F359022

General Info

Members Datasets Scaffolds Average Seq Length
247 216 245 216

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10759124|Ga0157380_107591241
Length 220
Sequence MTAFPRSPRLLKGGLVLIDPATAAVQRIIVLQYNPDTLSRTLQVQGVGESGDRSEALRLKGPPVETIKLEAEVDVTDQLELPQQGQNHLAVELGLHPQLAALETVVYPSSRQVEESNLLAKLGTLEIAPAEAPLTLFIWSATRVLPVRVTELSITEEAFDPALNPIRAKISLGLRVLNVNDLGFSHKGGDLFMTYFKQKEQLAARIAGGGFGALGIGDIS

Samples

Sample ID Description Type Environment
1 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
2 2902582711 Micromonospora sp. AP08 Isolate Unclassified
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
93 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
124 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
125 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
140 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
141 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
142 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
184 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
185 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
186 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
187 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
190 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
191 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
192 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
193 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
198 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
203 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
204 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
208 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
216 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.55
Nodule 0
Rhizoplane 2.02
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10010045 3300001989 Bacteria 3519
2 JGI24735J21928_10006358 3300002067 Bacteria 3897
3 JGI24748J21848_1000002 3300002074 Bacteria 426946
4 JGI24034J26672_10000004 3300002239 Bacteria 426946
5 JGI25156J39149_1006164 3300002705 Bacteria 3319
6 JGI25162J39368_1000951 3300002737 Bacteria 18558
7 JGI25157J39369_1002677 3300002741 Bacteria 4156
8 JGI25164J39214_1000116 3300002772 Bacteria 76944
9 JGI25165J46597_1000382 3300003214 Bacteria 48091
10 rootH2_10080878 3300003320 Bacteria 4686
11 rootL2_10118078 3300003322 Bacteria 6116
12 rootH1_10071972 3300003316 Bacteria 1620
13 rootH1_10071972 3300003323 Bacteria 14797
14 Ga0055533_1001306 3300003756 Bacteria 6771
15 Ga0055527_1003742 3300003760 Bacteria 2196
16 Ga0055535_1000637 3300003761 Bacteria 27979
17 Ga0055535_1000853 3300003761 Bacteria 21692
18 Ga0055542_1001130 3300003762 Bacteria 15854
19 Ga0055529_1000366 3300003763 Bacteria 49046
20 Ga0065715_10100035 3300005293 Bacteria 3343
21 Ga0070670_100002333 3300005331 Bacteria 15632
22 Ga0070670_100313142 3300005331 Bacteria 1374
23 Ga0068869_101071644 3300005334 Unclassified 704
24 Ga0070689_100000789 3300005340 Bacteria 19452
25 Ga0070691_10381295 3300005341 Bacteria 790
26 Ga0070669_100095189 3300005353 Bacteria 2239
27 Ga0070671_100046913 3300005355 Bacteria 3593
28 Ga0070673_100421220 3300005364 Unclassified 1197
29 Ga0070703_10000004 3300005406 Bacteria 136572
30 Ga0070709_10149702 3300005434 Bacteria 1612
31 Ga0070708_100143899 3300005445 Bacteria 2213
32 Ga0070678_100084266 3300005456 Bacteria 2419
33 Ga0070662_100005929 3300005457 Bacteria 7839
34 Ga0070662_100115001 3300005457 Unclassified 2055
35 Ga0070681_10658487 3300005458 Bacteria 962
36 Ga0068867_100133603 3300005459 Bacteria 1931
37 Ga0070685_10000611 3300005466 Bacteria 19687
38 Ga0070706_100001593 3300005467 Bacteria 23652
39 Ga0070706_100177257 3300005467 Bacteria 1990
40 Ga0070707_100002110 3300005468 Bacteria 19055
41 Ga0070707_100664353 3300005468 Bacteria 1005
