F359050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 247 | 151 | 245 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300025901|Ga0207688_10566233|Ga0207688_105662332 |
| Length | 128 |
| Sequence | MPSDCLFCKIVGGEIPATVVREDERTVAFMDINPATRGHLLVIPRAHAANLLEIGGDDLALAALVTDRLGADGVNLMNSCGRDAWQTVFHFHIHVIPRYAGDPLRLPWTPAPGDRDEIAAAAAALTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 33 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 34 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 36 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 37 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 38 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 91 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 92 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 93 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 94 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 95 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 103 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 105 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 110 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 111 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 112 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 113 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 118 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 119 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 120 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 121 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 122 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 123 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 124 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 134 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 135 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 136 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 137 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 138 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 139 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 140 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 141 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 142 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 143 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 144 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 145 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 151 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0 |
| Isolates | 0.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.24 |
| Nodule | 0 |
| Rhizoplane | 7.69 |
| Rhizosphere | 84.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100000151 | 3300005329 | Bacteria | 44735 |
| 2 | Ga0070683_100415226 | 3300005329 | Bacteria | 1283 |
| 3 | Ga0070670_100443048 | 3300005331 | Bacteria | 1150 |
| 4 | Ga0070680_100522608 | 3300005336 | Bacteria | 1016 |
| 5 | Ga0070682_100617835 | 3300005337 | Bacteria | 858 |
| 6 | Ga0070661_101290394 | 3300005344 | Bacteria | 612 |
| 7 | Ga0070674_100681674 | 3300005356 | Bacteria | 877 |
| 8 | Ga0070674_101747465 | 3300005356 | Bacteria | 563 |
| 9 | Ga0070673_101173073 | 3300005364 | Bacteria | 719 |
| 10 | Ga0070688_100088506 | 3300005365 | Bacteria | 2019 |
| 11 | Ga0070659_100101082 | 3300005366 | Bacteria | 2321 |
| 12 | Ga0070714_100014742 | 3300005435 | Bacteria | 6283 |
| 13 | Ga0070714_100016225 | 3300005435 | Bacteria | 6007 |
| 14 | Ga0070714_100177581 | 3300005435 | Bacteria | 1936 |
| 15 | Ga0070713_100813400 | 3300005436 | Bacteria | 896 |
| 16 | Ga0070710_10000008 | 3300005437 | Bacteria | 198148 |
| 17 | Ga0070710_10355497 | 3300005437 | Bacteria | 971 |
| 18 | Ga0070711_101309771 | 3300005439 | Bacteria | 629 |
| 19 | Ga0070700_100822097 | 3300005441 | Bacteria | 750 |
| 20 | Ga0070663_100642292 | 3300005455 | Bacteria | 897 |
| 21 | Ga0070678_101390429 | 3300005456 | Bacteria | 655 |
| 22 | Ga0070662_100103807 | 3300005457 | Bacteria | 2156 |
| 23 | Ga0070684_100000216 | 3300005535 | Bacteria | 40342 |
| 24 | Ga0070684_100360561 | 3300005535 | Bacteria | 1338 |
| 25 | Ga0070672_100791550 | 3300005543 | Bacteria | 834 |
| 26 | Ga0070665_100822816 | 3300005548 | Bacteria | 942 |
| 27 | Ga0070704_100175726 | 3300005549 | Bacteria | 1708 |
| 28 | Ga0070704_101019598 | 3300005549 | Bacteria | 749 |
| 29 | Ga0070664_100070379 | 3300005564 | Bacteria | 2996 |
| 30 | Ga0068857_100014937 | 3300005577 | Bacteria | 6773 |
| 31 | Ga0068856_100075046 | 3300005614 | Bacteria | 3349 |
| 32 | Ga0070702_100921315 | 3300005615 | Bacteria | 686 |
| 33 | Ga0068861_100110098 | 3300005719 | Bacteria | 2206 |
