F359080

General Info

Members Datasets Scaffolds Average Seq Length
247 144 494 425

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10066636|Ga0207667_100666363
Length 453
Sequence MSNNKIWLITRREYLTRVRNRTFLLSTFLFPLVIILFIAGSVMIATQTHTHHKIAVVDANGYFKDYLRSDSSLSFDFSPGIDTLNYAERGNTAVLIIPALPEDNVTIYRLKFKKQLGPAAKDDLENRVNNAITDHLIYEKTSISRIQLDTLRSQSKIAALRTFDDNDKKARASNQNAAGAIGYVCAILIYMLTFIYGAMVMRGVMEEKTNRIAEVVVSSVKPFQLMMGKITGIGAVGLTQFLLWIVLLVGLSLLAQAFIPPSVGKEIMQLQQANAMGNAGNAIKVSEGASKIYEFKSAMSAANLGLTIFCFLFYFIGGYLFYSALFAAIGSAVNEDPQEAQSLMMPVTLPIVFSFFVATVALQDPTGPLAVWASIIPFSSPIVMTGRIPFGVPGTVPWWQLGLSMVSLVAGFLGRAFGWYRHPGEGPGIIVSIIGAMVLLFIYRMVIGRRRVV

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
91 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
106 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
119 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
120 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
121 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
124 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
125 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
126 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
129 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
130 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
131 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
137 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
138 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
139 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
140 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
143 2818991444 Filimonas endophytica 3197 Isolate Unclassified
144 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0
Isolates 0.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 0
Rhizoplane 0
Rhizosphere 88.26
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10066636 3300025949 Bacteria 3753
2 JGI24751J29686_10000969 3300002459 Bacteria 6311
3 rootH2_10017605 3300003320 Bacteria 31360
4 rootH2_10022078 3300003320 Bacteria 12617
5 rootL2_10076772 3300003322 Bacteria 4191
6 Ga0070658_10032075 3300005327 Bacteria 4223
7 Ga0070683_100077270 3300005329 Bacteria 3113
8 Ga0070670_100063453 3300005331 Bacteria 3171
9 Ga0070677_10003773 3300005333 Bacteria 4900
10 Ga0070666_10012122 3300005335 Bacteria 5430
11 Ga0070680_100046343 3300005336 Bacteria 3537
12 Ga0070680_100099991 3300005336 Bacteria 2407
13 Ga0068868_100035241 3300005338 Bacteria 3867
14 Ga0070660_100017242 3300005339 Bacteria 5262
15 Ga0070691_10039594 3300005341 Bacteria 2227
16 Ga0070691_10070692 3300005341 Bacteria 1693
17 Ga0070671_100000785 3300005355 Bacteria 22867
18 Ga0070671_100028300 3300005355 Bacteria 4615
19 Ga0070673_100010758 3300005364 Bacteria 6209
20 Ga0070673_100023360 3300005364 Bacteria 4517
21 Ga0070667_100013008 3300005367 Bacteria 6882
22 Ga0070667_100019572 3300005367 Bacteria 5616
23 Ga0070678_100257423 3300005456 Bacteria 1466
24 Ga0070681_10065381 3300005458 Bacteria 3605
25 Ga0070685_10062188 3300005466 Bacteria 2189
26 Ga0070679_100053377 3300005530 Bacteria 4024
27 Ga0068853_100008172 3300005539 Bacteria 8400
28 Ga0068853_100017206 3300005539 Bacteria 5966
29 Ga0070672_100093225 3300005543 Bacteria 2432