42 Ga0070698_100119176 3300005471 Bacteria 2600
43 Ga0070699_100944547 3300005518 Unclassified 790
44 Ga0070697_100000140 3300005536 Bacteria 58765
45 Ga0070697_100002233 3300005536 Bacteria 14855
46 Ga0070686_100000080 3300005544 Bacteria 70371
47 Ga0070695_100564831 3300005545 Bacteria 889
48 Ga0070693_100191099 3300005547 Unclassified 1324
49 Ga0070693_100266771 3300005547 Bacteria 1141
50 Ga0070665_100000365 3300005548 Bacteria 67635
51 Ga0070704_100473489 3300005549 Unclassified 1082
52 Ga0070664_100085380 3300005564 Bacteria 2726
53 Ga0068854_100072193 3300005578 Bacteria 2527
54 Ga0068852_100556239 3300005616 Bacteria 1148
55 Ga0068859_100000046 3300005617 Bacteria 142733
56 Ga0068859_101035405 3300005617 Unclassified 902
57 Ga0068864_100001094 3300005618 Bacteria 22718
58 Ga0068870_10280365 3300005840 Bacteria 1045
59 Ga0068858_100000249 3300005842 Bacteria 57714
60 Ga0068858_100001031 3300005842 Bacteria 28780
61 Ga0068858_100028754 3300005842 Bacteria 5162
62 Ga0070717_10000134 3300006028 Bacteria 54840
63 Ga0075368_10002748 3300006042 Bacteria 5810
64 Ga0075364_10005531 3300006051 Bacteria 7355
65 Ga0070716_100221972 3300006173 Bacteria 1270
66 Ga0075367_10005069 3300006178 Bacteria 6502
67 Ga0075366_10046611 3300006195 Bacteria 2569
68 Ga0097621_100001093 3300006237 Bacteria 18962
69 Ga0075370_10027088 3300006353 Bacteria 3179
70 Ga0068871_100023286 3300006358 Unclassified 4788
71 Ga0075428_100015781 3300006844 Bacteria 8366
72 Ga0075431_100458272 3300006847 Bacteria 1270
73 Ga0075433_10522423 3300006852 Unclassified 1044
74 Ga0075434_100022420 3300006871 Bacteria 6151
75 Ga0075436_100099140 3300006914 Unclassified 2028
76 Ga0097620_100000046 3300006931 Bacteria 142733
77 Ga0097620_101035417 3300006931 Unclassified 902
78 Ga0105245_10368727 3300009098 Bacteria 1427
79 Ga0105247_10000005 3300009101 Bacteria 426989
80 Ga0105247_10022238 3300009101 Bacteria 3818
81 Ga0105247_10313991 3300009101 Unclassified 1091
82 Ga0105247_10327873 3300009101 Bacteria 1070
83 Ga0105243_10000996 3300009148 Bacteria 26244
84 Ga0105243_10591212 3300009148 Bacteria 1067
85 Ga0105242_10011854 3300009176 Bacteria 6710
86 Ga0105248_10629746 3300009177 Bacteria 1210
87 Ga0105238_11307410 3300009551 Bacteria 751
88 Ga0105249_10156227 3300009553 Bacteria 2200
89 Ga0157370_10014885 3300013104 Bacteria 7936
90 Ga0157369_10281485 3300013105 Bacteria 1732
91 Ga0157374_10386151 3300013296 Bacteria 1395
92 Ga0157378_10000015 3300013297 Bacteria 143601
93 Ga0163162_10013307 3300013306 Bacteria 8036
94 Ga0157375_10000092 3300013308 Bacteria 90157
95 Ga0157375_10006043 3300013308 Bacteria 10558
96 Ga0163163_10227088 3300014325 Bacteria 1916
97 Ga0157380_10759124 3300014326 Bacteria 982
98 Ga0157380_10855908 3300014326 Bacteria 931
99 Ga0183368_1004 3300015687 Bacteria 1211761
100 Ga0163161_10072645 3300017792 Bacteria 2519
101 Ga0207672_1000316 3300025223 Bacteria 6483
102 Ga0209674_100016 3300025226 Bacteria 696756
103 Ga0209672_100129 3300025228 Bacteria 76300
104 Ga0207427_100062 3300025231 Bacteria 178598
105 Ga0209437_100426 3300025233 Bacteria 37186
106 Ga0209258_100088 3300025242 Bacteria 237738
107 Ga0209646_1004332 3300025246 Bacteria 2602
108 Ga0209026_1002744 3300025250 Bacteria 6299
109 Ga0209148_1000024 3300025254 Bacteria 669890
110 Ga0209759_1001219 3300025256 Bacteria 15749
111 Ga0209233_1000023 3300025261 Bacteria 738870
112 Ga0209455_1000025 3300025272 Bacteria 670673
113 Ga0207710_10000004 3300025900 Bacteria 846540
114 Ga0207710_10009833 3300025900 Bacteria 4020
115 Ga0207643_10069041 3300025908 Unclassified 2031
116 Ga0207684_10001536 3300025910 Bacteria 24717
117 Ga0207684_10011559 3300025910 Bacteria 7714
118 Ga0207654_10353511 3300025911 Unclassified 1012
119 Ga0207707_10509402 3300025912 Bacteria 1026
120 Ga0207646_10003167 3300025922 Bacteria 18830