| 34 | Ga0068861_101235562 | 3300005719 | Bacteria | 724 |
| 35 | Ga0068861_101626175 | 3300005719 | Bacteria | 637 |
| 36 | Ga0068870_10292676 | 3300005840 | Bacteria | 1025 |
| 37 | Ga0068862_101789305 | 3300005844 | Bacteria | 623 |
| 38 | Ga0081455_10019606 | 3300005937 | Bacteria | 6390 |
| 39 | Ga0081455_10118837 | 3300005937 | Bacteria | 2086 |
| 40 | Ga0081455_10678124 | 3300005937 | Bacteria | 660 |
| 41 | Ga0081455_10717701 | 3300005937 | Bacteria | 635 |
| 42 | Ga0081538_10003427 | 3300005981 | Bacteria | 14997 |
| 43 | Ga0081538_10005481 | 3300005981 | Bacteria | 11401 |
| 44 | Ga0081538_10039438 | 3300005981 | Bacteria | 3029 |
| 45 | Ga0081538_10063174 | 3300005981 | Bacteria | 2104 |
| 46 | Ga0081540_1001098 | 3300005983 | Bacteria | 23963 |
| 47 | Ga0070717_10001047 | 3300006028 | Bacteria | 18556 |
| 48 | Ga0070717_10038991 | 3300006028 | Bacteria | 3863 |
| 49 | Ga0070717_10058030 | 3300006028 | Bacteria | 3200 |
| 50 | Ga0075365_10650321 | 3300006038 | Bacteria | 745 |
| 51 | Ga0075363_100365685 | 3300006048 | Unclassified | 844 |
| 52 | Ga0075364_10172734 | 3300006051 | Bacteria | 1461 |
| 53 | Ga0075364_10231376 | 3300006051 | Bacteria | 1255 |
| 54 | Ga0070712_100061560 | 3300006175 | Bacteria | 2652 |
| 55 | Ga0070712_100110340 | 3300006175 | Bacteria | 2051 |
| 56 | Ga0075430_100006738 | 3300006846 | Bacteria | 9687 |
| 57 | Ga0075431_100073086 | 3300006847 | Bacteria | 3538 |
| 58 | Ga0075434_100541536 | 3300006871 | Bacteria | 1184 |
| 59 | Ga0105240_12518877 | 3300009093 | Bacteria | 532 |
| 60 | Ga0111539_11320077 | 3300009094 | Bacteria | 837 |
| 61 | Ga0105245_10068231 | 3300009098 | Bacteria | 3222 |
| 62 | Ga0105245_10140115 | 3300009098 | Bacteria | 2277 |
| 63 | Ga0105245_10223846 | 3300009098 | Bacteria | 1817 |
| 64 | Ga0105245_10744942 | 3300009098 | Bacteria | 1015 |
| 65 | Ga0105243_10058588 | 3300009148 | Bacteria | 3069 |
| 66 | Ga0105243_10163678 | 3300009148 | Bacteria | 1920 |
| 67 | Ga0105242_10138067 | 3300009176 | Bacteria | 2112 |
| 68 | Ga0105249_10428571 | 3300009553 | Bacteria | 1358 |
| 69 | Ga0105249_13565641 | 3300009553 | Bacteria | 501 |
| 70 | Ga0105239_12067207 | 3300010375 | Bacteria | 662 |
| 71 | Ga0157369_11582284 | 3300013105 | Bacteria | 666 |
| 72 | Ga0157369_11877430 | 3300013105 | Bacteria | 608 |
| 73 | Ga0157378_13193202 | 3300013297 | Bacteria | 509 |
| 74 | Ga0163162_11372029 | 3300013306 | Bacteria | 804 |
| 75 | Ga0157372_12673389 | 3300013307 | Bacteria | 573 |
| 76 | Ga0157375_12709220 | 3300013308 | Bacteria | 593 |
| 77 | Ga0163163_11193607 | 3300014325 | Bacteria | 823 |
| 78 | Ga0157380_10895294 | 3300014326 | Bacteria | 913 |
| 79 | Ga0157380_12932731 | 3300014326 | Bacteria | 543 |
| 80 | Ga0157376_12007084 | 3300014969 | Bacteria | 616 |
| 81 | Ga0163161_10891446 | 3300017792 | Bacteria | 753 |
| 82 | Ga0213876_10042757 | 3300021384 | Bacteria | 2394 |
| 83 | Ga0213876_10095847 | 3300021384 | Bacteria | 1572 |
| 84 | Ga0213875_10074488 | 3300021388 | Bacteria | 1584 |
| 85 | Ga0213875_10086440 | 3300021388 | Bacteria | 1463 |
| 86 | Ga0207692_10000034 | 3300025898 | Bacteria | 45780 |
| 87 | Ga0207692_10607863 | 3300025898 | Bacteria | 703 |
| 88 | Ga0207688_10566233 | 3300025901 | Bacteria | 715 |
| 89 | Ga0207699_10297406 | 3300025906 | Bacteria | 1126 |
| 90 | Ga0207643_10074362 | 3300025908 | Bacteria | 1960 |
| 91 | Ga0207643_10342067 | 3300025908 | Bacteria | 938 |
| 92 | Ga0207693_10065612 | 3300025915 | Bacteria | 2842 |
| 93 | Ga0207693_10087109 | 3300025915 | Bacteria | 2447 |
| 94 | Ga0207693_10251860 | 3300025915 | Bacteria | 1386 |
| 95 | Ga0207660_10393273 | 3300025917 | Bacteria | 1116 |
| 96 | Ga0207657_10321874 | 3300025919 | Bacteria | 1222 |
| 97 | Ga0207650_10373261 | 3300025925 | Bacteria | 1177 |
| 98 | Ga0207687_10229284 | 3300025927 | Bacteria | 1466 |
| 99 | Ga0207700_10090667 | 3300025928 | Bacteria | 2413 |
| 100 | Ga0207700_11127795 | 3300025928 | Bacteria | 701 |
| 101 | Ga0207664_10000349 | 3300025929 | Bacteria | 33673 |
| 102 | Ga0207690_10528615 | 3300025932 | Bacteria | 957 |
| 103 | Ga0207706_10082086 | 3300025933 | Bacteria | 2833 |
| 104 | Ga0207709_10132515 | 3300025935 | Bacteria | 1700 |
| 105 | Ga0207704_10245403 | 3300025938 | Bacteria | 1341 |
| 106 | Ga0207665_10144718 | 3300025939 | Unclassified | 1698 |
| 107 | Ga0207665_10605956 | 3300025939 | Bacteria | 855 |
| 108 | Ga0207691_10605582 | 3300025940 | Bacteria | 927 |
| 109 | Ga0207661_10009068 | 3300025944 | Bacteria | 7129 |
| 110 | Ga0207661_10338792 | 3300025944 | Bacteria | 1355 |
