F359050

General Info

Members Datasets Scaffolds Average Seq Length
247 151 245 137

Family's Representative Sequence

Representative Sequence 3300025901|Ga0207688_10566233|Ga0207688_105662332
Length 128
Sequence MPSDCLFCKIVGGEIPATVVREDERTVAFMDINPATRGHLLVIPRAHAANLLEIGGDDLALAALVTDRLGADGVNLMNSCGRDAWQTVFHFHIHVIPRYAGDPLRLPWTPAPGDRDEIAAAAAALTRS

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
150 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 7.69
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 4.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000151 3300005329 Bacteria 44735
2 Ga0070683_100415226 3300005329 Bacteria 1283
3 Ga0070670_100443048 3300005331 Bacteria 1150
4 Ga0070680_100522608 3300005336 Bacteria 1016
5 Ga0070682_100617835 3300005337 Bacteria 858
6 Ga0070661_101290394 3300005344 Bacteria 612
7 Ga0070674_100681674 3300005356 Bacteria 877
8 Ga0070674_101747465 3300005356 Bacteria 563
9 Ga0070673_101173073 3300005364 Bacteria 719
10 Ga0070688_100088506 3300005365 Bacteria 2019
11 Ga0070659_100101082 3300005366 Bacteria 2321
12 Ga0070714_100014742 3300005435 Bacteria 6283
13 Ga0070714_100016225 3300005435 Bacteria 6007
14 Ga0070714_100177581 3300005435 Bacteria 1936
15 Ga0070713_100813400 3300005436 Bacteria 896
16 Ga0070710_10000008 3300005437 Bacteria 198148
17 Ga0070710_10355497 3300005437 Bacteria 971
18 Ga0070711_101309771 3300005439 Bacteria 629
19 Ga0070700_100822097 3300005441 Bacteria 750
20 Ga0070663_100642292 3300005455 Bacteria 897
21 Ga0070678_101390429 3300005456 Bacteria 655
22 Ga0070662_100103807 3300005457 Bacteria 2156
23 Ga0070684_100000216 3300005535 Bacteria 40342
24 Ga0070684_100360561 3300005535 Bacteria 1338
25 Ga0070672_100791550 3300005543 Bacteria 834
26 Ga0070665_100822816 3300005548 Bacteria 942
27 Ga0070704_100175726 3300005549 Bacteria 1708
28 Ga0070704_101019598 3300005549 Bacteria 749
29 Ga0070664_100070379 3300005564 Bacteria 2996
30 Ga0068857_100014937 3300005577 Bacteria 6773
31 Ga0068856_100075046 3300005614 Bacteria 3349
32 Ga0070702_100921315 3300005615 Bacteria 686
33 Ga0068861_100110098 3300005719 Bacteria 2206
34 Ga0068861_101235562 3300005719 Bacteria 724
35 Ga0068861_101626175 3300005719 Bacteria 637
36 Ga0068870_10292676 3300005840 Bacteria 1025
37 Ga0068862_101789305 3300005844 Bacteria 623
38 Ga0081455_10019606 3300005937 Bacteria 6390
39 Ga0081455_10118837 3300005937 Bacteria 2086
40 Ga0081455_10678124 3300005937 Bacteria 660
41 Ga0081455_10717701 3300005937 Bacteria 635
42 Ga0081538_10003427 3300005981 Bacteria 14997
43 Ga0081538_10005481 3300005981 Bacteria 11401
44 Ga0081538_10039438 3300005981 Bacteria 3029
45 Ga0081538_10063174 3300005981 Bacteria 2104
46 Ga0081540_1001098 3300005983 Bacteria 23963
47 Ga0070717_10001047 3300006028 Bacteria 18556
48 Ga0070717_10038991 3300006028 Bacteria 3863
49 Ga0070717_10058030 3300006028 Bacteria 3200
50 Ga0075365_10650321 3300006038 Bacteria 745
51 Ga0075363_100365685 3300006048 Unclassified 844
52 Ga0075364_10172734 3300006051 Bacteria 1461
53 Ga0075364_10231376 3300006051 Bacteria 1255
54 Ga0070712_100061560 3300006175 Bacteria 2652
55 Ga0070712_100110340 3300006175 Bacteria 2051
56 Ga0075430_100006738 3300006846 Bacteria 9687
57 Ga0075431_100073086 3300006847 Bacteria 3538
58 Ga0075434_100541536 3300006871 Bacteria 1184
59 Ga0105240_12518877 3300009093 Bacteria 532
60 Ga0111539_11320077 3300009094 Bacteria 837
61 Ga0105245_10068231 3300009098 Bacteria 3222
62 Ga0105245_10140115 3300009098 Bacteria 2277
63 Ga0105245_10223846 3300009098 Bacteria 1817
64 Ga0105245_10744942 3300009098 Bacteria 1015
65 Ga0105243_10058588 3300009148 Bacteria 3069
66 Ga0105243_10163678 3300009148 Bacteria 1920
67 Ga0105242_10138067 3300009176 Bacteria 2112
68 Ga0105249_10428571 3300009553 Bacteria 1358
69 Ga0105249_13565641 3300009553 Bacteria 501
70 Ga0105239_12067207 3300010375 Bacteria 662
71 Ga0157369_11582284 3300013105 Bacteria 666
72 Ga0157369_11877430 3300013105 Bacteria 608
73 Ga0157378_13193202 3300013297 Bacteria 509
74 Ga0163162_11372029 3300013306 Bacteria 804