121 Ga0207650_10022197 3300025925 Bacteria 4493
122 Ga0207644_10002425 3300025931 Bacteria 12009
123 Ga0207706_10012101 3300025933 Bacteria 7858
124 Ga0207686_10010095 3300025934 Bacteria 5135
125 Ga0207709_10001187 3300025935 Bacteria 18824
126 Ga0207709_10186039 3300025935 Bacteria 1471
127 Ga0207670_10000653 3300025936 Bacteria 18358
128 Ga0207704_10871421 3300025938 Bacteria 756
129 Ga0207665_10139999 3300025939 Bacteria 1724
130 Ga0207711_10389614 3300025941 Unclassified 1294
131 Ga0207689_10672432 3300025942 Bacteria 873
132 Ga0207679_10161939 3300025945 Bacteria 1833
133 Ga0207651_10115849 3300025960 Unclassified 2022
134 Ga0207703_10000034 3300026035 Bacteria 184136
135 Ga0207703_10000323 3300026035 Bacteria 52038
136 Ga0207703_10038289 3300026035 Unclassified 3826
137 Ga0207648_10164101 3300026089 Bacteria 1962
138 Ga0207676_10000541 3300026095 Bacteria 31495
139 Ga0207698_10449219 3300026142 Bacteria 1244
140 Ga0209813_10004189 3300027866 Bacteria 3428
141 Ga0268266_10017328 3300028379 Bacteria 6148
142 Ga0307513_10277622 3300031456 Unclassified 1455
143 Ga0307408_100006007 3300031548 Bacteria 8080
144 Ga0307408_100405279 3300031548 Bacteria 1172
145 Ga0307508_10000022 3300031616 Bacteria 180417
146 Ga0316578_10140744 3300031728 Bacteria 1453
147 Ga0316577_10401198 3300031733 Bacteria 779
148 Ga0307413_10009133 3300031824 Bacteria 4727
149 Ga0307410_10009883 3300031852 Bacteria 5377
150 Ga0307407_10057142 3300031903 Bacteria 2262
151 Ga0307407_10410454 3300031903 Bacteria 974
152 Ga0307412_10013714 3300031911 Bacteria 4761
153 Ga0307409_100162070 3300031995 Unclassified 1957
154 Ga0307416_100016556 3300032002 Bacteria 5129
155 Ga0307414_10006929 3300032004 Bacteria 6349
156 Ga0307411_10012168 3300032005 Bacteria 4680
157 Ga0307415_100005575 3300032126 Bacteria 6699
158 Ga0316574_0298683 3300035398 Bacteria 1024
159 Ga0373924_0055959 3300035410 Bacteria 1642
160 Ga0373935_0101690 3300035692 Bacteria 1896
161 Ga0373937_0000967 3300036401 Bacteria 24372
162 Ga0400484_19089 3300038725 Bacteria 2022
163 Ga0400490_09010 3300038726 Bacteria 1103
164 Ga0400490_44035 3300038726 Bacteria 9020
165 Ga0400488_55484 3300038741 Bacteria 4750
166 Ga0400483_118306 3300039062 Bacteria 6787
167 Ga0450896_015407 3300042133 Bacteria 1095
168 Ga0450903_005142 3300042138 Bacteria 2198
169 Ga0439435_0001633 3300042436 Bacteria 4216
170 Ga0453683_0559209 3300044673 Unclassified 745
171 Ga0453684_0114551 3300044712 Bacteria 3268
172 Ga0495603_0061807 3300046455 Bacteria 2211
173 Ga0495638_0156886 3300046460 Bacteria 1316
174 Ga0495639_0008205 3300046475 Bacteria 4486
175 Ga0495607_0001591 3300046501 Bacteria 19757
176 Ga0495632_0201167 3300046519 Bacteria 907
177 Ga0495643_0000034 3300046522 Bacteria 238524
178 Ga0495654_0111139 3300046530 Bacteria 1250
179 Ga0495609_0000873 3300046538 Bacteria 22111
180 Ga0495597_0057817 3300046542 Bacteria 1696
181 Ga0495656_0001288 3300046615 Bacteria 8155
182 Ga0495625_0010658 3300046660 Bacteria 7576
183 Ga0495669_0015151 3300046684 Bacteria 3299
184 Ga0495613_0520111 3300046689 Bacteria 799
185 Ga0495670_0000120 3300046691 Bacteria 34491
186 Ga0495671_0031474 3300046692 Bacteria 2712
187 Ga0495672_0001117 3300047320 Bacteria 27196
188 Ga0495683_0002718 3300047323 Bacteria 10548
189 Ga0495687_000310 3300047443 Bacteria 63709
190 Ga0495677_0015647 3300047445 Bacteria 2755
191 Ga0495684_0547560 3300047471 Bacteria 788
192 Ga0495593_0204851 3300047673 Bacteria 991
193 Ga0496106_0004180 3300048909 Bacteria 10759
194 Ga0496112_0000122 3300048915 Bacteria 48608
195 Ga0496112_0124847 3300048915 Unclassified 2545
196 Ga0496113_0055601 3300048916 Bacteria 2967
197 Ga0496115_0000462 3300048918 Bacteria 32479
198 Ga0496123_0103479 3300048926 Bacteria 1649
199 Ga0496125_0023215 3300048928 Bacteria 5732