| 111 | Ga0207679_10035861 | 3300025945 | Bacteria | 3513 |
| 112 | Ga0207640_10496890 | 3300025981 | Bacteria | 1015 |
| 113 | Ga0207677_10332211 | 3300026023 | Bacteria | 1267 |
| 114 | Ga0207678_11309293 | 3300026067 | Bacteria | 641 |
| 115 | Ga0207708_10287256 | 3300026075 | Bacteria | 1334 |
| 116 | Ga0207708_11032170 | 3300026075 | Bacteria | 715 |
| 117 | Ga0207702_10063082 | 3300026078 | Bacteria | 3168 |
| 118 | Ga0207702_12129018 | 3300026078 | Bacteria | 550 |
| 119 | Ga0207676_10556306 | 3300026095 | Bacteria | 1097 |
| 120 | Ga0207674_10005442 | 3300026116 | Bacteria | 15122 |
| 121 | Ga0207675_100255370 | 3300026118 | Bacteria | 1697 |
| 122 | Ga0207675_101360778 | 3300026118 | Bacteria | 730 |
| 123 | Ga0207675_102525535 | 3300026118 | Bacteria | 524 |
| 124 | Ga0207698_11260494 | 3300026142 | Bacteria | 754 |
| 125 | Ga0265338_10052629 | 3300028800 | Bacteria | 3650 |
| 126 | Ga0265338_10134473 | 3300028800 | Bacteria | 1947 |
| 127 | Ga0265327_10010195 | 3300031251 | Bacteria | 6641 |
| 128 | Ga0265327_10216279 | 3300031251 | Bacteria | 863 |
| 129 | Ga0307408_101234687 | 3300031548 | Bacteria | 698 |
| 130 | Ga0307405_10504598 | 3300031731 | Bacteria | 970 |
| 131 | Ga0307413_11408585 | 3300031824 | Bacteria | 613 |
| 132 | Ga0307410_10208161 | 3300031852 | Bacteria | 1497 |
| 133 | Ga0307406_10451842 | 3300031901 | Bacteria | 1031 |
| 134 | Ga0307406_10600861 | 3300031901 | Bacteria | 907 |
| 135 | Ga0307407_10007577 | 3300031903 | Bacteria | 4924 |
| 136 | Ga0307407_10685861 | 3300031903 | Bacteria | 770 |
| 137 | Ga0307412_10112400 | 3300031911 | Bacteria | 1947 |
| 138 | Ga0307409_100016250 | 3300031995 | Bacteria | 4917 |
| 139 | Ga0307416_100239935 | 3300032002 | Bacteria | 1755 |
| 140 | Ga0307416_100531870 | 3300032002 | Bacteria | 1246 |
| 141 | Ga0307414_10188317 | 3300032004 | Bacteria | 1667 |
| 142 | Ga0307411_10071171 | 3300032005 | Bacteria | 2356 |
| 143 | Ga0307411_10296336 | 3300032005 | Bacteria | 1295 |
| 144 | Ga0307415_100067712 | 3300032126 | Bacteria | 2496 |
| 145 | Ga0307415_100120904 | 3300032126 | Bacteria | 1963 |
| 146 | Ga0307415_100448108 | 3300032126 | Bacteria | 1115 |
| 147 | Ga0373934_0169510 | 3300035086 | Bacteria | 896 |
| 148 | Ga0373941_0238740 | 3300035115 | Bacteria | 705 |
| 149 | Ga0395900_0164475 | 3300037418 | Bacteria | 2262 |
| 150 | Ga0395900_0405849 | 3300037418 | Unclassified | 1326 |
| 151 | Ga0395900_0412332 | 3300037418 | Bacteria | 1313 |
| 152 | Ga0395900_0435477 | 3300037418 | Unclassified | 1270 |
| 153 | Ga0395900_0576159 | 3300037418 | Bacteria | 1068 |
| 154 | Ga0395900_0988123 | 3300037418 | Bacteria | 762 |
| 155 | Ga0395898_0039578 | 3300037466 | Bacteria | 4666 |
| 156 | Ga0395898_0393496 | 3300037466 | Bacteria | 1321 |
| 157 | Ga0395898_1045597 | 3300037466 | Bacteria | 751 |
| 158 | Ga0395898_1190961 | 3300037466 | Bacteria | 693 |
| 159 | Ga0395898_1773764 | 3300037466 | Bacteria | 539 |
| 160 | Ga0395905_0530262 | 3300037471 | Bacteria | 1078 |
| 161 | Ga0436364_0185151 | 3300037853 | Bacteria | 2606 |
| 162 | Ga0436364_0426125 | 3300037853 | Bacteria | 1285 |
| 163 | Ga0436364_0438652 | 3300037853 | Bacteria | 11637 |
| 164 | Ga0436364_0516052 | 3300037853 | Unclassified | 700 |
| 165 | Ga0395901_0318097 | 3300038443 | Bacteria | 1611 |
| 166 | Ga0395901_1382239 | 3300038443 | Bacteria | 663 |
| 167 | Ga0436365_0248021 | 3300039437 | Bacteria | 1872 |
| 168 | Ga0436365_1454171 | 3300039437 | Bacteria | 2181 |
| 169 | Ga0436361_0153275 | 3300039447 | Bacteria | 600 |
| 170 | Ga0436362_0319236 | 3300039453 | Bacteria | 2625 |
| 171 | Ga0436362_1168769 | 3300039453 | Bacteria | 763 |
| 172 | Ga0466969_0353044 | 3300044656 | Bacteria | 666 |
| 173 | Ga0466972_0367195 | 3300044658 | Bacteria | 674 |
| 174 | Ga0466965_0049273 | 3300044683 | Bacteria | 2088 |
| 175 | Ga0466965_0060700 | 3300044683 | Bacteria | 1889 |
| 176 | Ga0466965_0876618 | 3300044683 | Bacteria | 522 |
| 177 | Ga0466961_0828791 | 3300044693 | Bacteria | 552 |
| 178 | Ga0466963_0002750 | 3300044694 | Bacteria | 9924 |
| 179 | Ga0466963_0032254 | 3300044694 | Bacteria | 3391 |
| 180 | Ga0466963_0079976 | 3300044694 | Bacteria | 2212 |
| 181 | Ga0466963_0082894 | 3300044694 | Bacteria | 2174 |
| 182 | Ga0466963_0266624 | 3300044694 | Bacteria | 1203 |
| 183 | Ga0466963_0349972 | 3300044694 | Bacteria | 1040 |
| 184 | Ga0466971_0028544 | 3300044719 | Bacteria | 2496 |
| 185 | Ga0466971_0100801 | 3300044719 | Bacteria | 1327 |
| 186 | Ga0466971_0573630 | 3300044719 | Bacteria | 561 |
| 187 | Ga0466968_0084022 | 3300044735 | Bacteria | 1403 |
| 188 | Ga0466970_0105215 | 3300044765 | Bacteria | 1539 |