75 Ga0157372_12673389 3300013307 Bacteria 573
76 Ga0157375_12709220 3300013308 Bacteria 593
77 Ga0163163_11193607 3300014325 Bacteria 823
78 Ga0157380_10895294 3300014326 Bacteria 913
79 Ga0157380_12932731 3300014326 Bacteria 543
80 Ga0157376_12007084 3300014969 Bacteria 616
81 Ga0163161_10891446 3300017792 Bacteria 753
82 Ga0213876_10042757 3300021384 Bacteria 2394
83 Ga0213876_10095847 3300021384 Bacteria 1572
84 Ga0213875_10074488 3300021388 Bacteria 1584
85 Ga0213875_10086440 3300021388 Bacteria 1463
86 Ga0207692_10000034 3300025898 Bacteria 45780
87 Ga0207692_10607863 3300025898 Bacteria 703
88 Ga0207688_10566233 3300025901 Bacteria 715
89 Ga0207699_10297406 3300025906 Bacteria 1126
90 Ga0207643_10074362 3300025908 Bacteria 1960
91 Ga0207643_10342067 3300025908 Bacteria 938
92 Ga0207693_10065612 3300025915 Bacteria 2842
93 Ga0207693_10087109 3300025915 Bacteria 2447
94 Ga0207693_10251860 3300025915 Bacteria 1386
95 Ga0207660_10393273 3300025917 Bacteria 1116
96 Ga0207657_10321874 3300025919 Bacteria 1222
97 Ga0207650_10373261 3300025925 Bacteria 1177
98 Ga0207687_10229284 3300025927 Bacteria 1466
99 Ga0207700_10090667 3300025928 Bacteria 2413
100 Ga0207700_11127795 3300025928 Bacteria 701
101 Ga0207664_10000349 3300025929 Bacteria 33673
102 Ga0207690_10528615 3300025932 Bacteria 957
103 Ga0207706_10082086 3300025933 Bacteria 2833
104 Ga0207709_10132515 3300025935 Bacteria 1700
105 Ga0207704_10245403 3300025938 Bacteria 1341
106 Ga0207665_10144718 3300025939 Unclassified 1698
107 Ga0207665_10605956 3300025939 Bacteria 855
108 Ga0207691_10605582 3300025940 Bacteria 927
109 Ga0207661_10009068 3300025944 Bacteria 7129
110 Ga0207661_10338792 3300025944 Bacteria 1355
111 Ga0207679_10035861 3300025945 Bacteria 3513
112 Ga0207640_10496890 3300025981 Bacteria 1015
113 Ga0207677_10332211 3300026023 Bacteria 1267
114 Ga0207678_11309293 3300026067 Bacteria 641
115 Ga0207708_10287256 3300026075 Bacteria 1334
116 Ga0207708_11032170 3300026075 Bacteria 715
117 Ga0207702_10063082 3300026078 Bacteria 3168
118 Ga0207702_12129018 3300026078 Bacteria 550
119 Ga0207676_10556306 3300026095 Bacteria 1097
120 Ga0207674_10005442 3300026116 Bacteria 15122
121 Ga0207675_100255370 3300026118 Bacteria 1697
122 Ga0207675_101360778 3300026118 Bacteria 730
123 Ga0207675_102525535 3300026118 Bacteria 524
124 Ga0207698_11260494 3300026142 Bacteria 754
125 Ga0265338_10052629 3300028800 Bacteria 3650
126 Ga0265338_10134473 3300028800 Bacteria 1947
127 Ga0265327_10010195 3300031251 Bacteria 6641
128 Ga0265327_10216279 3300031251 Bacteria 863
129 Ga0307408_101234687 3300031548 Bacteria 698
130 Ga0307405_10504598 3300031731 Bacteria 970
131 Ga0307413_11408585 3300031824 Bacteria 613
132 Ga0307410_10208161 3300031852 Bacteria 1497
133 Ga0307406_10451842 3300031901 Bacteria 1031
134 Ga0307406_10600861 3300031901 Bacteria 907
135 Ga0307407_10007577 3300031903 Bacteria 4924
136 Ga0307407_10685861 3300031903 Bacteria 770
137 Ga0307412_10112400 3300031911 Bacteria 1947
138 Ga0307409_100016250 3300031995 Bacteria 4917
139 Ga0307416_100239935 3300032002 Bacteria 1755
140 Ga0307416_100531870 3300032002 Bacteria 1246
141 Ga0307414_10188317 3300032004 Bacteria 1667
142 Ga0307411_10071171 3300032005 Bacteria 2356
143 Ga0307411_10296336 3300032005 Bacteria 1295
144 Ga0307415_100067712 3300032126 Bacteria 2496
145 Ga0307415_100120904 3300032126 Bacteria 1963
146 Ga0307415_100448108 3300032126 Bacteria 1115
147 Ga0373934_0169510 3300035086 Bacteria 896
148 Ga0373941_0238740 3300035115 Bacteria 705
149 Ga0395900_0164475 3300037418 Bacteria 2262
150 Ga0395900_0405849 3300037418 Unclassified 1326
151 Ga0395900_0412332 3300037418 Bacteria 1313
152 Ga0395900_0435477 3300037418 Unclassified 1270
153 Ga0395900_0576159 3300037418 Bacteria 1068
154 Ga0395900_0988123 3300037418 Bacteria 762
155 Ga0395898_0039578 3300037466 Bacteria 4666
156 Ga0395898_0393496 3300037466 Bacteria 1321
157 Ga0395898_1045597 3300037466 Bacteria 751
158 Ga0395898_1190961 3300037466 Bacteria 693
159 Ga0395898_1773764 3300037466 Bacteria 539