30 Ga0070665_100000018 3300005548 Bacteria 434118
31 Ga0068855_100007942 3300005563 Bacteria 12822
32 Ga0068855_100026847 3300005563 Bacteria 6889
33 Ga0068855_100120861 3300005563 Bacteria 2998
34 Ga0068855_100165391 3300005563 Unclassified 2508
35 Ga0068857_100001141 3300005577 Bacteria 20708
36 Ga0068857_100015142 3300005577 Bacteria 6731
37 Ga0068856_100007483 3300005614 Bacteria 10660
38 Ga0068852_100005345 3300005616 Bacteria 9173
39 Ga0068852_100007930 3300005616 Bacteria 7779
40 Ga0068852_100018222 3300005616 Bacteria 5529
41 Ga0068859_100000007 3300005617 Bacteria 390070
42 Ga0068859_100028744 3300005617 Bacteria 5574
43 Ga0068864_100001494 3300005618 Bacteria 19272
44 Ga0068864_100009943 3300005618 Bacteria 7847
45 Ga0068863_100004508 3300005841 Bacteria 13738
46 Ga0068863_100021443 3300005841 Bacteria 6165
47 Ga0068863_100116867 3300005841 Bacteria 2542
48 Ga0068863_100122351 3300005841 Bacteria 2482
49 Ga0068858_100003038 3300005842 Bacteria 16817
50 Ga0068860_100000252 3300005843 Bacteria 79891
51 Ga0068860_100002053 3300005843 Bacteria 21203
52 Ga0068860_100002841 3300005843 Bacteria 17987
53 Ga0068860_100013971 3300005843 Bacteria 7873
54 Ga0068862_100003587 3300005844 Bacteria 13289
55 Ga0097621_100000250 3300006237 Bacteria 36249
56 Ga0068871_100007063 3300006358 Bacteria 8004
57 Ga0068871_100007346 3300006358 Bacteria 7862
58 Ga0097620_100000007 3300006931 Bacteria 390070
59 Ga0097620_100028744 3300006931 Bacteria 5574
60 Ga0105240_10000431 3300009093 Bacteria 77497
61 Ga0105240_10009494 3300009093 Bacteria 13775
62 Ga0105240_10013177 3300009093 Bacteria 11373
63 Ga0105240_10021135 3300009093 Bacteria 8664
64 Ga0105240_10026582 3300009093 Bacteria 7595
65 Ga0105240_10027071 3300009093 Bacteria 7515
66 Ga0105240_10038478 3300009093 Bacteria 6136
67 Ga0105240_10050918 3300009093 Bacteria 5215
68 Ga0105240_10096421 3300009093 Bacteria 3604
69 Ga0105241_10001335 3300009174 Bacteria 18732
70 Ga0105241_10025560 3300009174 Bacteria 4389
71 Ga0105242_10017529 3300009176 Bacteria 5582
72 Ga0105248_10038472 3300009177 Bacteria 5354
73 Ga0105237_10002909 3300009545 Bacteria 20759
74 Ga0105237_10008105 3300009545 Bacteria 11413
75 Ga0105237_10010166 3300009545 Bacteria 10027
76 Ga0105237_10015367 3300009545 Bacteria 7971
77 Ga0105237_10018635 3300009545 Bacteria 7178
78 Ga0105237_10023029 3300009545 Bacteria 6387
79 Ga0105237_10037668 3300009545 Bacteria 4887
80 Ga0105238_10001916 3300009551 Bacteria 20875
81 Ga0105249_10011651 3300009553 Bacteria 7732
82 Ga0105239_10002372 3300010375 Bacteria 24021
83 Ga0105239_10006685 3300010375 Bacteria 13321
84 Ga0105239_10007590 3300010375 Bacteria 12429
85 Ga0105239_10023304 3300010375 Bacteria 6819
86 Ga0105239_10033537 3300010375 Bacteria 5637
87 Ga0105239_10054132 3300010375 Unclassified 4401
88 Ga0105239_10169757 3300010375 Bacteria 2439
89 Ga0157373_10009227 3300013100 Bacteria 7293
90 Ga0157373_10073402 3300013100 Bacteria 2414
91 Ga0157370_10000549 3300013104 Bacteria 46792
92 Ga0157370_10017252 3300013104 Bacteria 7288
93 Ga0157370_10017449 3300013104 Bacteria 7241
94 Ga0157369_10019067 3300013105 Bacteria 7680
95 Ga0157369_10182091 3300013105 Bacteria 2210
96 Ga0157374_10000025 3300013296 Bacteria 245131