| 189 | Ga0466970_0888527 | 3300044765 | Bacteria | 524 |
| 190 | Ga0466957_0003271 | 3300044842 | Bacteria | 8876 |
| 191 | Ga0466957_0037550 | 3300044842 | Bacteria | 2917 |
| 192 | Ga0466957_0455888 | 3300044842 | Bacteria | 882 |
| 193 | Ga0466957_0525961 | 3300044842 | Bacteria | 822 |
| 194 | Ga0466959_0891551 | 3300045049 | Bacteria | 593 |
| 195 | Ga0466958_0001708 | 3300045836 | Bacteria | 10594 |
| 196 | Ga0466958_0223333 | 3300045836 | Bacteria | 1202 |
| 197 | Ga0466958_0330502 | 3300045836 | Bacteria | 980 |
| 198 | Ga0466958_0444363 | 3300045836 | Bacteria | 839 |
| 199 | Ga0466967_0000491 | 3300045976 | Bacteria | 19255 |
| 200 | Ga0466967_0037656 | 3300045976 | Bacteria | 4141 |
| 201 | Ga0466967_0042116 | 3300045976 | Bacteria | 3944 |
| 202 | Ga0466967_0071230 | 3300045976 | Bacteria | 3112 |
| 203 | Ga0466967_0099842 | 3300045976 | Bacteria | 2651 |
| 204 | Ga0466967_0117499 | 3300045976 | Bacteria | 2452 |
| 205 | Ga0466967_0286840 | 3300045976 | Bacteria | 1580 |
| 206 | Ga0466967_0422765 | 3300045976 | Bacteria | 1299 |
| 207 | Ga0495605_0094181 | 3300046474 | Bacteria | 1384 |
| 208 | Ga0495664_0494490 | 3300046477 | Bacteria | 731 |
| 209 | Ga0495631_0102429 | 3300046518 | Bacteria | 1232 |
| 210 | Ga0495644_0393139 | 3300046523 | Unclassified | 548 |
| 211 | Ga0495649_0303319 | 3300046694 | Bacteria | 813 |
| 212 | Ga0495589_0357832 | 3300046794 | Bacteria | 672 |
| 213 | Ga0495674_0915634 | 3300047319 | Bacteria | 676 |
| 214 | Ga0496100_0787239 | 3300048903 | Bacteria | 745 |
| 215 | Ga0496101_1432364 | 3300048904 | Bacteria | 539 |
| 216 | Ga0496102_0005546 | 3300048905 | Bacteria | 10717 |
| 217 | Ga0496103_0546951 | 3300048906 | Bacteria | 739 |
| 218 | Ga0496106_0241333 | 3300048909 | Bacteria | 1444 |
| 219 | Ga0496106_0277389 | 3300048909 | Bacteria | 1343 |
| 220 | Ga0496107_0588560 | 3300048910 | Bacteria | 823 |
| 221 | Ga0496109_0930076 | 3300048912 | Bacteria | 807 |
| 222 | Ga0496109_1197508 | 3300048912 | Bacteria | 696 |
| 223 | Ga0496110_0187697 | 3300048913 | Bacteria | 1877 |
| 224 | Ga0496111_0024912 | 3300048914 | Bacteria | 4220 |
| 225 | Ga0496111_0776095 | 3300048914 | Bacteria | 694 |
| 226 | Ga0496112_0071853 | 3300048915 | Bacteria | 3420 |
| 227 | Ga0496113_0375379 | 3300048916 | Bacteria | 1141 |
| 228 | Ga0496113_0449142 | 3300048916 | Bacteria | 1036 |
| 229 | Ga0496113_1240476 | 3300048916 | Bacteria | 581 |
| 230 | Ga0496114_0116930 | 3300048917 | Bacteria | 2290 |
| 231 | Ga0496114_0936802 | 3300048917 | Bacteria | 748 |
| 232 | Ga0496114_1479850 | 3300048917 | Bacteria | 567 |
| 233 | Ga0496124_0154239 | 3300048927 | Bacteria | 1798 |
| 234 | nmdc:mga00v17_208113_c1 | 3300050491 | Bacteria | 1265 |
| 235 | nmdc:mga00v17_214296_c1 | 3300050491 | Bacteria | 1246 |
| 236 | nmdc:mga00v17_466675_c1 | 3300050491 | Bacteria | 819 |
| 237 | nmdc:mga06r32_310458_c1 | 3300050510 | Bacteria | 1563 |
| 238 | nmdc:mga08y16_853708_c1 | 3300050511 | Bacteria | 899 |
| 239 | nmdc:mga0n895_937974_c1 | 3300050512 | Bacteria | 849 |
| 240 | Ga0495601_0477079 | 3300053077 | Bacteria | 806 |
| 241 | Ga0495655_0071652 | 3300053083 | Bacteria | 970 |
| 242 | Ga0495655_0226449 | 3300053083 | Bacteria | 621 |
| 243 | Ga0500554_011065 | 3300053102 | Bacteria | 2222 |
| 244 | Ga0466962_0038359 | 3300061719 | Bacteria | 2294 |
| 245 | Ga0466962_0112603 | 3300061719 | Bacteria | 1311 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028800 | Ga0265338_10134473 | Ga0265338_101344734 | 110 |
| 2 | 3300035086 | Ga0373934_0169510 | Ga0373934_0169510_194_538 | 110 |
| 3 | 3300037418 | Ga0395900_0164475 | Ga0395900_0164475_1805_2188 | 125 |
| 4 | 3300025901 | Ga0207688_10566233 | Ga0207688_105662332 | 127 |
| 5 | iso_pu_bacteria | 2816332119 | 2816426075 | 130 |
| 6 | 3300005435 | Ga0070714_100014742 | Ga0070714_1000147426 | 133 |
| 7 | 3300005435 | Ga0070714_100016225 | Ga0070714_1000162257 | 133 |
| 8 | 3300005439 | Ga0070711_101309771 | Ga0070711_1013097712 | 133 |
| 9 | 3300006028 | Ga0070717_10001047 | Ga0070717_100010472 | 133 |
| 10 | 3300006028 | Ga0070717_10038991 | Ga0070717_100389912 | 133 |
| 11 | 3300006028 | Ga0070717_10058030 | Ga0070717_100580303 | 133 |
| 12 | 3300006175 | Ga0070712_100110340 | Ga0070712_1001103403 | 133 |
| 13 | 3300009098 | Ga0105245_10140115 | Ga0105245_101401152 | 133 |
| 14 | 3300013105 | Ga0157369_11582284 | Ga0157369_115822842 | 133 |
| 15 | 3300021384 | Ga0213876_10042757 | Ga0213876_100427572 | 133 |
| 16 | 3300021384 | Ga0213876_10095847 | Ga0213876_100958472 | 133 |
| 17 | 3300021388 | Ga0213875_10074488 | Ga0213875_100744882 | 133 |
