga0439431_0090554
415 Ga0439445_0000859
416 Ga0439448_0053532
417 Ga0439455_0030757
418 Ga0466959_0050907
419 Ga0451576_0813521
420 Ga0495629_0279562
421 Ga0495638_0000650
422 Ga0495638_0000657
423 Ga0495650_0000849
424 Ga0495606_0002283
425 Ga0495652_0004657
426 Ga0495646_0006259
427 Ga0495658_0281919
428 Ga0495649_0011318
429 Ga0495649_0061144
430 Ga0495680_0071897
431 Ga0495679_101693
432 Ga0496104_0338909
433 Ga0496105_0008837
434 Ga0496107_0063897
435 Ga0496115_0000170
436 Ga0496115_0001755
437 Ga0496115_0065038
438 Ga0496115_0153973
439 Ga0496116_0131303
440 Ga0496117_0036910
441 Ga0496117_0081225
442 Ga0496117_0084866
443 Ga0496118_0000779
444 Ga0496118_0012592
445 Ga0496118_0170480
446 Ga0496119_0000218
447 Ga0496120_0000322
448 Ga0496121_0000883
449 Ga0496121_0025126
450 Ga0496126_0002101
451 Ga0496126_0040031
452 Ga0496126_0220190
453 Ga0495678_025594
454 Ga0495682_0019181
455 Ga0501031_0046969
456 Ga0501032_0356779
457 Ga0501033_0001461
458 Ga0501033_0128899
459 Ga0501033_0477453
460 Ga0501034_0636595
461 Ga0501036_0019026
462 Ga0501036_0197719
463 Ga0501037_0021419
464 Ga0501037_0215716
465 Ga0501038_0043788
466 Ga0501039_0075277
467 Ga0501043_0001543
468 Ga0501046_0432732
469 Ga0501047_0118987
470 Ga0501047_0212492
471 Ga0501048_0057583
472 Ga0501070_0641564
473 Ga0501225_0001030
474 Ga0501080_0149803
475 Ga0501035_0048793
476 Ga0501035_0250625
477 Ga0501035_0310692
478 Ga0501035_0320422
479 Ga0501035_0325620
480 Ga0501035_0480695
481 Ga0501044_0000183
482 Ga0501044_0077165
483 Ga0501044_0144769
484 Ga0501044_0448814
485 Ga0500643_024708
486 Ga0500555_010965
487 Ga0500595_005479
488 Ga0500564_011769
489 Ga0500636_0089523
490 Ga0500636_0259646
491 Ga0500661_006428
492 2739733971
493 2852683610
494 2928966131

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

33

97

0.93

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

24

95

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

33

100

0.87

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

122

219

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zb6-assembly1.cif.gz_A crystal structure of lolium rigidum gstf in complex with s-(p-nitrobenzyl) glutathione 0.9174 2 201
6riv-assembly1.cif.gz_A crystal structure of alopecurus myosuroides gstf 0.9171 2 201
7obo-assembly1.cif.gz_AAA-2 gstf1 from alopecurus myosuroides 0.9149 2 201
6tk8-assembly1.cif.gz_AAA-2 gstf1 f122t variant from alopecurus myosuroides 0.9142 2 201
7odm-assembly1.cif.gz_AAA-2 amgstf1 y118s variant 0.9065 2 201
ID Description Score Start End Superfamily
af_F1R9R0_45_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9703 2 75 3.40.30.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9691 2 63 3.40.30.10
af_Q9FHE1_1_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.968 2 74 3.40.30.10
af_D3Z8I7_45_138_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9643 2 77 3.40.30.10
af_Q7JYX0_7_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.961 3 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1V3NXJ4-F1-model_v4 Glutathione S-transferase 0.994 1 204 GO:0016740
AF-A0A1V3NXJ4-F1-model_v4 Glutathione S-transferase 0.9892 1 204 GO:0016740
AF-A0A7V8YEU5-F1-model_v4 Glutathione S-transferase family protein 0.9533 1 199 GO:0005737
GO:0016740
AF-A0A6J4PL94-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9479 1 204 GO:0004364
AF-A0A3B4CE34-F1-model_v4 deleted 0.9457 32 208

Map