160 Ga0395905_0530262 3300037471 Bacteria 1078
161 Ga0436364_0185151 3300037853 Bacteria 2606
162 Ga0436364_0426125 3300037853 Bacteria 1285
163 Ga0436364_0438652 3300037853 Bacteria 11637
164 Ga0436364_0516052 3300037853 Unclassified 700
165 Ga0395901_0318097 3300038443 Bacteria 1611
166 Ga0395901_1382239 3300038443 Bacteria 663
167 Ga0436365_0248021 3300039437 Bacteria 1872
168 Ga0436365_1454171 3300039437 Bacteria 2181
169 Ga0436361_0153275 3300039447 Bacteria 600
170 Ga0436362_0319236 3300039453 Bacteria 2625
171 Ga0436362_1168769 3300039453 Bacteria 763
172 Ga0466969_0353044 3300044656 Bacteria 666
173 Ga0466972_0367195 3300044658 Bacteria 674
174 Ga0466965_0049273 3300044683 Bacteria 2088
175 Ga0466965_0060700 3300044683 Bacteria 1889
176 Ga0466965_0876618 3300044683 Bacteria 522
177 Ga0466961_0828791 3300044693 Bacteria 552
178 Ga0466963_0002750 3300044694 Bacteria 9924
179 Ga0466963_0032254 3300044694 Bacteria 3391
180 Ga0466963_0079976 3300044694 Bacteria 2212
181 Ga0466963_0082894 3300044694 Bacteria 2174
182 Ga0466963_0266624 3300044694 Bacteria 1203
183 Ga0466963_0349972 3300044694 Bacteria 1040
184 Ga0466971_0028544 3300044719 Bacteria 2496
185 Ga0466971_0100801 3300044719 Bacteria 1327
186 Ga0466971_0573630 3300044719 Bacteria 561
187 Ga0466968_0084022 3300044735 Bacteria 1403
188 Ga0466970_0105215 3300044765 Bacteria 1539
189 Ga0466970_0888527 3300044765 Bacteria 524
190 Ga0466957_0003271 3300044842 Bacteria 8876
191 Ga0466957_0037550 3300044842 Bacteria 2917
192 Ga0466957_0455888 3300044842 Bacteria 882
193 Ga0466957_0525961 3300044842 Bacteria 822
194 Ga0466959_0891551 3300045049 Bacteria 593
195 Ga0466958_0001708 3300045836 Bacteria 10594
196 Ga0466958_0223333 3300045836 Bacteria 1202
197 Ga0466958_0330502 3300045836 Bacteria 980
198 Ga0466958_0444363 3300045836 Bacteria 839
199 Ga0466967_0000491 3300045976 Bacteria 19255
200 Ga0466967_0037656 3300045976 Bacteria 4141
201 Ga0466967_0042116 3300045976 Bacteria 3944
202 Ga0466967_0071230 3300045976 Bacteria 3112
203 Ga0466967_0099842 3300045976 Bacteria 2651
204 Ga0466967_0117499 3300045976 Bacteria 2452
205 Ga0466967_0286840 3300045976 Bacteria 1580
206 Ga0466967_0422765 3300045976 Bacteria 1299
207 Ga0495605_0094181 3300046474 Bacteria 1384
208 Ga0495664_0494490 3300046477 Bacteria 731
209 Ga0495631_0102429 3300046518 Bacteria 1232
210 Ga0495644_0393139 3300046523 Unclassified 548
211 Ga0495649_0303319 3300046694 Bacteria 813
212 Ga0495589_0357832 3300046794 Bacteria 672
213 Ga0495674_0915634 3300047319 Bacteria 676
214 Ga0496100_0787239 3300048903 Bacteria 745
215 Ga0496101_1432364 3300048904 Bacteria 539
216 Ga0496102_0005546 3300048905 Bacteria 10717
217 Ga0496103_0546951 3300048906 Bacteria 739
218 Ga0496106_0241333 3300048909 Bacteria 1444
219 Ga0496106_0277389 3300048909 Bacteria 1343
220 Ga0496107_0588560 3300048910 Bacteria 823
221 Ga0496109_0930076 3300048912 Bacteria 807
222 Ga0496109_1197508 3300048912 Bacteria 696
223 Ga0496110_0187697 3300048913 Bacteria 1877
224 Ga0496111_0024912 3300048914 Bacteria 4220
225 Ga0496111_0776095 3300048914 Bacteria 694
226 Ga0496112_0071853 3300048915 Bacteria 3420
227 Ga0496113_0375379 3300048916 Bacteria 1141
228 Ga0496113_0449142 3300048916 Bacteria 1036
229 Ga0496113_1240476 3300048916 Bacteria 581
230 Ga0496114_0116930 3300048917 Bacteria 2290
231 Ga0496114_0936802 3300048917 Bacteria 748
232 Ga0496114_1479850 3300048917 Bacteria 567
233 Ga0496124_0154239 3300048927 Bacteria 1798
234 nmdc:mga00v17_208113_c1 3300050491 Bacteria 1265
235 nmdc:mga00v17_214296_c1 3300050491 Bacteria 1246
236 nmdc:mga00v17_466675_c1 3300050491 Bacteria 819
237 nmdc:mga06r32_310458_c1 3300050510 Bacteria 1563
238 nmdc:mga08y16_853708_c1 3300050511 Bacteria 899
239 nmdc:mga0n895_937974_c1 3300050512 Bacteria 849
240 Ga0495601_0477079 3300053077 Bacteria 806
241 Ga0495655_0071652 3300053083 Bacteria 970
242 Ga0495655_0226449 3300053083 Bacteria 621
243 Ga0500554_011065 3300053102 Bacteria 2222
244 Ga0466962_0038359 3300061719 Bacteria 2294
245 Ga0466962_0112603 3300061719 Bacteria 1311