| 18 | 3300021388 | Ga0213875_10086440 | Ga0213875_100864402 | 133 |
| 19 | 3300025906 | Ga0207699_10297406 | Ga0207699_102974062 | 133 |
| 20 | 3300025915 | Ga0207693_10087109 | Ga0207693_100871092 | 133 |
| 21 | 3300025928 | Ga0207700_10090667 | Ga0207700_100906674 | 133 |
| 22 | 3300025929 | Ga0207664_10000349 | Ga0207664_100003496 | 133 |
| 23 | 3300026095 | Ga0207676_10556306 | Ga0207676_105563062 | 133 |
| 24 | 3300037418 | Ga0395900_0405849 | Ga0395900_0405849_840_1253 | 133 |
| 25 | 3300037418 | Ga0395900_0435477 | Ga0395900_0435477_352_768 | 133 |
| 26 | 3300037418 | Ga0395900_0576159 | Ga0395900_0576159_59_466 | 133 |
| 27 | 3300037853 | Ga0436364_0426125 | Ga0436364_0426125_388_795 | 133 |
| 28 | 3300037853 | Ga0436364_0438652 | Ga0436364_0438652_4857_5264 | 133 |
| 29 | 3300037853 | Ga0436364_0516052 | Ga0436364_0516052_188_595 | 133 |
| 30 | 3300039437 | Ga0436365_0248021 | Ga0436365_0248021_524_928 | 133 |
| 31 | 3300039437 | Ga0436365_1454171 | Ga0436365_1454171_1111_1518 | 133 |
| 32 | 3300039447 | Ga0436361_0153275 | Ga0436361_0153275_108_515 | 133 |
| 33 | 3300039453 | Ga0436362_0319236 | Ga0436362_0319236_1412_1819 | 133 |
| 34 | 3300039453 | Ga0436362_1168769 | Ga0436362_1168769_321_728 | 133 |
| 35 | 3300044656 | Ga0466969_0353044 | Ga0466969_0353044_46_453 | 133 |
| 36 | 3300044683 | Ga0466965_0060700 | Ga0466965_0060700_390_797 | 133 |
| 37 | 3300044693 | Ga0466961_0828791 | Ga0466961_0828791_79_486 | 133 |
| 38 | 3300044694 | Ga0466963_0002750 | Ga0466963_0002750_2482_2889 | 133 |
| 39 | 3300044719 | Ga0466971_0028544 | Ga0466971_0028544_262_669 | 133 |
| 40 | 3300044719 | Ga0466971_0100801 | Ga0466971_0100801_763_1170 | 133 |
| 41 | 3300044735 | Ga0466968_0084022 | Ga0466968_0084022_646_1053 | 133 |
| 42 | 3300044765 | Ga0466970_0105215 | Ga0466970_0105215_797_1204 | 133 |
| 43 | 3300044842 | Ga0466957_0003271 | Ga0466957_0003271_8319_8726 | 133 |
| 44 | 3300044842 | Ga0466957_0455888 | Ga0466957_0455888_35_445 | 133 |
| 45 | 3300044842 | Ga0466957_0525961 | Ga0466957_0525961_213_620 | 133 |
| 46 | 3300045049 | Ga0466959_0891551 | Ga0466959_0891551_21_428 | 133 |
| 47 | 3300045836 | Ga0466958_0001708 | Ga0466958_0001708_9792_10199 | 133 |
| 48 | 3300045836 | Ga0466958_0223333 | Ga0466958_0223333_225_632 | 133 |
| 49 | 3300045836 | Ga0466958_0444363 | Ga0466958_0444363_221_628 | 133 |
| 50 | 3300045976 | Ga0466967_0071230 | Ga0466967_0071230_1812_2219 | 133 |
| 51 | 3300046477 | Ga0495664_0494490 | Ga0495664_0494490_185_598 | 133 |
| 52 | 3300046694 | Ga0495649_0303319 | Ga0495649_0303319_68_472 | 133 |
| 53 | 3300047319 | Ga0495674_0915634 | Ga0495674_0915634_106_519 | 133 |
| 54 | 3300048903 | Ga0496100_0787239 | Ga0496100_0787239_245_658 | 133 |
| 55 | 3300053077 | Ga0495601_0477079 | Ga0495601_0477079_64_477 | 133 |
| 56 | 3300053102 | Ga0500554_011065 | Ga0500554_011065_1305_1712 | 133 |
| 57 | 3300061719 | Ga0466962_0038359 | Ga0466962_0038359_1284_1715 | 133 |
| 58 | 3300061719 | Ga0466962_0112603 | Ga0466962_0112603_690_1097 | 133 |
| 59 | iso_pu_bacteria | 2515154155 | 2515851074 | 133 |
| 60 | 3300005329 | Ga0070683_100415226 | Ga0070683_1004152261 | 134 |
| 61 | 3300005356 | Ga0070674_100681674 | Ga0070674_1006816742 | 134 |
| 62 | 3300005364 | Ga0070673_101173073 | Ga0070673_1011730731 | 134 |
| 63 | 3300005366 | Ga0070659_100101082 | Ga0070659_1001010823 | 134 |
| 64 | 3300005437 | Ga0070710_10000008 | Ga0070710_1000000850 | 134 |
| 65 | 3300005455 | Ga0070663_100642292 | Ga0070663_1006422922 | 134 |
| 66 | 3300005456 | Ga0070678_101390429 | Ga0070678_1013904292 | 134 |
| 67 | 3300005457 | Ga0070662_100103807 | Ga0070662_1001038072 | 134 |
| 68 | 3300005535 | Ga0070684_100360561 | Ga0070684_1003605612 | 134 |
| 69 | 3300005543 | Ga0070672_100791550 | Ga0070672_1007915502 | 134 |
| 70 | 3300005548 | Ga0070665_100822816 | Ga0070665_1008228162 | 134 |
| 71 | 3300005615 | Ga0070702_100921315 | Ga0070702_1009213151 | 134 |
| 72 | 3300005719 | Ga0068861_100110098 | Ga0068861_1001100981 | 134 |
| 73 | 3300005719 | Ga0068861_101235562 | Ga0068861_1012355622 | 134 |
| 74 | 3300005937 | Ga0081455_10717701 | Ga0081455_107177011 | 134 |
| 75 | 3300005981 | Ga0081538_10039438 | Ga0081538_100394384 | 134 |
| 76 | 3300006038 | Ga0075365_10650321 | Ga0075365_106503212 | 134 |
| 77 | 3300006048 | Ga0075363_100365685 | Ga0075363_1003656852 | 134 |
| 78 | 3300006051 | Ga0075364_10172734 | Ga0075364_101727342 | 134 |
| 79 | 3300006051 | Ga0075364_10231376 | Ga0075364_102313762 | 134 |
| 80 | 3300009093 | Ga0105240_12518877 | Ga0105240_125188771 | 134 |