200 Ga0495682_0075657 3300049460 Unclassified 1211
201 Ga0501040_0003471 3300049576 Bacteria 10167
202 Ga0501040_0047175 3300049576 Bacteria 2942
203 Ga0501042_0078357 3300049578 Bacteria 2367
204 Ga0501043_0288023 3300049579 Bacteria 1258
205 Ga0501048_0453890 3300049582 Bacteria 918
206 Ga0501072_0048754 3300049588 Bacteria 3334
207 Ga0501075_0220671 3300049591 Bacteria 1446
208 Ga0501076_0061860 3300049592 Bacteria 2980
209 Ga0501076_0141490 3300049592 Bacteria 1955
210 Ga0501202_000507 3300049652 Bacteria 5592
211 Ga0501206_018517 3300049653 Unclassified 981
212 Ga0501207_005780 3300049654 Unclassified 1720
213 Ga0501216_006253 3300049660 Unclassified 1821
214 Ga0501217_002038 3300049661 Bacteria 3908
215 Ga0501223_001594 3300049663 Bacteria 5221
216 Ga0501224_001015 3300049664 Bacteria 3639
217 Ga0501230_011328 3300049667 Unclassified 1410
218 Ga0501233_002874 3300049668 Unclassified 3066
219 Ga0501235_001666 3300049669 Bacteria 4762
220 Ga0501239_003369 3300049672 Unclassified 1516
221 Ga0501249_024050 3300049679 Unclassified 1341
222 Ga0501252_012463 3300049682 Unclassified 1030
223 Ga0501225_0006209 3300049705 Bacteria 3490
224 Ga0501229_001775 3300049706 Unclassified 2528
225 Ga0501234_001766 3300049707 Bacteria 3405
226 Ga0501079_0172388 3300049741 Bacteria 1687
227 Ga0501079_0368422 3300049741 Bacteria 1126
228 Ga0501080_0694381 3300049742 Bacteria 898
229 Ga0501081_0233773 3300049743 Bacteria 1339
230 Ga0501081_0287473 3300049743 Bacteria 1205
231 Ga0501212_009677 3300049851 Unclassified 1362
232 Ga0501226_000762 3300049853 Unclassified 4351
233 nmdc:mga03683_21930_c1 3300050489 Bacteria 2469
234 nmdc:mga00v17_64068_c1 3300050491 Unclassified 2265
235 nmdc:mga0k408_141571_c1 3300050493 Unclassified 1431
236 nmdc:mga06z11_26876_c1 3300050494 Bacteria 2745
237 nmdc:mga04h51_18523_c1 3300050495 Unclassified 2052
238 nmdc:mga07m45_29475_c1 3300050496 Bacteria 3035
239 nmdc:mga06r32_438611_c1 3300050510 Bacteria 1286
240 nmdc:mga0n895_19806_c1 3300050512 Bacteria 6260
241 Ga0500555_001478 3300053103 Bacteria 7142
242 Ga0500645_002141 3300053730 Bacteria 9066
243 Ga0501084_0024720 3300054114 Bacteria 5013
244 Ga0501084_0284593 3300054114 Bacteria 1396
245 Ga0530510_0012473 3300061734 Bacteria 5970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025942 Ga0207689_10672432 Ga0207689_106724322 190
2 3300005617 Ga0068859_101035405 Ga0068859_1010354051 192
3 3300006931 Ga0097620_101035417 Ga0097620_1010354171 192
4 3300005467 Ga0070706_100177257 Ga0070706_1001772573 201
5 3300025910 Ga0207684_10011559 Ga0207684_100115595 201
6 3300049576 Ga0501040_0047175 Ga0501040_0047175_1302_1913 202
7 3300049578 Ga0501042_0078357 Ga0501042_0078357_778_1389 202
8 3300049582 Ga0501048_0453890 Ga0501048_0453890_294_905 202
9 3300049588 Ga0501072_0048754 Ga0501072_0048754_2675_3286 202
10 3300049592 Ga0501076_0061860 Ga0501076_0061860_1348_1959 202
11 3300049706 Ga0501229_001775 Ga0501229_001775_1810_2418 202
12 3300049741 Ga0501079_0172388 Ga0501079_0172388_742_1353 202
13 3300049743 Ga0501081_0287473 Ga0501081_0287473_251_862 202
14 3300054114 Ga0501084_0024720 Ga0501084_0024720_151_762 202
15 3300061734 Ga0530510_0012473 Ga0530510_0012473_1824_2435 202
16 3300005340 Ga0070689_100000789 Ga0070689_1000007893 203
17 3300005364 Ga0070673_100421220 Ga0070673_1004212201 203
18 3300005536 Ga0070697_100000140 Ga0070697_10000014027 203
19 3300005842 Ga0068858_100000249 Ga0068858_10000024912 203
20 3300025911 Ga0207654_10353511 Ga0207654_103535112 203
21 3300025935 Ga0207709_10186039 Ga0207709_101860392 203
22 3300025936 Ga0207670_10000653 Ga0207670_100006533 203
23 3300025941 Ga0207711_10389614 Ga0207711_103896141 203
24 3300025960 Ga0207651_10115849 Ga0207651_101158491 203
25 3300026035 Ga0207703_10000034 Ga0207703_1000003412 203