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028800 Ga0265338_10134473 Ga0265338_101344734 110
2 3300035086 Ga0373934_0169510 Ga0373934_0169510_194_538 110
3 3300037418 Ga0395900_0164475 Ga0395900_0164475_1805_2188 125
4 3300025901 Ga0207688_10566233 Ga0207688_105662332 127
5 iso_pu_bacteria 2816332119 2816426075 130
6 3300005435 Ga0070714_100014742 Ga0070714_1000147426 133
7 3300005435 Ga0070714_100016225 Ga0070714_1000162257 133
8 3300005439 Ga0070711_101309771 Ga0070711_1013097712 133
9 3300006028 Ga0070717_10001047 Ga0070717_100010472 133
10 3300006028 Ga0070717_10038991 Ga0070717_100389912 133
11 3300006028 Ga0070717_10058030 Ga0070717_100580303 133
12 3300006175 Ga0070712_100110340 Ga0070712_1001103403 133
13 3300009098 Ga0105245_10140115 Ga0105245_101401152 133
14 3300013105 Ga0157369_11582284 Ga0157369_115822842 133
15 3300021384 Ga0213876_10042757 Ga0213876_100427572 133
16 3300021384 Ga0213876_10095847 Ga0213876_100958472 133
17 3300021388 Ga0213875_10074488 Ga0213875_100744882 133
18 3300021388 Ga0213875_10086440 Ga0213875_100864402 133
19 3300025906 Ga0207699_10297406 Ga0207699_102974062 133
20 3300025915 Ga0207693_10087109 Ga0207693_100871092 133
21 3300025928 Ga0207700_10090667 Ga0207700_100906674 133
22 3300025929 Ga0207664_10000349 Ga0207664_100003496 133
23 3300026095 Ga0207676_10556306 Ga0207676_105563062 133
24 3300037418 Ga0395900_0405849 Ga0395900_0405849_840_1253 133
25 3300037418 Ga0395900_0435477 Ga0395900_0435477_352_768 133
26 3300037418 Ga0395900_0576159 Ga0395900_0576159_59_466 133
27 3300037853 Ga0436364_0426125 Ga0436364_0426125_388_795 133
28 3300037853 Ga0436364_0438652 Ga0436364_0438652_4857_5264 133
29 3300037853 Ga0436364_0516052 Ga0436364_0516052_188_595 133
30 3300039437 Ga0436365_0248021 Ga0436365_0248021_524_928 133
31 3300039437 Ga0436365_1454171 Ga0436365_1454171_1111_1518 133
32 3300039447 Ga0436361_0153275 Ga0436361_0153275_108_515 133
33 3300039453 Ga0436362_0319236 Ga0436362_0319236_1412_1819 133
34 3300039453 Ga0436362_1168769 Ga0436362_1168769_321_728 133
35 3300044656 Ga0466969_0353044 Ga0466969_0353044_46_453 133
36 3300044683 Ga0466965_0060700 Ga0466965_0060700_390_797 133
37 3300044693 Ga0466961_0828791 Ga0466961_0828791_79_486 133
38 3300044694 Ga0466963_0002750 Ga0466963_0002750_2482_2889 133
39 3300044719 Ga0466971_0028544 Ga0466971_0028544_262_669 133
40 3300044719 Ga0466971_0100801 Ga0466971_0100801_763_1170 133
41 3300044735 Ga0466968_0084022 Ga0466968_0084022_646_1053 133
42 3300044765 Ga0466970_0105215 Ga0466970_0105215_797_1204 133
43 3300044842 Ga0466957_0003271 Ga0466957_0003271_8319_8726 133
44 3300044842 Ga0466957_0455888 Ga0466957_0455888_35_445 133
45 3300044842 Ga0466957_0525961 Ga0466957_0525961_213_620 133
46 3300045049 Ga0466959_0891551 Ga0466959_0891551_21_428 133
47 3300045836 Ga0466958_0001708 Ga0466958_0001708_9792_10199 133
48 3300045836 Ga0466958_0223333 Ga0466958_0223333_225_632 133
49 3300045836 Ga0466958_0444363 Ga0466958_0444363_221_628 133
50 3300045976 Ga0466967_0071230 Ga0466967_0071230_1812_2219 133
51 3300046477 Ga0495664_0494490 Ga0495664_0494490_185_598 133
52 3300046694 Ga0495649_0303319 Ga0495649_0303319_68_472 133
53 3300047319 Ga0495674_0915634 Ga0495674_0915634_106_519 133
54 3300048903 Ga0496100_0787239 Ga0496100_0787239_245_658 133
55 3300053077 Ga0495601_0477079 Ga0495601_0477079_64_477 133
56 3300053102 Ga0500554_011065 Ga0500554_011065_1305_1712 133
57 3300061719 Ga0466962_0038359 Ga0466962_0038359_1284_1715 133
58 3300061719 Ga0466962_0112603 Ga0466962_0112603_690_1097 133
59 iso_pu_bacteria 2515154155 2515851074 133
60 3300005329 Ga0070683_100415226 Ga0070683_1004152261 134
61 3300005356 Ga0070674_100681674 Ga0070674_1006816742 134
62 3300005364 Ga0070673_101173073 Ga0070673_1011730731 134