| 81 | 3300009094 | Ga0111539_11320077 | Ga0111539_113200772 | 134 |
| 82 | 3300009098 | Ga0105245_10223846 | Ga0105245_102238463 | 134 |
| 83 | 3300009098 | Ga0105245_10744942 | Ga0105245_107449421 | 134 |
| 84 | 3300009148 | Ga0105243_10058588 | Ga0105243_100585885 | 134 |
| 85 | 3300009148 | Ga0105243_10163678 | Ga0105243_101636782 | 134 |
| 86 | 3300009176 | Ga0105242_10138067 | Ga0105242_101380672 | 134 |
| 87 | 3300009553 | Ga0105249_10428571 | Ga0105249_104285712 | 134 |
| 88 | 3300013297 | Ga0157378_13193202 | Ga0157378_131932021 | 134 |
| 89 | 3300013306 | Ga0163162_11372029 | Ga0163162_113720292 | 134 |
| 90 | 3300013308 | Ga0157375_12709220 | Ga0157375_127092201 | 134 |
| 91 | 3300014326 | Ga0157380_10895294 | Ga0157380_108952942 | 134 |
| 92 | 3300014326 | Ga0157380_12932731 | Ga0157380_129327311 | 134 |
| 93 | 3300017792 | Ga0163161_10891446 | Ga0163161_108914461 | 134 |
| 94 | 3300025898 | Ga0207692_10000034 | Ga0207692_1000003452 | 134 |
| 95 | 3300025908 | Ga0207643_10342067 | Ga0207643_103420672 | 134 |
| 96 | 3300025915 | Ga0207693_10251860 | Ga0207693_102518602 | 134 |
| 97 | 3300025919 | Ga0207657_10321874 | Ga0207657_103218742 | 134 |
| 98 | 3300025927 | Ga0207687_10229284 | Ga0207687_102292843 | 134 |
| 99 | 3300025933 | Ga0207706_10082086 | Ga0207706_100820864 | 134 |
| 100 | 3300025935 | Ga0207709_10132515 | Ga0207709_101325153 | 134 |
| 101 | 3300025938 | Ga0207704_10245403 | Ga0207704_102454032 | 134 |
| 102 | 3300025940 | Ga0207691_10605582 | Ga0207691_106055822 | 134 |
| 103 | 3300025944 | Ga0207661_10338792 | Ga0207661_103387922 | 134 |
| 104 | 3300025981 | Ga0207640_10496890 | Ga0207640_104968902 | 134 |
| 105 | 3300026023 | Ga0207677_10332211 | Ga0207677_103322112 | 134 |
| 106 | 3300026067 | Ga0207678_11309293 | Ga0207678_113092932 | 134 |
| 107 | 3300026075 | Ga0207708_10287256 | Ga0207708_102872562 | 134 |
| 108 | 3300026075 | Ga0207708_11032170 | Ga0207708_110321702 | 134 |
| 109 | 3300026078 | Ga0207702_12129018 | Ga0207702_121290181 | 134 |
| 110 | 3300026118 | Ga0207675_100255370 | Ga0207675_1002553701 | 134 |
| 111 | 3300026118 | Ga0207675_101360778 | Ga0207675_1013607781 | 134 |
| 112 | 3300026142 | Ga0207698_11260494 | Ga0207698_112604941 | 134 |
| 113 | 3300031824 | Ga0307413_11408585 | Ga0307413_114085851 | 134 |
| 114 | 3300031852 | Ga0307410_10208161 | Ga0307410_102081612 | 134 |
| 115 | 3300031901 | Ga0307406_10451842 | Ga0307406_104518421 | 134 |
| 116 | 3300031901 | Ga0307406_10600861 | Ga0307406_106008611 | 134 |
| 117 | 3300031903 | Ga0307407_10685861 | Ga0307407_106858612 | 134 |
| 118 | 3300032002 | Ga0307416_100531870 | Ga0307416_1005318702 | 134 |
| 119 | 3300032005 | Ga0307411_10296336 | Ga0307411_102963363 | 134 |
| 120 | 3300032126 | Ga0307415_100067712 | Ga0307415_1000677122 | 134 |
| 121 | 3300032126 | Ga0307415_100448108 | Ga0307415_1004481081 | 134 |
| 122 | 3300035115 | Ga0373941_0238740 | Ga0373941_0238740_220_633 | 134 |
| 123 | 3300037418 | Ga0395900_0412332 | Ga0395900_0412332_816_1232 | 134 |
| 124 | 3300037418 | Ga0395900_0988123 | Ga0395900_0988123_270_683 | 134 |
| 125 | 3300037466 | Ga0395898_1190961 | Ga0395898_1190961_141_575 | 134 |
| 126 | 3300037471 | Ga0395905_0530262 | Ga0395905_0530262_444_860 | 134 |
| 127 | 3300037853 | Ga0436364_0185151 | Ga0436364_0185151_1037_1450 | 134 |
| 128 | 3300038443 | Ga0395901_0318097 | Ga0395901_0318097_313_747 | 134 |
| 129 | 3300044658 | Ga0466972_0367195 | Ga0466972_0367195_240_647 | 134 |
| 130 | 3300044683 | Ga0466965_0049273 | Ga0466965_0049273_142_549 | 134 |
| 131 | 3300044683 | Ga0466965_0876618 | Ga0466965_0876618_50_463 | 134 |
| 132 | 3300044694 | Ga0466963_0032254 | Ga0466963_0032254_1702_2115 | 134 |
| 133 | 3300044694 | Ga0466963_0079976 | Ga0466963_0079976_983_1396 | 134 |
| 134 | 3300044694 | Ga0466963_0082894 | Ga0466963_0082894_150_557 | 134 |
| 135 | 3300044694 | Ga0466963_0266624 | Ga0466963_0266624_465_872 | 134 |
| 136 | 3300044694 | Ga0466963_0349972 | Ga0466963_0349972_226_636 | 134 |
| 137 | 3300044719 | Ga0466971_0573630 | Ga0466971_0573630_79_486 | 134 |
| 138 | 3300044765 | Ga0466970_0888527 | Ga0466970_0888527_50_457 | 134 |
| 139 | 3300044842 | Ga0466957_0037550 | Ga0466957_0037550_2249_2656 | 134 |
| 140 | 3300045836 | Ga0466958_0330502 | Ga0466958_0330502_354_767 | 134 |
| 141 | 3300045976 | Ga0466967_0000491 | Ga0466967_0000491_6963_7376 | 134 |
| 142 | 3300045976 | Ga0466967_0037656 | Ga0466967_0037656_376_783 | 134 |
| 143 | 3300045976 | Ga0466967_0042116 | Ga0466967_0042116_3124_3537 | 134 |
| 144 | 3300045976 | Ga0466967_0099842 | Ga0466967_0099842_2091_2498 | 134 |