97 Ga0157378_10002846 3300013297 Bacteria 15427
98 Ga0157378_10012950 3300013297 Bacteria 7296
99 Ga0157378_10016195 3300013297 Bacteria 6530
100 Ga0163162_10000124 3300013306 Bacteria 68603
101 Ga0163162_10000406 3300013306 Bacteria 39456
102 Ga0163162_10001048 3300013306 Bacteria 25671
103 Ga0163162_10004042 3300013306 Bacteria 14074
104 Ga0163162_10014865 3300013306 Bacteria 7601
105 Ga0157372_10001897 3300013307 Bacteria 22688
106 Ga0157372_10022708 3300013307 Bacteria 6790
107 Ga0157372_10093287 3300013307 Bacteria 3426
108 Ga0157372_10159204 3300013307 Bacteria 2608
109 Ga0157372_10192123 3300013307 Bacteria 2364
110 Ga0157372_10218429 3300013307 Bacteria 2209
111 Ga0157372_10284876 3300013307 Bacteria 1921
112 Ga0157375_10000483 3300013308 Bacteria 36292
113 Ga0157375_10038922 3300013308 Bacteria 4570
114 Ga0163163_10000668 3300014325 Bacteria 29354
115 Ga0163163_10011998 3300014325 Bacteria 7884
116 Ga0163163_10091603 3300014325 Bacteria 3055
117 Ga0157379_10097803 3300014968 Bacteria 2635
118 Ga0157376_10000353 3300014969 Bacteria 30588
119 Ga0157376_10014335 3300014969 Bacteria 5946
120 Ga0157376_10050388 3300014969 Bacteria 3454
121 Ga0163161_10001881 3300017792 Bacteria 15314
122 Ga0163161_10031699 3300017792 Bacteria 3768
123 Ga0213876_10003805 3300021384 Bacteria 8552
124 Ga0213876_10024155 3300021384 Bacteria 3208
125 Ga0207682_10011973 3300025893 Unclassified 3387
126 Ga0207680_10000172 3300025903 Bacteria 31500
127 Ga0207680_10006462 3300025903 Bacteria 5667
128 Ga0207705_10092352 3300025909 Bacteria 2218
129 Ga0207707_10126659 3300025912 Bacteria 2234
130 Ga0207695_10000224 3300025913 Bacteria 151136
131 Ga0207695_10001519 3300025913 Bacteria 38506
132 Ga0207695_10004096 3300025913 Bacteria 20038
133 Ga0207695_10019565 3300025913 Bacteria 7790
134 Ga0207695_10020865 3300025913 Bacteria 7486
135 Ga0207695_10042698 3300025913 Bacteria 4839
136 Ga0207695_10050618 3300025913 Bacteria 4368
137 Ga0207695_10065203 3300025913 Bacteria 3745
138 Ga0207671_10002103 3300025914 Bacteria 21762
139 Ga0207671_10003892 3300025914 Bacteria 14560
140 Ga0207671_10008812 3300025914 Bacteria 8496
141 Ga0207671_10009409 3300025914 Bacteria 8169
142 Ga0207671_10050116 3300025914 Bacteria 3091
143 Ga0207671_10067951 3300025914 Unclassified 2655
144 Ga0207660_10116996 3300025917 Bacteria 2014
145 Ga0207657_10012404 3300025919 Bacteria 8422
146 Ga0207652_10009408 3300025921 Bacteria 7857
147 Ga0207694_10197653 3300025924 Bacteria 1635
148 Ga0207659_10069657 3300025926 Bacteria 2562
149 Ga0207691_10009301 3300025940 Bacteria 9431
150 Ga0207689_10001304 3300025942 Bacteria 24024
151 Ga0207689_10033543 3300025942 Bacteria 4266
152 Ga0207679_10116212 3300025945 Bacteria 2121
153 Ga0207667_10002159 3300025949 Bacteria 24642
154 Ga0207667_10003703 3300025949 Bacteria 18851
155 Ga0207667_10050362 3300025949 Bacteria 4395
156 Ga0207667_10086595 3300025949 Bacteria 3242
157 Ga0207640_10013456 3300025981 Bacteria 4690
158 Ga0207658_10144374 3300025986 Bacteria 1930
159 Ga0207677_10102499 3300026023 Bacteria 2110
160 Ga0207703_10045857 3300026035 Bacteria 3518
161 Ga0207639_10005688 3300026041 Bacteria 8437
162 Ga0207639_10048073 3300026041 Bacteria 3227
163 Ga0207639_10071288 3300026041 Bacteria 2717