63 3300005366 Ga0070659_100101082 Ga0070659_1001010823 134
64 3300005437 Ga0070710_10000008 Ga0070710_1000000850 134
65 3300005455 Ga0070663_100642292 Ga0070663_1006422922 134
66 3300005456 Ga0070678_101390429 Ga0070678_1013904292 134
67 3300005457 Ga0070662_100103807 Ga0070662_1001038072 134
68 3300005535 Ga0070684_100360561 Ga0070684_1003605612 134
69 3300005543 Ga0070672_100791550 Ga0070672_1007915502 134
70 3300005548 Ga0070665_100822816 Ga0070665_1008228162 134
71 3300005615 Ga0070702_100921315 Ga0070702_1009213151 134
72 3300005719 Ga0068861_100110098 Ga0068861_1001100981 134
73 3300005719 Ga0068861_101235562 Ga0068861_1012355622 134
74 3300005937 Ga0081455_10717701 Ga0081455_107177011 134
75 3300005981 Ga0081538_10039438 Ga0081538_100394384 134
76 3300006038 Ga0075365_10650321 Ga0075365_106503212 134
77 3300006048 Ga0075363_100365685 Ga0075363_1003656852 134
78 3300006051 Ga0075364_10172734 Ga0075364_101727342 134
79 3300006051 Ga0075364_10231376 Ga0075364_102313762 134
80 3300009093 Ga0105240_12518877 Ga0105240_125188771 134
81 3300009094 Ga0111539_11320077 Ga0111539_113200772 134
82 3300009098 Ga0105245_10223846 Ga0105245_102238463 134
83 3300009098 Ga0105245_10744942 Ga0105245_107449421 134
84 3300009148 Ga0105243_10058588 Ga0105243_100585885 134
85 3300009148 Ga0105243_10163678 Ga0105243_101636782 134
86 3300009176 Ga0105242_10138067 Ga0105242_101380672 134
87 3300009553 Ga0105249_10428571 Ga0105249_104285712 134
88 3300013297 Ga0157378_13193202 Ga0157378_131932021 134
89 3300013306 Ga0163162_11372029 Ga0163162_113720292 134
90 3300013308 Ga0157375_12709220 Ga0157375_127092201 134
91 3300014326 Ga0157380_10895294 Ga0157380_108952942 134
92 3300014326 Ga0157380_12932731 Ga0157380_129327311 134
93 3300017792 Ga0163161_10891446 Ga0163161_108914461 134
94 3300025898 Ga0207692_10000034 Ga0207692_1000003452 134
95 3300025908 Ga0207643_10342067 Ga0207643_103420672 134
96 3300025915 Ga0207693_10251860 Ga0207693_102518602 134
97 3300025919 Ga0207657_10321874 Ga0207657_103218742 134
98 3300025927 Ga0207687_10229284 Ga0207687_102292843 134
99 3300025933 Ga0207706_10082086 Ga0207706_100820864 134
100 3300025935 Ga0207709_10132515 Ga0207709_101325153 134
101 3300025938 Ga0207704_10245403 Ga0207704_102454032 134
102 3300025940 Ga0207691_10605582 Ga0207691_106055822 134
103 3300025944 Ga0207661_10338792 Ga0207661_103387922 134
104 3300025981 Ga0207640_10496890 Ga0207640_104968902 134
105 3300026023 Ga0207677_10332211 Ga0207677_103322112 134
106 3300026067 Ga0207678_11309293 Ga0207678_113092932 134
107 3300026075 Ga0207708_10287256 Ga0207708_102872562 134
108 3300026075 Ga0207708_11032170 Ga0207708_110321702 134
109 3300026078 Ga0207702_12129018 Ga0207702_121290181 134
110 3300026118 Ga0207675_100255370 Ga0207675_1002553701 134
111 3300026118 Ga0207675_101360778 Ga0207675_1013607781 134
112 3300026142 Ga0207698_11260494 Ga0207698_112604941 134
113 3300031824 Ga0307413_11408585 Ga0307413_114085851 134
114 3300031852 Ga0307410_10208161 Ga0307410_102081612 134
115 3300031901 Ga0307406_10451842 Ga0307406_104518421 134
116 3300031901 Ga0307406_10600861 Ga0307406_106008611 134
117 3300031903 Ga0307407_10685861 Ga0307407_106858612 134
118 3300032002 Ga0307416_100531870 Ga0307416_1005318702 134
119 3300032005 Ga0307411_10296336 Ga0307411_102963363 134
120 3300032126 Ga0307415_100067712 Ga0307415_1000677122 134
121 3300032126 Ga0307415_100448108 Ga0307415_1004481081 134
122 3300035115 Ga0373941_0238740 Ga0373941_0238740_220_633 134
123 3300037418 Ga0395900_0412332 Ga0395900_0412332_816_1232 134
124 3300037418 Ga0395900_0988123 Ga0395900_0988123_270_683 134
125 3300037466 Ga0395898_1190961 Ga0395898_1190961_141_575 134
126 3300037471 Ga0395905_0530262 Ga0395905_0530262_444_860 134