26 3300044673 Ga0453683_0559209 Ga0453683_0559209_13_636 203
27 3300049576 Ga0501040_0003471 Ga0501040_0003471_4730_5386 204
28 3300049579 Ga0501043_0288023 Ga0501043_0288023_454_1110 204
29 3300049591 Ga0501075_0220671 Ga0501075_0220671_267_923 204
30 3300049592 Ga0501076_0141490 Ga0501076_0141490_689_1345 204
31 3300049741 Ga0501079_0368422 Ga0501079_0368422_90_746 204
32 3300049742 Ga0501080_0694381 Ga0501080_0694381_76_732 204
33 3300054114 Ga0501084_0284593 Ga0501084_0284593_500_1156 204
34 3300013308 Ga0157375_10000092 Ga0157375_1000009240 205
35 3300006028 Ga0070717_10000134 Ga0070717_1000013423 207
36 iso_pu_bacteria 2551306166 2552107563 208
37 iso_pu_bacteria 2902582711 2902585185 210
38 3300005466 Ga0070685_10000611 Ga0070685_1000061111 211
39 3300046522 Ga0495643_0000034 Ga0495643_0000034_179197_179853 211
40 3300005293 Ga0065715_10100035 Ga0065715_101000352 212
41 3300005331 Ga0070670_100002333 Ga0070670_1000023333 212
42 3300005406 Ga0070703_10000004 Ga0070703_10000004101 212
43 3300005518 Ga0070699_100944547 Ga0070699_1009445471 212
44 3300005545 Ga0070695_100564831 Ga0070695_1005648311 212
45 3300014325 Ga0163163_10227088 Ga0163163_102270882 212
46 3300025925 Ga0207650_10022197 Ga0207650_100221973 212
47 3300031456 Ga0307513_10277622 Ga0307513_102776222 212
48 3300031616 Ga0307508_10000022 Ga0307508_1000002290 212
49 3300005544 Ga0070686_100000080 Ga0070686_1000000804 213
50 3300006237 Ga0097621_100001093 Ga0097621_1000010932 213
51 3300006358 Ga0068871_100023286 Ga0068871_1000232867 213
52 3300025938 Ga0207704_10871421 Ga0207704_108714211 213
53 3300046684 Ga0495669_0015151 Ga0495669_0015151_317_979 213
54 3300039062 Ga0400483_118306 Ga0400483_118306_3124_3777 214
55 iso_pu_bacteria 8006926726 8006927023 214
56 3300013296 Ga0157374_10386151 Ga0157374_103861514 215
57 3300042133 Ga0450896_015407 Ga0450896_015407_364_1014 215
58 3300002705 JGI25156J39149_1006164 JGI25156J39149_10061642 216
59 3300002737 JGI25162J39368_1000951 JGI25162J39368_100095116 216
60 3300002741 JGI25157J39369_1002677 JGI25157J39369_10026774 216
61 3300002772 JGI25164J39214_1000116 JGI25164J39214_100011642 216
62 3300003214 JGI25165J46597_1000382 JGI25165J46597_100038217 216
63 3300003760 Ga0055527_1003742 Ga0055527_10037421 216
64 3300003761 Ga0055535_1000637 Ga0055535_100063718 216
65 3300003761 Ga0055535_1000853 Ga0055535_10008539 216
66 3300003762 Ga0055542_1001130 Ga0055542_10011302 216
67 3300003763 Ga0055529_1000366 Ga0055529_100036619 216
68 3300025228 Ga0209672_100129 Ga0209672_10012944 216
69 3300025231 Ga0207427_100062 Ga0207427_10006241 216
70 3300025233 Ga0209437_100426 Ga0209437_10042627 216
71 3300025242 Ga0209258_100088 Ga0209258_10008818 216
72 3300025246 Ga0209646_1004332 Ga0209646_10043322 216
73 3300025250 Ga0209026_1002744 Ga0209026_10027442 216
74 3300025254 Ga0209148_1000024 Ga0209148_1000024132 216
75 3300025256 Ga0209759_1001219 Ga0209759_10012196 216
76 3300025261 Ga0209233_1000023 Ga0209233_100002371 216
77 3300025272 Ga0209455_1000025 Ga0209455_1000025132 216
78 3300031728 Ga0316578_10140744 Ga0316578_101407442 216
79 3300035398 Ga0316574_0298683 Ga0316574_0298683_156_815 216
80 3300048926 Ga0496123_0103479 Ga0496123_0103479_393_1043 216
81 3300005331 Ga0070670_100313142 Ga0070670_1003131422 217
82 3300005341 Ga0070691_10381295 Ga0070691_103812951 217
83 3300009148 Ga0105243_10591212 Ga0105243_105912122 217
84 3300031733 Ga0316577_10401198 Ga0316577_104011981 217
85 3300038725 Ga0400484_19089 Ga0400484_19089_1221_1874 217
86 3300038726 Ga0400490_09010 Ga0400490_09010_249_902 217
87 3300038741 Ga0400488_55484 Ga0400488_55484_3182_3835 217
88 3300042436 Ga0439435_0001633 Ga0439435_0001633_2867_3520 217
89 3300001989 JGI24739J22299_10010045 JGI24739J22299_100100453 218
90 3300002067 JGI24735J21928_10006358 JGI24735J21928_100063583 218