164 Ga0207641_10000090 3300026088 Bacteria 127735
165 Ga0207641_10091082 3300026088 Bacteria 2668
166 Ga0207648_10045069 3300026089 Bacteria 3869
167 Ga0207676_10002953 3300026095 Bacteria 12129
168 Ga0207674_10003399 3300026116 Bacteria 19518
169 Ga0207674_10019086 3300026116 Bacteria 7433
170 Ga0207683_10044539 3300026121 Unclassified 3879
171 Ga0207683_10258354 3300026121 Bacteria 1590
172 Ga0207698_10002125 3300026142 Bacteria 11686
173 Ga0207698_10010037 3300026142 Bacteria 6064
174 Ga0207698_10010806 3300026142 Bacteria 5890
175 Ga0268266_10000026 3300028379 Bacteria 434485
176 Ga0268265_10007380 3300028380 Bacteria 7423
177 Ga0268264_10000015 3300028381 Bacteria 508501
178 Ga0268264_10000019 3300028381 Bacteria 488112
179 Ga0268264_10000054 3300028381 Bacteria 317048
180 Ga0268264_10001333 3300028381 Bacteria 23222
181 Ga0268264_10002767 3300028381 Bacteria 15294
182 Ga0268264_10011948 3300028381 Bacteria 7150
183 Ga0307517_10005589 3300028786 Bacteria 18886
184 Ga0307515_10000078 3300028794 Bacteria 227988
185 Ga0307511_10000024 3300030521 Bacteria 112616
186 Ga0307513_10117360 3300031456 Unclassified 2638
187 Ga0307509_10148289 3300031507 Bacteria 2267
188 Ga0307508_10000162 3300031616 Bacteria 80675
189 Ga0307516_10002555 3300031730 Bacteria 24195
190 Ga0307510_10003981 3300033180 Bacteria 17300
191 Ga0307510_10055508 3300033180 Bacteria 4137
192 Ga0373947_0075162 3300035725 Unclassified 2080
193 Ga0395900_0027165 3300037418 Bacteria 5861
194 Ga0395905_0001907 3300037471 Bacteria 24001
195 Ga0436365_0614476 3300039437 Bacteria 9743
196 Ga0436365_1584543 3300039437 Bacteria 38465
197 Ga0466972_0000716 3300044658 Bacteria 15875
198 Ga0453684_0325445 3300044712 Bacteria 1739
199 Ga0466968_0040787 3300044735 Bacteria 1958
200 Ga0466970_0020087 3300044765 Bacteria 3467
201 Ga0466959_0000768 3300045049 Bacteria 18800
202 Ga0495638_0024052 3300046460 Bacteria 3976
203 Ga0495606_0001907 3300046507 Bacteria 25966
204 Ga0495648_0000493 3300046524 Bacteria 42504
205 Ga0495598_0016846 3300046537 Bacteria 1873
206 Ga0495668_0000172 3300046616 Bacteria 96882
207 Ga0495611_0001086 3300046648 Bacteria 14336
208 Ga0495649_0042526 3300046694 Bacteria 2483
209 Ga0495672_0014544 3300047320 Bacteria 5384
210 Ga0495672_0021476 3300047320 Bacteria 4211
211 Ga0495672_0025868 3300047320 Bacteria 3752
212 Ga0495687_000031 3300047443 Bacteria 274659
213 Ga0495686_0000128 3300047472 Bacteria 156223
214 Ga0496124_0063169 3300048927 Bacteria 3095
215 Ga0501298_000357 3300049521 Bacteria 6131
216 Ga0501299_006242 3300049522 Unclassified 1864
217 Ga0501033_0125389 3300049570 Unclassified 1862
218 Ga0501034_0017622 3300049571 Bacteria 7322
219 Ga0501034_0045069 3300049571 Bacteria 4458
220 Ga0501201_000992 3300049651 Bacteria 2663
221 Ga0501202_003262 3300049652 Bacteria 2770
222 Ga0501206_004386 3300049653 Bacteria 1794
223 Ga0501216_011538 3300049660 Unclassified 1438
224 Ga0501217_000395 3300049661 Bacteria 7038
225 Ga0501223_003325 3300049663 Bacteria 3513
226 Ga0501233_001081 3300049668 Bacteria 4616
227 Ga0501235_000727 3300049669 Bacteria 6714
228 Ga0501243_001151 3300049675 Bacteria 3761
229 Ga0501259_000918 3300049688 Bacteria 4851
230 Ga0501260_000779 3300049689 Bacteria 2513