| 145 | 3300045976 | Ga0466967_0117499 | Ga0466967_0117499_537_989 | 134 |
| 146 | 3300045976 | Ga0466967_0286840 | Ga0466967_0286840_89_499 | 134 |
| 147 | 3300046518 | Ga0495631_0102429 | Ga0495631_0102429_805_1218 | 134 |
| 148 | 3300046794 | Ga0495589_0357832 | Ga0495589_0357832_211_627 | 134 |
| 149 | 3300048904 | Ga0496101_1432364 | Ga0496101_1432364_86_502 | 134 |
| 150 | 3300048905 | Ga0496102_0005546 | Ga0496102_0005546_4613_5017 | 134 |
| 151 | 3300048906 | Ga0496103_0546951 | Ga0496103_0546951_97_501 | 134 |
| 152 | 3300048909 | Ga0496106_0241333 | Ga0496106_0241333_34_438 | 134 |
| 153 | 3300048910 | Ga0496107_0588560 | Ga0496107_0588560_171_587 | 134 |
| 154 | 3300048912 | Ga0496109_0930076 | Ga0496109_0930076_163_576 | 134 |
| 155 | 3300048913 | Ga0496110_0187697 | Ga0496110_0187697_1171_1584 | 134 |
| 156 | 3300048914 | Ga0496111_0776095 | Ga0496111_0776095_263_676 | 134 |
| 157 | 3300048916 | Ga0496113_0375379 | Ga0496113_0375379_303_710 | 134 |
| 158 | 3300048916 | Ga0496113_0449142 | Ga0496113_0449142_604_1017 | 134 |
| 159 | 3300048917 | Ga0496114_0936802 | Ga0496114_0936802_277_690 | 134 |
| 160 | 3300048917 | Ga0496114_1479850 | Ga0496114_1479850_30_443 | 134 |
| 161 | 3300048927 | Ga0496124_0154239 | Ga0496124_0154239_334_750 | 134 |
| 162 | 3300050491 | nmdc:mga00v17_208113_c1 | nmdc:mga00v17_208113_c1_487_894 | 134 |
| 163 | 3300050491 | nmdc:mga00v17_214296_c1 | nmdc:mga00v17_214296_c1_690_1106 | 134 |
| 164 | 3300050491 | nmdc:mga00v17_466675_c1 | nmdc:mga00v17_466675_c1_272_688 | 134 |
| 165 | 3300050511 | nmdc:mga08y16_853708_c1 | nmdc:mga08y16_853708_c1_394_807 | 134 |
| 166 | 3300053083 | Ga0495655_0226449 | Ga0495655_0226449_189_602 | 134 |
| 167 | 3300005329 | Ga0070683_100000151 | Ga0070683_10000015133 | 135 |
| 168 | 3300005331 | Ga0070670_100443048 | Ga0070670_1004430482 | 135 |
| 169 | 3300005336 | Ga0070680_100522608 | Ga0070680_1005226082 | 135 |
| 170 | 3300005337 | Ga0070682_100617835 | Ga0070682_1006178351 | 135 |
| 171 | 3300005344 | Ga0070661_101290394 | Ga0070661_1012903941 | 135 |
| 172 | 3300005356 | Ga0070674_101747465 | Ga0070674_1017474651 | 135 |
| 173 | 3300005365 | Ga0070688_100088506 | Ga0070688_1000885062 | 135 |
| 174 | 3300005435 | Ga0070714_100177581 | Ga0070714_1001775812 | 135 |
| 175 | 3300005436 | Ga0070713_100813400 | Ga0070713_1008134001 | 135 |
| 176 | 3300005437 | Ga0070710_10355497 | Ga0070710_103554972 | 135 |
| 177 | 3300005441 | Ga0070700_100822097 | Ga0070700_1008220971 | 135 |
| 178 | 3300005535 | Ga0070684_100000216 | Ga0070684_1000002163 | 135 |
| 179 | 3300005549 | Ga0070704_100175726 | Ga0070704_1001757262 | 135 |
| 180 | 3300005549 | Ga0070704_101019598 | Ga0070704_1010195982 | 135 |
| 181 | 3300005564 | Ga0070664_100070379 | Ga0070664_1000703792 | 135 |
| 182 | 3300005577 | Ga0068857_100014937 | Ga0068857_1000149373 | 135 |
| 183 | 3300005614 | Ga0068856_100075046 | Ga0068856_1000750464 | 135 |
| 184 | 3300005719 | Ga0068861_101626175 | Ga0068861_1016261752 | 135 |
| 185 | 3300005840 | Ga0068870_10292676 | Ga0068870_102926761 | 135 |
| 186 | 3300005844 | Ga0068862_101789305 | Ga0068862_1017893052 | 135 |
| 187 | 3300005937 | Ga0081455_10019606 | Ga0081455_100196066 | 135 |
| 188 | 3300005937 | Ga0081455_10118837 | Ga0081455_101188373 | 135 |
| 189 | 3300005937 | Ga0081455_10678124 | Ga0081455_106781241 | 135 |
| 190 | 3300005981 | Ga0081538_10003427 | Ga0081538_1000342712 | 135 |
| 191 | 3300005981 | Ga0081538_10005481 | Ga0081538_100054814 | 135 |
| 192 | 3300005981 | Ga0081538_10063174 | Ga0081538_100631742 | 135 |
| 193 | 3300005983 | Ga0081540_1001098 | Ga0081540_100109832 | 135 |
| 194 | 3300006175 | Ga0070712_100061560 | Ga0070712_1000615602 | 135 |
| 195 | 3300006846 | Ga0075430_100006738 | Ga0075430_1000067382 | 135 |
| 196 | 3300006847 | Ga0075431_100073086 | Ga0075431_1000730864 | 135 |
| 197 | 3300006871 | Ga0075434_100541536 | Ga0075434_1005415362 | 135 |
| 198 | 3300009098 | Ga0105245_10068231 | Ga0105245_100682312 | 135 |
| 199 | 3300009553 | Ga0105249_13565641 | Ga0105249_135656411 | 135 |
| 200 | 3300010375 | Ga0105239_12067207 | Ga0105239_120672072 | 135 |
| 201 | 3300013105 | Ga0157369_11877430 | Ga0157369_118774302 | 135 |
| 202 | 3300013307 | Ga0157372_12673389 | Ga0157372_126733891 | 135 |
| 203 | 3300014325 | Ga0163163_11193607 | Ga0163163_111936072 | 135 |
| 204 | 3300014969 | Ga0157376_12007084 | Ga0157376_120070841 | 135 |
| 205 | 3300025898 | Ga0207692_10607863 | Ga0207692_106078631 | 135 |
| 206 | 3300025908 | Ga0207643_10074362 | Ga0207643_100743622 | 135 |