127 3300037853 Ga0436364_0185151 Ga0436364_0185151_1037_1450 134
128 3300038443 Ga0395901_0318097 Ga0395901_0318097_313_747 134
129 3300044658 Ga0466972_0367195 Ga0466972_0367195_240_647 134
130 3300044683 Ga0466965_0049273 Ga0466965_0049273_142_549 134
131 3300044683 Ga0466965_0876618 Ga0466965_0876618_50_463 134
132 3300044694 Ga0466963_0032254 Ga0466963_0032254_1702_2115 134
133 3300044694 Ga0466963_0079976 Ga0466963_0079976_983_1396 134
134 3300044694 Ga0466963_0082894 Ga0466963_0082894_150_557 134
135 3300044694 Ga0466963_0266624 Ga0466963_0266624_465_872 134
136 3300044694 Ga0466963_0349972 Ga0466963_0349972_226_636 134
137 3300044719 Ga0466971_0573630 Ga0466971_0573630_79_486 134
138 3300044765 Ga0466970_0888527 Ga0466970_0888527_50_457 134
139 3300044842 Ga0466957_0037550 Ga0466957_0037550_2249_2656 134
140 3300045836 Ga0466958_0330502 Ga0466958_0330502_354_767 134
141 3300045976 Ga0466967_0000491 Ga0466967_0000491_6963_7376 134
142 3300045976 Ga0466967_0037656 Ga0466967_0037656_376_783 134
143 3300045976 Ga0466967_0042116 Ga0466967_0042116_3124_3537 134
144 3300045976 Ga0466967_0099842 Ga0466967_0099842_2091_2498 134
145 3300045976 Ga0466967_0117499 Ga0466967_0117499_537_989 134
146 3300045976 Ga0466967_0286840 Ga0466967_0286840_89_499 134
147 3300046518 Ga0495631_0102429 Ga0495631_0102429_805_1218 134
148 3300046794 Ga0495589_0357832 Ga0495589_0357832_211_627 134
149 3300048904 Ga0496101_1432364 Ga0496101_1432364_86_502 134
150 3300048905 Ga0496102_0005546 Ga0496102_0005546_4613_5017 134
151 3300048906 Ga0496103_0546951 Ga0496103_0546951_97_501 134
152 3300048909 Ga0496106_0241333 Ga0496106_0241333_34_438 134
153 3300048910 Ga0496107_0588560 Ga0496107_0588560_171_587 134
154 3300048912 Ga0496109_0930076 Ga0496109_0930076_163_576 134
155 3300048913 Ga0496110_0187697 Ga0496110_0187697_1171_1584 134
156 3300048914 Ga0496111_0776095 Ga0496111_0776095_263_676 134
157 3300048916 Ga0496113_0375379 Ga0496113_0375379_303_710 134
158 3300048916 Ga0496113_0449142 Ga0496113_0449142_604_1017 134
159 3300048917 Ga0496114_0936802 Ga0496114_0936802_277_690 134
160 3300048917 Ga0496114_1479850 Ga0496114_1479850_30_443 134
161 3300048927 Ga0496124_0154239 Ga0496124_0154239_334_750 134
162 3300050491 nmdc:mga00v17_208113_c1 nmdc:mga00v17_208113_c1_487_894 134
163 3300050491 nmdc:mga00v17_214296_c1 nmdc:mga00v17_214296_c1_690_1106 134
164 3300050491 nmdc:mga00v17_466675_c1 nmdc:mga00v17_466675_c1_272_688 134
165 3300050511 nmdc:mga08y16_853708_c1 nmdc:mga08y16_853708_c1_394_807 134
166 3300053083 Ga0495655_0226449 Ga0495655_0226449_189_602 134
167 3300005329 Ga0070683_100000151 Ga0070683_10000015133 135
168 3300005331 Ga0070670_100443048 Ga0070670_1004430482 135
169 3300005336 Ga0070680_100522608 Ga0070680_1005226082 135
170 3300005337 Ga0070682_100617835 Ga0070682_1006178351 135
171 3300005344 Ga0070661_101290394 Ga0070661_1012903941 135
172 3300005356 Ga0070674_101747465 Ga0070674_1017474651 135
173 3300005365 Ga0070688_100088506 Ga0070688_1000885062 135
174 3300005435 Ga0070714_100177581 Ga0070714_1001775812 135
175 3300005436 Ga0070713_100813400 Ga0070713_1008134001 135
176 3300005437 Ga0070710_10355497 Ga0070710_103554972 135
177 3300005441 Ga0070700_100822097 Ga0070700_1008220971 135
178 3300005535 Ga0070684_100000216 Ga0070684_1000002163 135
179 3300005549 Ga0070704_100175726 Ga0070704_1001757262 135
180 3300005549 Ga0070704_101019598 Ga0070704_1010195982 135
181 3300005564 Ga0070664_100070379 Ga0070664_1000703792 135
182 3300005577 Ga0068857_100014937 Ga0068857_1000149373 135
183 3300005614 Ga0068856_100075046 Ga0068856_1000750464 135
184 3300005719 Ga0068861_101626175 Ga0068861_1016261752 135
185 3300005840 Ga0068870_10292676 Ga0068870_102926761 135
186 3300005844 Ga0068862_101789305 Ga0068862_1017893052 135
187 3300005937 Ga0081455_10019606 Ga0081455_100196066 135
188 3300005937 Ga0081455_10118837 Ga0081455_101188373 135
189 3300005937 Ga0081455_10678124 Ga0081455_106781241 135
190 3300005981 Ga0081538_10003427 Ga0081538_1000342712 135
191 3300005981 Ga0081538_10005481 Ga0081538_100054814 135
192 3300005981 Ga0081538_10063174 Ga0081538_100631742 135
193 3300005983 Ga0081540_1001098 Ga0081540_100109832 135
194 3300006175 Ga0070712_100061560 Ga0070712_1000615602 135
195 3300006846 Ga0075430_100006738 Ga0075430_1000067382 135
196 3300006847 Ga0075431_100073086 Ga0075431_1000730864 135
197 3300006871 Ga0075434_100541536 Ga0075434_1005415362 135
198 3300009098 Ga0105245_10068231 Ga0105245_100682312 135
199 3300009553 Ga0105249_13565641 Ga0105249_135656411 135
200 3300010375 Ga0105239_12067207 Ga0105239_120672072 135
201 3300013105 Ga0157369_11877430 Ga0157369_118774302 135
202 3300013307 Ga0157372_12673389 Ga0157372_126733891 135
203 3300014325 Ga0163163_11193607 Ga0163163_111936072 135
204 3300014969 Ga0157376_12007084 Ga0157376_120070841 135
205 3300025898 Ga0207692_10607863 Ga0207692_106078631 135
206 3300025908 Ga0207643_10074362 Ga0207643_100743622 135
207 3300025915 Ga0207693_10065612 Ga0207693_100656122 135
208 3300025917 Ga0207660_10393273 Ga0207660_103932731 135
209 3300025925 Ga0207650_10373261 Ga0207650_103732612 135
210 3300025928 Ga0207700_11127795 Ga0207700_111277951 135
211 3300025932 Ga0207690_10528615 Ga0207690_105286152 135
212 3300025939 Ga0207665_10144718 Ga0207665_101447182 135
213 3300025939 Ga0207665_10605956 Ga0207665_106059562 135
214 3300025944 Ga0207661_10009068 Ga0207661_100090685 135
215 3300025945 Ga0207679_10035861 Ga0207679_100358613 135
216 3300026078 Ga0207702_10063082 Ga0207702_100630822 135
217 3300026116 Ga0207674_10005442 Ga0207674_100054427 135
218 3300026118 Ga0207675_102525535 Ga0207675_1025255351 135
219 3300028800 Ga0265338_10052629 Ga0265338_100526291 135
220 3300031251 Ga0265327_10010195 Ga0265327_100101956 135
221 3300031251 Ga0265327_10216279 Ga0265327_102162791 135
222 3300031548 Ga0307408_101234687 Ga0307408_1012346872 135
223 3300031731 Ga0307405_10504598 Ga0307405_105045982 135
224 3300031903 Ga0307407_10007577 Ga0307407_100075774 135
225 3300031911 Ga0307412_10112400 Ga0307412_101124002 135
226 3300031995 Ga0307409_100016250 Ga0307409_1000162503 135
227 3300032002 Ga0307416_100239935 Ga0307416_1002399351 135
228 3300032004 Ga0307414_10188317 Ga0307414_101883173 135
229 3300032005 Ga0307411_10071171 Ga0307411_100711713 135
230 3300032126 Ga0307415_100120904 Ga0307415_1001209043 135
231 3300037466 Ga0395898_0039578 Ga0395898_0039578_2539_2961 135
232 3300037466 Ga0395898_0393496 Ga0395898_0393496_90_512 135
233 3300037466 Ga0395898_1045597 Ga0395898_1045597_139_561 135
234 3300037466 Ga0395898_1773764 Ga0395898_1773764_54_491 135
235 3300038443 Ga0395901_1382239 Ga0395901_1382239_197_619 135
236 3300045976 Ga0466967_0422765 Ga0466967_0422765_622_1044 135
237 3300046474 Ga0495605_0094181 Ga0495605_0094181_915_1337 135
238 3300046523 Ga0495644_0393139 Ga0495644_0393139_71_493 135
239 3300048909 Ga0496106_0277389 Ga0496106_0277389_68_478 135
240 3300048912 Ga0496109_1197508 Ga0496109_1197508_94_501 135
241 3300048914 Ga0496111_0024912 Ga0496111_0024912_1828_2247 135
242 3300048915 Ga0496112_0071853 Ga0496112_0071853_551_976 135
243 3300048916 Ga0496113_1240476 Ga0496113_1240476_44_451 135
244 3300048917 Ga0496114_0116930 Ga0496114_0116930_1780_2190 135
245 3300050510 nmdc:mga06r32_310458_c1 nmdc:mga06r32_310458_c1_1042_1461 135
246 3300050512 nmdc:mga0n895_937974_c1 nmdc:mga0n895_937974_c1_195_611 135
247 3300053083 Ga0495655_0071652 Ga0495655_0071652_521_937 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01230

HIT

HIT domain

12

101

0.93

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

4

102

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o0m-assembly1.cif.gz_A crystal structure of a zn-bound histidine triad family protein from mycobacterium smegmatis 0.9453 2 133
3lb5-assembly2.cif.gz_D crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9358 1 133
3lb5-assembly2.cif.gz_C crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9348 1 133
3imi-assembly2.cif.gz_C 2.01 angstrom resolution crystal structure of a hit family protein from bacillus anthracis str. 'ames ancestor' 0.9334 3 116
3lb5-assembly1.cif.gz_A crystal structure of hit-like protein involved in cell-cycle regulation from bartonella henselae with unknown ligand 0.9223 1 133
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9564 17 106 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9517 3 109 3.30.428.10
3o0mB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9499 3 133 3.30.428.10
af_F4K1R2_26_184_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9281 2 133 3.30.428.10
3ksvA01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9242 2 108 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A350TWM6-F1-model_v4 deleted 0.9836 2 103
AF-A0A2E5KGQ5-F1-model_v4 HIT family hydrolase 0.9813 3 109 GO:0009117
GO:0016787
AF-A0A838MGY5-F1-model_v4 HIT family protein 0.9808 4 109 GO:0003824
GO:0009117
AF-A0A3N5E9W3-F1-model_v4 HIT family protein 0.9772 2 105 GO:0003824
GO:0009117
AF-A0A846Q632-F1-model_v4 HIT domain-containing protein 0.9745 2 106 GO:0003824
GO:0009117

Feature Viewer

pLDDT pTM Quality
93.36 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map