231 Ga0501261_004718 3300049690 Unclassified 1696
232 Ga0501221_000932 3300049704 Bacteria 4795
233 Ga0501225_0019607 3300049705 Unclassified 1871
234 Ga0501044_0014499 3300049823 Bacteria 8502
235 Ga0500644_0024216 3300053088 Bacteria 1853
236 Ga0500562_000015 3300053108 Bacteria 143120
237 Ga0500642_0018323 3300053130 Bacteria 2705
238 Ga0500568_0019585 3300053139 Bacteria 2938
239 Ga0500588_0005422 3300053146 Bacteria 2835
240 Ga0500622_0002720 3300053156 Bacteria 12490
241 Ga0500622_0003649 3300053156 Bacteria 10118
242 Ga0500637_0120838 3300053178 Bacteria 1520
243 Ga0500611_000029 3300053727 Bacteria 89288
244 Ga0500645_027325 3300053730 Unclassified 1730
245 Ga0466962_0015143 3300061719 Bacteria 3719
246 2819589929 2818991444 Bacteria 6968812
247 2929160197 2929154850 Bacteria 6753285
248 Ga0207667_10066636
249 JGI24751J29686_10000969
250 rootH2_10017605
251 rootH2_10022078
252 rootL2_10076772
253 Ga0070658_10032075
254 Ga0070683_100077270
255 Ga0070670_100063453
256 Ga0070677_10003773
257 Ga0070666_10012122
258 Ga0070680_100046343
259 Ga0070680_100099991
260 Ga0068868_100035241
261 Ga0070660_100017242
262 Ga0070691_10039594
263 Ga0070691_10070692
264 Ga0070671_100000785
265 Ga0070671_100028300
266 Ga0070673_100010758
267 Ga0070673_100023360
268 Ga0070667_100013008
269 Ga0070667_100019572
270 Ga0070678_100257423
271 Ga0070681_10065381
272 Ga0070685_10062188
273 Ga0070679_100053377
274 Ga0068853_100008172
275 Ga0068853_100017206
276 Ga0070672_100093225
277 Ga0070665_100000018
278 Ga0068855_100007942
279 Ga0068855_100026847
280 Ga0068855_100120861
281 Ga0068855_100165391
282 Ga0068857_100001141
283 Ga0068857_100015142
284 Ga0068856_100007483
285 Ga0068852_100005345
286 Ga0068852_100007930
287 Ga0068852_100018222
288 Ga0068859_100000007
289 Ga0068859_100028744
290 Ga0068864_100001494
291 Ga0068864_100009943
292 Ga0068863_100004508
293 Ga0068863_100021443
294 Ga0068863_100116867
295 Ga0068863_100122351
296 Ga0068858_100003038
297 Ga0068860_100000252
298 Ga0068860_100002053
299 Ga0068860_100002841
300 Ga0068860_100013971
301 Ga0068862_100003587
302 Ga0097621_100000250
303 Ga0068871_100007063
304 Ga0068871_100007346
305 Ga0097620_100000007
306 Ga0097620_100028744
307 Ga0105240_10000431
308 Ga0105240_10009494
309 Ga0105240_10013177
310 Ga0105240_10021135
311 Ga0105240_10026582
312 Ga0105240_10027071
313 Ga0105240_10038478
314 Ga0105240_10050918
315 Ga0105240_10096421
316 Ga0105241_10001335
317 Ga0105241_10025560
318 Ga0105242_10017529
319 Ga0105248_10038472
320 Ga0105237_10002909
321 Ga0105237_10008105
322 Ga0105237_10010166
323 Ga0105237_10015367
324 Ga0105237_10018635
325 Ga0105237_10023029
326 Ga0105237_10037668
327 Ga0105238_10001916
328 Ga0105249_10011651
329 Ga0105239_10002372
330 Ga0105239_10006685
331 Ga0105239_10007590
332 Ga0105239_10023304
333 Ga0105239_10033537
334 Ga0105239_10054132
335 Ga0105239_10169757
336 Ga0157373_10009227
337 Ga0157373_10073402
338 Ga0157370_10000549
339 Ga0157370_10017252
340 Ga0157370_10017449
341 Ga0157369_10019067
342 Ga0157369_10182091
343 Ga0157374_10000025
344 Ga0157378_10002846
345 Ga0157378_10012950
346 Ga0157378_10016195
347 Ga0163162_10000124
348 Ga0163162_10000406
349 Ga0163162_10001048
350 Ga0163162_10004042
351 Ga0163162_10014865
352 Ga0157372_10001897
353 Ga0157372_10022708
354 Ga0157372_10093287
355 Ga0157372_10159204
356 Ga0157372_10192123
357 Ga0157372_10218429
358 Ga0157372_10284876
359 Ga0157375_10000483
360 Ga0157375_10038922
361 Ga0163163_10000668
362 Ga0163163_10011998
363 Ga0163163_10091603
364 Ga0157379_10097803
365 Ga0157376_10000353
366 Ga0157376_10014335
367 Ga0157376_10050388
368 Ga0163161_10001881
369 Ga0163161_10031699
370 Ga0213876_10003805
371 Ga0213876_10024155
372 Ga0207682_10011973
373 Ga0207680_10000172
374 Ga0207680_10006462
375 Ga0207705_10092352
376 Ga0207707_10126659
377 Ga0207695_10000224
378 Ga0207695_10001519
379 Ga0207695_10004096
380 Ga0207695_10019565
381 Ga0207695_10020865
382 Ga0207695_10042698
383 Ga0207695_10050618
384 Ga0207695_10065203
385 Ga0207671_10002103
386 Ga0207671_10003892
387 Ga0207671_10008812
388 Ga0207671_10009409
389 Ga0207671_10050116
390 Ga0207671_10067951
391 Ga0207660_10116996
392 Ga0207657_10012404
393 Ga0207652_10009408
394 Ga0207694_10197653
395 Ga0207659_10069657
396 Ga0207691_10009301
397 Ga0207689_10001304
398 Ga0207689_10033543
399 Ga0207679_10116212
400 Ga0207667_10002159
401 Ga0207667_10003703
402 Ga0207667_10050362
403 Ga0207667_10086595
404 Ga0207640_10013456
405 Ga0207658_10144374
406 Ga0207677_10102499
407 Ga0207703_10045857
408 Ga0207639_10005688
409 Ga0207639_10048073
410 Ga0207639_10071288
411 Ga0207641_10000090
412 Ga0207641_10091082
413 Ga0207648_10045069
414 Ga0207676_10002953
415 Ga0207674_10003399
416 Ga0207674_10019086
417 Ga0207683_10044539
418 Ga0207683_10258354
419 Ga0207698_10002125
420 Ga0207698_10010037
421 Ga0207698_10010806
422 Ga0268266_10000026
423 Ga0268265_10007380
424 Ga0268264_10000015
425 Ga0268264_10000019
426 Ga0268264_10000054
427 Ga0268264_10001333
428 Ga0268264_10002767
429 Ga0268264_10011948
430 Ga0307517_10005589
431 Ga0307515_10000078
432 Ga0307511_10000024
433 Ga0307513_10117360
434 Ga0307509_10148289
435 Ga0307508_10000162
436 Ga0307516_10002555
437 Ga0307510_10003981
438 Ga0307510_10055508
439 Ga0373947_0075162
440 Ga0395900_0027165
441 Ga0395905_0001907
442 Ga0436365_0614476
443 Ga0436365_1584543
444 Ga0466972_0000716
445 Ga0453684_0325445
446 Ga0466968_0040787
447 Ga0466970_0020087
448 Ga0466959_0000768
449 Ga0495638_0024052
450 Ga0495606_0001907
451 Ga0495648_0000493
452 Ga0495598_0016846
453 Ga0495668_0000172
454 Ga0495611_0001086
455 Ga0495649_0042526
456 Ga0495672_0014544
457 Ga0495672_0021476
458 Ga0495672_0025868
459 Ga0495687_000031
460 Ga0495686_0000128
461 Ga0496124_0063169
462 Ga0501298_000357
463 Ga0501299_006242
464 Ga0501033_0125389
465 Ga0501034_0017622
466 Ga0501034_0045069
467 Ga0501201_000992
468 Ga0501202_003262
469 Ga0501206_004386
470 Ga0501216_011538
471 Ga0501217_000395
472 Ga0501223_003325
473 Ga0501233_001081
474 Ga0501235_000727
475 Ga0501243_001151
476 Ga0501259_000918
477 Ga0501260_000779
478 Ga0501261_004718
479 Ga0501221_000932
480 Ga0501225_0019607
481 Ga0501044_0014499
482 Ga0500644_0024216
483 Ga0500562_000015
484 Ga0500642_0018323
485 Ga0500568_0019585
486 Ga0500588_0005422
487 Ga0500622_0002720
488 Ga0500622_0003649
489 Ga0500637_0120838
490 Ga0500611_000029
491 Ga0500645_027325
492 Ga0466962_0015143
493 2819589929
494 2929160197

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04226

Transgly_assoc

Transglycosylase associated protein

407

448

0.96

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

21

420

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z7n-assembly1.cif.gz_E atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate 0.5764 51 95
6czm-assembly1.cif.gz_D crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form 0.5626 49 96
1z7n-assembly1.cif.gz_H atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate 0.56 51 95
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.5073 172 396
2vd3-assembly1.cif.gz_A the structure of histidine inhibited hisg from methanobacterium thermoautotrophicum 0.5063 51 94
ID Description Score Start End Superfamily
2i6eA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5208 51 97 3.40.190.10
1z7nH02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.4955 51 101 3.40.190.10
2o1mB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.4948 48 94 3.40.190.10
1k35A03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.477 42 96 3.40.120.10
af_Q54HM5_62_190_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4379 278 397 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A4D7JF70-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9602 279 403 GO:0016020
GO:0140359
AF-A0A4D7JF70-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.8904 279 403 GO:0016020
GO:0140359
AF-R6TYM7-F1-model_v4 deleted 0.8737 276 412
AF-A0A3D4T9N3-F1-model_v4 ABC transporter permease 0.8717 276 412 GO:0016020
GO:0140359
AF-A0A3B8WEN6-F1-model_v4 ABC transporter permease 0.8699 274 412 GO:0016020
GO:0140359

Map