91 3300002074 JGI24748J21848_1000002 JGI24748J21848_1000002258 218
92 3300002239 JGI24034J26672_10000004 JGI24034J26672_10000004116 218
93 3300003320 rootH2_10080878 rootH2_100808783 218
94 3300003322 rootL2_10118078 rootL2_101180783 218
95 3300003323 rootH1_10071972 rootH1_100719729 218
96 3300003756 Ga0055533_1001306 Ga0055533_10013064 218
97 3300005334 Ga0068869_101071644 Ga0068869_1010716441 218
98 3300005353 Ga0070669_100095189 Ga0070669_1000951893 218
99 3300005355 Ga0070671_100046913 Ga0070671_1000469132 218
100 3300005434 Ga0070709_10149702 Ga0070709_101497023 218
101 3300005445 Ga0070708_100143899 Ga0070708_1001438992 218
102 3300005456 Ga0070678_100084266 Ga0070678_1000842663 218
103 3300005457 Ga0070662_100005929 Ga0070662_1000059296 218
104 3300005457 Ga0070662_100115001 Ga0070662_1001150012 218
105 3300005458 Ga0070681_10658487 Ga0070681_106584871 218
106 3300005459 Ga0068867_100133603 Ga0068867_1001336032 218
107 3300005467 Ga0070706_100001593 Ga0070706_10000159310 218
108 3300005468 Ga0070707_100002110 Ga0070707_10000211013 218
109 3300005468 Ga0070707_100664353 Ga0070707_1006643531 218
110 3300005471 Ga0070698_100119176 Ga0070698_1001191763 218
111 3300005536 Ga0070697_100002233 Ga0070697_1000022338 218
112 3300005547 Ga0070693_100191099 Ga0070693_1001910991 218
113 3300005547 Ga0070693_100266771 Ga0070693_1002667712 218
114 3300005548 Ga0070665_100000365 Ga0070665_10000036533 218
115 3300005549 Ga0070704_100473489 Ga0070704_1004734892 218
116 3300005564 Ga0070664_100085380 Ga0070664_1000853803 218
117 3300005578 Ga0068854_100072193 Ga0068854_1000721933 218
118 3300005616 Ga0068852_100556239 Ga0068852_1005562392 218
119 3300005617 Ga0068859_100000046 Ga0068859_10000004669 218
120 3300005618 Ga0068864_100001094 Ga0068864_10000109413 218
121 3300005840 Ga0068870_10280365 Ga0068870_102803652 218
122 3300005842 Ga0068858_100001031 Ga0068858_10000103119 218
123 3300005842 Ga0068858_100028754 Ga0068858_1000287546 218
124 3300006042 Ga0075368_10002748 Ga0075368_100027487 218
125 3300006051 Ga0075364_10005531 Ga0075364_100055318 218
126 3300006173 Ga0070716_100221972 Ga0070716_1002219722 218
127 3300006178 Ga0075367_10005069 Ga0075367_100050692 218
128 3300006195 Ga0075366_10046611 Ga0075366_100466113 218
129 3300006353 Ga0075370_10027088 Ga0075370_100270884 218
130 3300006844 Ga0075428_100015781 Ga0075428_1000157818 218
131 3300006847 Ga0075431_100458272 Ga0075431_1004582723 218
132 3300006852 Ga0075433_10522423 Ga0075433_105224232 218
133 3300006871 Ga0075434_100022420 Ga0075434_1000224203 218
134 3300006914 Ga0075436_100099140 Ga0075436_1000991402 218
135 3300006931 Ga0097620_100000046 Ga0097620_10000004669 218
136 3300009098 Ga0105245_10368727 Ga0105245_103687272 218
137 3300009101 Ga0105247_10000005 Ga0105247_10000005110 218
138 3300009101 Ga0105247_10022238 Ga0105247_100222384 218
139 3300009101 Ga0105247_10313991 Ga0105247_103139912 218
140 3300009101 Ga0105247_10327873 Ga0105247_103278732 218
141 3300009148 Ga0105243_10000996 Ga0105243_1000099619 218
142 3300009176 Ga0105242_10011854 Ga0105242_100118544 218
143 3300009177 Ga0105248_10629746 Ga0105248_106297461 218
144 3300009551 Ga0105238_11307410 Ga0105238_113074101 218
145 3300009553 Ga0105249_10156227 Ga0105249_101562273 218
146 3300013104 Ga0157370_10014885 Ga0157370_100148858 218
147 3300013105 Ga0157369_10281485 Ga0157369_102814853 218
148 3300013297 Ga0157378_10000015 Ga0157378_1000001595 218
149 3300013306 Ga0163162_10013307 Ga0163162_100133073 218
150 3300013308 Ga0157375_10006043 Ga0157375_100060434 218
151 3300014326 Ga0157380_10759124 Ga0157380_107591241 218
152 3300014326 Ga0157380_10855908 Ga0157380_108559081 218
153 3300015687 Ga0183368_1004 Ga0183368_1004552 218
154 3300017792 Ga0163161_10072645 Ga0163161_100726452 218
155 3300025223 Ga0207672_1000316 Ga0207672_10003164 218
156 3300025226 Ga0209674_100016 Ga0209674_100016119 218
157 3300025900 Ga0207710_10000004 Ga0207710_10000004109 218
158 3300025900 Ga0207710_10009833 Ga0207710_100098334 218
159 3300025908 Ga0207643_10069041 Ga0207643_100690411 218
160 3300025910 Ga0207684_10001536 Ga0207684_1000153613 218
161 3300025912 Ga0207707_10509402 Ga0207707_105094022 218
162 3300025922 Ga0207646_10003167 Ga0207646_100031677 218
163 3300025931 Ga0207644_10002425 Ga0207644_100024258 218
164 3300025933 Ga0207706_10012101 Ga0207706_100121016 218
165 3300025934 Ga0207686_10010095 Ga0207686_100100953 218
166 3300025935 Ga0207709_10001187 Ga0207709_100011877 218
167 3300025939 Ga0207665_10139999 Ga0207665_101399992 218
168 3300025945 Ga0207679_10161939 Ga0207679_101619392 218
169 3300026035 Ga0207703_10000323 Ga0207703_100003235 218
170 3300026035 Ga0207703_10038289 Ga0207703_100382893 218
171 3300026089 Ga0207648_10164101 Ga0207648_101641013 218
172 3300026095 Ga0207676_10000541 Ga0207676_100005413 218
173 3300026142 Ga0207698_10449219 Ga0207698_104492191 218
174 3300027866 Ga0209813_10004189 Ga0209813_100041892 218
175 3300028379 Ga0268266_10017328 Ga0268266_100173287 218
176 3300031548 Ga0307408_100006007 Ga0307408_1000060072 218
177 3300031548 Ga0307408_100405279 Ga0307408_1004052792 218
178 3300031824 Ga0307413_10009133 Ga0307413_100091333 218
179 3300031852 Ga0307410_10009883 Ga0307410_100098836 218
180 3300031903 Ga0307407_10057142 Ga0307407_100571423 218
181 3300031903 Ga0307407_10410454 Ga0307407_104104542 218
182 3300031911 Ga0307412_10013714 Ga0307412_100137142 218
183 3300031995 Ga0307409_100162070 Ga0307409_1001620702 218
184 3300032002 Ga0307416_100016556 Ga0307416_1000165567 218
185 3300032004 Ga0307414_10006929 Ga0307414_100069297 218
186 3300032005 Ga0307411_10012168 Ga0307411_100121684 218
187 3300032126 Ga0307415_100005575 Ga0307415_1000055752 218
188 3300035410 Ga0373924_0055959 Ga0373924_0055959_932_1588 218
189 3300035692 Ga0373935_0101690 Ga0373935_0101690_952_1608 218
190 3300036401 Ga0373937_0000967 Ga0373937_0000967_12937_13593 218
191 3300038726 Ga0400490_44035 Ga0400490_44035_1194_1850 218
192 3300042138 Ga0450903_005142 Ga0450903_005142_739_1395 218
193 3300044712 Ga0453684_0114551 Ga0453684_0114551_480_1136 218
194 3300046455 Ga0495603_0061807 Ga0495603_0061807_389_1045 218
195 3300046460 Ga0495638_0156886 Ga0495638_0156886_646_1302 218
196 3300046475 Ga0495639_0008205 Ga0495639_0008205_3149_3805 218
197 3300046501 Ga0495607_0001591 Ga0495607_0001591_12477_13136 218
198 3300046519 Ga0495632_0201167 Ga0495632_0201167_169_825 218
199 3300046530 Ga0495654_0111139 Ga0495654_0111139_456_1112 218
200 3300046538 Ga0495609_0000873 Ga0495609_0000873_3220_3876 218
201 3300046542 Ga0495597_0057817 Ga0495597_0057817_962_1618 218
202 3300046615 Ga0495656_0001288 Ga0495656_0001288_6950_7609 218
203 3300046660 Ga0495625_0010658 Ga0495625_0010658_5688_6347 218
204 3300046689 Ga0495613_0520111 Ga0495613_0520111_33_689 218
205 3300046691 Ga0495670_0000120 Ga0495670_0000120_11897_12553 218
206 3300046692 Ga0495671_0031474 Ga0495671_0031474_656_1312 218
207 3300047320 Ga0495672_0001117 Ga0495672_0001117_10060_10719 218
208 3300047323 Ga0495683_0002718 Ga0495683_0002718_120_776 218
209 3300047443 Ga0495687_000310 Ga0495687_000310_49440_50099 218
210 3300047445 Ga0495677_0015647 Ga0495677_0015647_1056_1715 218
211 3300047471 Ga0495684_0547560 Ga0495684_0547560_95_751 218
212 3300047673 Ga0495593_0204851 Ga0495593_0204851_16_672 218
213 3300048909 Ga0496106_0004180 Ga0496106_0004180_2165_2821 218
214 3300048915 Ga0496112_0000122 Ga0496112_0000122_9373_10032 218
215 3300048915 Ga0496112_0124847 Ga0496112_0124847_879_1535 218
216 3300048916 Ga0496113_0055601 Ga0496113_0055601_2160_2816 218
217 3300048918 Ga0496115_0000462 Ga0496115_0000462_26697_27353 218
218 3300048928 Ga0496125_0023215 Ga0496125_0023215_3604_4260 218
219 3300049460 Ga0495682_0075657 Ga0495682_0075657_389_1048 218
220 3300049652 Ga0501202_000507 Ga0501202_000507_3528_4184 218
221 3300049653 Ga0501206_018517 Ga0501206_018517_227_883 218
222 3300049654 Ga0501207_005780 Ga0501207_005780_684_1340 218
223 3300049660 Ga0501216_006253 Ga0501216_006253_1019_1675 218
224 3300049661 Ga0501217_002038 Ga0501217_002038_2830_3486 218
225 3300049663 Ga0501223_001594 Ga0501223_001594_1010_1666 218
226 3300049664 Ga0501224_001015 Ga0501224_001015_857_1513 218
227 3300049667 Ga0501230_011328 Ga0501230_011328_188_844 218
228 3300049668 Ga0501233_002874 Ga0501233_002874_1904_2560 218
229 3300049669 Ga0501235_001666 Ga0501235_001666_341_997 218
230 3300049672 Ga0501239_003369 Ga0501239_003369_55_711 218
231 3300049679 Ga0501249_024050 Ga0501249_024050_133_789 218
232 3300049682 Ga0501252_012463 Ga0501252_012463_164_820 218
233 3300049705 Ga0501225_0006209 Ga0501225_0006209_2346_3002 218
234 3300049707 Ga0501234_001766 Ga0501234_001766_2658_3314 218
235 3300049743 Ga0501081_0233773 Ga0501081_0233773_622_1278 218
236 3300049851 Ga0501212_009677 Ga0501212_009677_515_1171 218
237 3300049853 Ga0501226_000762 Ga0501226_000762_1850_2506 218
238 3300050489 nmdc:mga03683_21930_c1 nmdc:mga03683_21930_c1_1229_1885 218
239 3300050491 nmdc:mga00v17_64068_c1 nmdc:mga00v17_64068_c1_759_1415 218
240 3300050493 nmdc:mga0k408_141571_c1 nmdc:mga0k408_141571_c1_330_986 218
241 3300050494 nmdc:mga06z11_26876_c1 nmdc:mga06z11_26876_c1_1679_2335 218
242 3300050495 nmdc:mga04h51_18523_c1 nmdc:mga04h51_18523_c1_552_1208 218
243 3300050496 nmdc:mga07m45_29475_c1 nmdc:mga07m45_29475_c1_1819_2523 218
244 3300050510 nmdc:mga06r32_438611_c1 nmdc:mga06r32_438611_c1_100_756 218
245 3300050512 nmdc:mga0n895_19806_c1 nmdc:mga0n895_19806_c1_3495_4151 218
246 3300053103 Ga0500555_001478 Ga0500555_001478_37_693 218
247 3300053730 Ga0500645_002141 Ga0500645_002141_6688_7344 218

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xvq-assembly2.cif.gz_B crystal structure of monkey nicotinamide n-methyltransferase (nnmt) bound with end product, 1-methyl nicotinamide (mna) 0.6922 145 175
6j0n-assembly1.cif.gz_b cryo-em structure of an extracellular contractile injection system, baseplate in extended state, refined in c6 symmetry 0.6893 12 175
7aeb-assembly1.cif.gz_N cryo-em structure of an extracellular contractile injection system in marine bacterium algoriphagus machipongonensis, the baseplate complex in extended state applied 6-fold symmetry. 0.6791 9 175
7nbm-assembly2.cif.gz_B co-crystal structure of human nicotinamide n-methyltransferase (nnmt) with the bisubstrate-like inhibitor (33) 0.6711 145 175
6rbk-assembly1.cif.gz_A cryo-em structure of the anti-feeding prophage (afp) baseplate in extended state, 3-fold symmetrised 0.6691 12 195
ID Description Score Start End Superfamily
af_I1JPT8_30_125_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.7356 10 35 2.60.40.1120
5yjfD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6283 145 175 3.40.50.150
af_O44511_12_210_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6258 12 34 1.20.140.150
4f0pD01 Mainly Beta;Roll;PUA domain-like; 0.5787 144 176 2.30.280.20
af_P71805_5_210_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.5752 145 175 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W7XGP1-F1-model_v4 Uncharacterized protein 0.9464 7 217
AF-A0A023XMJ8-F1-model_v4 deleted 0.9365 16 218
AF-A0A150RXT0-F1-model_v4 Uncharacterized protein 0.9348 68 203
AF-A0A7W7XGP1-F1-model_v4 Uncharacterized protein 0.9333 7 217
AF-A0A6N6ZBJ3-F1-model_v4 Uncharacterized protein 0.9304 1 218

Feature Viewer

pLDDT pTM Quality
86.12 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map