| 207 | 3300025915 | Ga0207693_10065612 | Ga0207693_100656122 | 135 |
| 208 | 3300025917 | Ga0207660_10393273 | Ga0207660_103932731 | 135 |
| 209 | 3300025925 | Ga0207650_10373261 | Ga0207650_103732612 | 135 |
| 210 | 3300025928 | Ga0207700_11127795 | Ga0207700_111277951 | 135 |
| 211 | 3300025932 | Ga0207690_10528615 | Ga0207690_105286152 | 135 |
| 212 | 3300025939 | Ga0207665_10144718 | Ga0207665_101447182 | 135 |
| 213 | 3300025939 | Ga0207665_10605956 | Ga0207665_106059562 | 135 |
| 214 | 3300025944 | Ga0207661_10009068 | Ga0207661_100090685 | 135 |
| 215 | 3300025945 | Ga0207679_10035861 | Ga0207679_100358613 | 135 |
| 216 | 3300026078 | Ga0207702_10063082 | Ga0207702_100630822 | 135 |
| 217 | 3300026116 | Ga0207674_10005442 | Ga0207674_100054427 | 135 |
| 218 | 3300026118 | Ga0207675_102525535 | Ga0207675_1025255351 | 135 |
| 219 | 3300028800 | Ga0265338_10052629 | Ga0265338_100526291 | 135 |
| 220 | 3300031251 | Ga0265327_10010195 | Ga0265327_100101956 | 135 |
| 221 | 3300031251 | Ga0265327_10216279 | Ga0265327_102162791 | 135 |
| 222 | 3300031548 | Ga0307408_101234687 | Ga0307408_1012346872 | 135 |
| 223 | 3300031731 | Ga0307405_10504598 | Ga0307405_105045982 | 135 |
| 224 | 3300031903 | Ga0307407_10007577 | Ga0307407_100075774 | 135 |
| 225 | 3300031911 | Ga0307412_10112400 | Ga0307412_101124002 | 135 |
| 226 | 3300031995 | Ga0307409_100016250 | Ga0307409_1000162503 | 135 |
| 227 | 3300032002 | Ga0307416_100239935 | Ga0307416_1002399351 | 135 |
| 228 | 3300032004 | Ga0307414_10188317 | Ga0307414_101883173 | 135 |
| 229 | 3300032005 | Ga0307411_10071171 | Ga0307411_100711713 | 135 |
| 230 | 3300032126 | Ga0307415_100120904 | Ga0307415_1001209043 | 135 |
| 231 | 3300037466 | Ga0395898_0039578 | Ga0395898_0039578_2539_2961 | 135 |
| 232 | 3300037466 | Ga0395898_0393496 | Ga0395898_0393496_90_512 | 135 |
| 233 | 3300037466 | Ga0395898_1045597 | Ga0395898_1045597_139_561 | 135 |
| 234 | 3300037466 | Ga0395898_1773764 | Ga0395898_1773764_54_491 | 135 |
| 235 | 3300038443 | Ga0395901_1382239 | Ga0395901_1382239_197_619 | 135 |
| 236 | 3300045976 | Ga0466967_0422765 | Ga0466967_0422765_622_1044 | 135 |
| 237 | 3300046474 | Ga0495605_0094181 | Ga0495605_0094181_915_1337 | 135 |
| 238 | 3300046523 | Ga0495644_0393139 | Ga0495644_0393139_71_493 | 135 |
| 239 | 3300048909 | Ga0496106_0277389 | Ga0496106_0277389_68_478 | 135 |
| 240 | 3300048912 | Ga0496109_1197508 | Ga0496109_1197508_94_501 | 135 |
| 241 | 3300048914 | Ga0496111_0024912 | Ga0496111_0024912_1828_2247 | 135 |
| 242 | 3300048915 | Ga0496112_0071853 | Ga0496112_0071853_551_976 | 135 |
| 243 | 3300048916 | Ga0496113_1240476 | Ga0496113_1240476_44_451 | 135 |
| 244 | 3300048917 | Ga0496114_0116930 | Ga0496114_0116930_1780_2190 | 135 |
| 245 | 3300050510 | nmdc:mga06r32_310458_c1 | nmdc:mga06r32_310458_c1_1042_1461 | 135 |
| 246 | 3300050512 | nmdc:mga0n895_937974_c1 | nmdc:mga0n895_937974_c1_195_611 | 135 |
| 247 | 3300053083 | Ga0495655_0071652 | Ga0495655_0071652_521_937 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o0m-assembly1.cif.gz_A | crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis | 0.9453 | 2 | 133 |
| 3lb5-assembly2.cif.gz_D | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9358 | 1 | 133 |
| 3lb5-assembly2.cif.gz_C | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9348 | 1 | 133 |
| 3imi-assembly2.cif.gz_C | 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' | 0.9334 | 3 | 116 |
| 3lb5-assembly1.cif.gz_A | crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand | 0.9223 | 1 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A140LH01_2_105_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9564 | 17 | 106 | 3.30.428.10 |
| 1y23D01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9517 | 3 | 109 | 3.30.428.10 |
| 3o0mB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9499 | 3 | 133 | 3.30.428.10 |
| af_F4K1R2_26_184_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9281 | 2 | 133 | 3.30.428.10 |
| 3ksvA01 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9242 | 2 | 108 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350TWM6-F1-model_v4 | deleted | 0.9836 | 2 | 103 |
|
| AF-A0A2E5KGQ5-F1-model_v4 | HIT family hydrolase | 0.9813 | 3 | 109 |
GO:0009117
GO:0016787 |
| AF-A0A838MGY5-F1-model_v4 | HIT family protein | 0.9808 | 4 | 109 |
GO:0003824
GO:0009117 |
| AF-A0A3N5E9W3-F1-model_v4 | HIT family protein | 0.9772 | 2 | 105 |
GO:0003824
GO:0009117 |
| AF-A0A846Q632-F1-model_v4 | HIT domain-containing protein | 0.9745 | 2 | 106 |
GO:0003824
GO:0009117 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar