F359149

General Info

Members Datasets Scaffolds Average Seq Length
247 145 494 438

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10017521|Ga0307410_100175212
Length 455
Sequence MEVQASGQCRCGPRRLDYNPRMPTLLASLMLSLLVASAAGAQVTAIRAGRLIDPETGTAAANQVILVENGRFTAVGSNVAVPAGAEVIDLSALTVLPGLVDAHNHLALTYKDEPESNVYYFTYVTDSTALRAIQAASNGLQMLSSGFTIVRDMGNNGNYADTALRVAIEQGWLPGPTIINSGLIIGGMGGQFYPTPEMAVDKKIVYPEYLDADTPDEIVKAVRQNILFGAKVIKICVDCKPYGYTIDEIRLFIAEAAKSGLKVEGHCQTEPGVRRAVEAGIWSIAHDSGMSDALHKQMAQKGVWRAGTETPISLTGHTTAERYDRTVKLLRNAWENKVPLTFSTDADYYVPPKTRGEVAISFIETWTAAGIPNADILRAMTTNGYKVSETEKTRGPIKPGMAADLIAVTGNPLENIDALRRVQFVLKDGLVFKRDGVMTPEKFLHGGPVKGWRIR

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
95 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
96 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
97 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
129 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.02
Rhizosphere 97.98
Stem 0
Stem Tuber 0
Unclassified 9.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10017521 3300031852 Bacteria 4304
2 Ga0065712_10013224 3300005290 Bacteria 2344
3 Ga0065712_10074231 3300005290 Bacteria 4133
4 Ga0065712_10087646 3300005290 Archaea 2563
5 Ga0065715_10002860 3300005293 Bacteria 7998
6 Ga0065715_10003502 3300005293 Bacteria 4475
7 Ga0065707_10011362 3300005295 Viruses 3446
8 Ga0070670_100008418 3300005331 Bacteria 8794
9 Ga0070666_10011436 3300005335 Bacteria 5569
10 Ga0070689_100112773 3300005340 Bacteria 2164
11 Ga0070687_100020975 3300005343 Bacteria 3064
12 Ga0070668_100053125 3300005347 Bacteria 3125
13 Ga0070669_100008526 3300005353 Bacteria 7317
14 Ga0070669_100031711 3300005353 Bacteria 3817
15 Ga0070669_100079112 3300005353 Bacteria 2445
16 Ga0070669_100198681 3300005353 Unclassified 1577
17 Ga0070675_100000320 3300005354 Bacteria 32325
18 Ga0070675_100151048 3300005354 Bacteria 1992
19 Ga0070675_100207920 3300005354 Bacteria 1700
20 Ga0070671_100001663 3300005355 Bacteria 16827
21 Ga0070674_100001413 3300005356 Bacteria 12723
22 Ga0070673_100019654 3300005364 Bacteria 4853
23 Ga0070688_100034123 3300005365 Bacteria 3080
24 Ga0070701_10040859 3300005438 Bacteria 2360
25 Ga0070705_100002441 3300005440 Bacteria 9344
26 Ga0070694_100001688 3300005444 Bacteria 12990
27 Ga0070694_100103890 3300005444 Unclassified 2014
28 Ga0070708_100056462 3300005445 Bacteria 3493
29 Ga0070662_100198423 3300005457 Bacteria 1591
30 Ga0068867_100002748 3300005459 Bacteria 12403
31 Ga0068867_100038888 3300005459 Bacteria 3466
32 Ga0070707_100098376 3300005468 Bacteria 2834
33 Ga0070698_100178334 3300005471 Unclassified 2063
34 Ga0070699_100036751 3300005518 Bacteria 4237
35 Ga0070699_100059924 3300005518 Bacteria 3298
36 Ga0070686_100000279 3300005544 Bacteria 34519
37 Ga0070686_100148648 3300005544 Bacteria 1638
38 Ga0070695_100002470 3300005545 Bacteria 10647
39 Ga0070695_100101442 3300005545 Bacteria 1939
40 Ga0070696_100002046 3300005546 Bacteria 13222
41 Ga0070696_100004702 3300005546 Bacteria 9125
42 Ga0070665_100006639 3300005548 Bacteria 11761
43 Ga0070704_100002438 3300005549 Bacteria 10432
44 Ga0070704_100045614 3300005549 Bacteria 3051
45 Ga0068854_100001918 3300005578 Bacteria 12674
46 Ga0068856_100198222 3300005614 Unclassified 2022
47 Ga0068852_100165371 3300005616 Bacteria 2069
48 Ga0068859_100386757 3300005617 Bacteria 1495
49 Ga0068864_100230258 3300005618 Unclassified 1713
50 Ga0068864_100294135 3300005618 Bacteria 1519
51 Ga0068861_100037114 3300005719 Bacteria 3622
52 Ga0068861_100138436 3300005719 Bacteria 1984
53 Ga0068863_100000525 3300005841 Bacteria 39048
54 Ga0068863_100126684 3300005841 Bacteria 2437
55 Ga0068863_100315373 3300005841 Bacteria 1518
56 Ga0068858_100007609 3300005842 Bacteria 10463
57 Ga0068862_100003344 3300005844 Bacteria 13843
58 Ga0068862_100020463 3300005844 Bacteria 5528
59 Ga0068862_100072593 3300005844 Unclassified 2973
60 Ga0081455_10019380 3300005937 Bacteria 6438
61 Ga0068871_100001766 3300006358 Bacteria 14556
62 Ga0068871_100057556 3300006358 Bacteria 3163
63 Ga0075428_100071549 3300006844 Bacteria 3790
64 Ga0075430_100006518 3300006846 Bacteria 9841
65 Ga0075430_100090222 3300006846 Unclassified 2564
66 Ga0075430_100195072 3300006846 Bacteria 1682
67 Ga0075431_100010228 3300006847 Bacteria 9434
68 Ga0075431_100014867 3300006847 Bacteria 7880
69 Ga0075431_100018060 3300006847 Bacteria 7175
70 Ga0075431_100109406 3300006847 Bacteria 2852
71 Ga0075433_10014426 3300006852 Bacteria 6454
72 Ga0075434_100000385 3300006871 Bacteria 32259
73 Ga0075434_100014091 3300006871 Bacteria 7636
74 Ga0075436_100000036 3300006914 Bacteria 84076
75 Ga0075436_100031838 3300006914 Bacteria 3633
76 Ga0075436_100116101 3300006914 Bacteria 1870
77 Ga0097620_100386750 3300006931 Bacteria 1495
78 Ga0075435_100000014 3300007076 Bacteria 100771
79 Ga0075435_100014474 3300007076 Bacteria 5897
80 Ga0075435_100017881 3300007076 Bacteria 5374
81 Ga0075435_100033458 3300007076 Bacteria 4065
82 Ga0075435_100071345 3300007076 Bacteria 2836
83 Ga0111539_10000411 3300009094 Bacteria 53592
84 Ga0111539_10000574 3300009094 Bacteria 47151
85 Ga0111539_10009024 3300009094 Bacteria 12619
86 Ga0111539_10016421 3300009094 Bacteria 9178
87 Ga0111539_10027457 3300009094 Bacteria 6953
88 Ga0111539_10105411 3300009094 Bacteria 3307
89 Ga0111539_10250349 3300009094 Bacteria 2063
90 Ga0105245_10227733 3300009098 Bacteria 1802
91 Ga0105247_10003148 3300009101 Bacteria 10871
92 Ga0114129_10000263 3300009147 Bacteria 59355
93 Ga0114129_10002820 3300009147 Bacteria 24254
94 Ga0114129_10022599 3300009147 Bacteria 8921
95 Ga0114129_10024144 3300009147 Bacteria 8616
96 Ga0114129_10048593 3300009147 Bacteria 5961
97 Ga0114129_10102965 3300009147 Bacteria 3948
98 Ga0114129_10134045 3300009147 Unclassified 3400
99 Ga0105243_10066096 3300009148 Bacteria 2908
100 Ga0105241_10112681 3300009174 Bacteria 2179
101 Ga0105248_10005812 3300009177 Bacteria 13563
102 Ga0105248_10010618 3300009177 Bacteria 10154
103 Ga0105248_10044616 3300009177 Bacteria 4972
104 Ga0105248_10211164 3300009177 Bacteria 2187
105 Ga0105249_10000910 3300009553 Bacteria 26144
106 Ga0163162_10022024 3300013306 Bacteria 6279
107 Ga0163162_10087517 3300013306 Bacteria 3194
108 Ga0163163_10011037 3300014325 Bacteria 8169
109 Ga0163163_10143122 3300014325 Bacteria 2434
110 Ga0163163_10167336 3300014325 Unclassified 2245
111 Ga0157380_10002137 3300014326 Bacteria 13258
112 Ga0157380_10083042 3300014326 Unclassified 2623
113 Ga0157379_10003932 3300014968 Bacteria 12662
114 Ga0207710_10008530 3300025900 Bacteria 4320
115 Ga0207645_10002227 3300025907 Bacteria 15459
116 Ga0207695_10177064 3300025913 Bacteria 2055
117 Ga0207681_10001621 3300025923 Bacteria 14508
118 Ga0207681_10058211 3300025923 Bacteria 2645
119 Ga0207681_10169354 3300025923 Bacteria 1654
120 Ga0207650_10092110 3300025925 Unclassified 2318
121 Ga0207650_10220916 3300025925 Bacteria 1525
122 Ga0207659_10003190 3300025926 Bacteria 9807
123 Ga0207644_10097249 3300025931 Viruses 2205
124 Ga0207670_10079971 3300025936 Unclassified 2283
125 Ga0207669_10159212 3300025937 Unclassified 1592
126 Ga0207704_10005229 3300025938 Bacteria 5976
127 Ga0207704_10135359 3300025938 Bacteria 1714
128 Ga0207691_10028220 3300025940 Bacteria 5257
129 Ga0207711_10108939 3300025941 Bacteria 2461
130 Ga0207711_10186341 3300025941 Bacteria 1889
131 Ga0207651_10256768 3300025960 Unclassified 1433
132 Ga0207712_10001414 3300025961 Bacteria 16371
133 Ga0207668_10139969 3300025972 Bacteria 1859
134 Ga0207640_10002055 3300025981 Bacteria 10872
135 Ga0207703_10026193 3300026035 Bacteria 4588
136 Ga0207708_10003178 3300026075 Bacteria 12099
137 Ga0207708_10048127 3300026075 Bacteria 3245
138 Ga0207702_10235539 3300026078 Unclassified 1713
139 Ga0207641_10008183 3300026088 Bacteria 8650
140 Ga0207641_10118750 3300026088 Bacteria 2356
141 Ga0207648_10002234 3300026089 Bacteria 20964
142 Ga0207648_10227054 3300026089 Unclassified 1660
143 Ga0207676_10247366 3300026095 Bacteria 1603
144 Ga0207674_10069324 3300026116 Bacteria 3547
145 Ga0207675_100050652 3300026118 Bacteria 3875
146 Ga0207675_100063838 3300026118 Bacteria 3441
147 Ga0207675_100111035 3300026118 Bacteria 2587
148 Ga0207428_10000135 3300027907 Bacteria 99170
149 Ga0207428_10006019 3300027907 Bacteria 11222
150 Ga0268266_10058127 3300028379 Bacteria 3329
151 Ga0268265_10002407 3300028380 Bacteria 14141
152 Ga0268265_10008084 3300028380 Bacteria 7108
153 Ga0268264_10149822 3300028381 Bacteria 2090
154 Ga0307405_10250584 3300031731 Bacteria 1317
155 Ga0307410_10052734 3300031852 Bacteria 2749
156 Ga0307407_10001002 3300031903 Bacteria 9712
157 Ga0307409_100025976 3300031995 Bacteria 4121
158 Ga0307416_100208217 3300032002 Bacteria 1863
159 Ga0307411_10146153 3300032005 Bacteria 1750
160 Ga0373959_0000858 3300034820 Bacteria 5147
161 Ga0373940_0003168 3300035088 Bacteria 3321
162 Ga0373949_0000768 3300035090 Bacteria 10347
163 Ga0373951_0000221 3300035091 Bacteria 19838
164 Ga0373941_0000311 3300035115 Bacteria 9434
165 Ga0373960_0000808 3300035121 Bacteria 6582
166 Ga0373942_0000828 3300035207 Bacteria 8537
167 Ga0373961_0000405 3300035241 Bacteria 18136
168 Ga0373962_0006528 3300035242 Bacteria 2827
169 Ga0373925_0063714 3300037068 Unclassified 2774
170 Ga0451576_0249016 3300045051 Bacteria 1857
171 Ga0495592_0030895 3300046454 Unclassified 4052
172 Ga0495651_0048189 3300046462 Bacteria 3292
173 Ga0495580_0147623 3300046472 Bacteria 1630
174 Ga0495664_0064775 3300046477 Unclassified 2178
175 Ga0495608_0040435 3300046511 Bacteria 3124
176 Ga0495618_0147462 3300046514 Unclassified 1504
177 Ga0495586_0094156 3300046535 Bacteria 1657
178 Ga0495645_0020984 3300046543 Bacteria 4720
179 Ga0495667_0000918 3300046559 Bacteria 19053
180 Ga0495599_0018263 3300046678 Bacteria 4370
181 Ga0495623_0088327 3300046679 Bacteria 1908
182 Ga0495636_0023726 3300047318 Bacteria 2485
183 Ga0496102_0212930 3300048905 Bacteria 1822
184 Ga0496108_0001575 3300048911 Bacteria 18056
185 Ga0496112_0029712 3300048915 Bacteria 5288
186 Ga0496112_0054314 3300048915 Bacteria 3935
187 Ga0496113_0218943 3300048916 Bacteria 1517
188 Ga0501039_0098508 3300049575 Bacteria 2281
189 Ga0501039_0216044 3300049575 Bacteria 1508
190 Ga0501040_0009776 3300049576 Bacteria 6262
191 Ga0501041_0037257 3300049577 Bacteria 2947
192 Ga0501041_0078010 3300049577 Bacteria 2038
193 Ga0501048_0042948 3300049582 Bacteria 3236
194 Ga0501068_0086424 3300049584 Bacteria 1931
195 Ga0501071_0032293 3300049587 Bacteria 3717
196 Ga0501071_0063086 3300049587 Bacteria 2686
197 Ga0501072_0047522 3300049588 Bacteria 3379
198 Ga0501075_0007452 3300049591 Bacteria 7588
199 Ga0501075_0150684 3300049591 Bacteria 1773
200 Ga0501075_0196026 3300049591 Bacteria 1540
201 Ga0501076_0025934 3300049592 Bacteria 4538
202 Ga0501079_0070065 3300049741 Bacteria 2707
203 Ga0501080_0099633 3300049742 Bacteria 2697
204 Ga0501081_0059429 3300049743 Unclassified 2647
205 Ga0501081_0110867 3300049743 Bacteria 1947
206 Ga0501081_0140805 3300049743 Bacteria 1729
207 nmdc:mga05p37_13296_c1 3300050507 Bacteria 9856
208 nmdc:mga05p37_15816_c1 3300050507 Bacteria 9074
209 nmdc:mga05p37_15_c1 3300050507 Bacteria 134650
210 nmdc:mga05p37_30546_c1 3300050507 Bacteria 6574
211 nmdc:mga05p37_3843_c1 3300050507 Bacteria 17563
212 nmdc:mga05p37_42748_c1 3300050507 Bacteria 5570
213 nmdc:mga05p37_4832_c1 3300050507 Bacteria 15759
214 nmdc:mga09592_186428_c1 3300050508 Bacteria 1795
215 nmdc:mga0qj67_144289_c1 3300050509 Bacteria 1930
216 nmdc:mga0qj67_162999_c1 3300050509 Bacteria 1810
217 nmdc:mga0qj67_39522_c1 3300050509 Bacteria 3705
218 nmdc:mga06r32_11723_c1 3300050510 Bacteria 7890
219 nmdc:mga06r32_209506_c1 3300050510 Bacteria 1937
220 nmdc:mga06r32_50743_c1 3300050510 Bacteria 3968
221 nmdc:mga08y16_176222_c1 3300050511 Bacteria 2220
222 nmdc:mga08y16_72218_c1 3300050511 Unclassified 3596
223 nmdc:mga08y16_7409_c1 3300050511 Bacteria 11496
224 nmdc:mga08y16_8160_c1 3300050511 Bacteria 10957
225 nmdc:mga0n895_30215_c1 3300050512 Bacteria 5175
226 nmdc:mga0n895_3898_c1 3300050512 Bacteria 12129
227 nmdc:mga0n895_42244_c1 3300050512 Bacteria 4435
228 nmdc:mga0n895_49548_c1 3300050512 Bacteria 4116
229 nmdc:mga0n895_722_c1 3300050512 Bacteria 23241
230 nmdc:mga0rr50_15110_c1 3300050513 Bacteria 5088
231 nmdc:mga0rr50_2_c1 3300050513 Bacteria 373938
232 nmdc:mga08x19_121612_c1 3300050514 Bacteria 1751
233 nmdc:mga08x19_49528_c1 3300050514 Bacteria 2694
234 nmdc:mga08x19_7255_c1 3300050514 Bacteria 6582
235 nmdc:mga08x19_76_c1 3300050514 Bacteria 92204
236 nmdc:mga08x19_8184_c1 3300050514 Bacteria 6214
237 nmdc:mga0a205_119677_c1 3300050515 Bacteria 2532
238 nmdc:mga0a205_141011_c1 3300050515 Bacteria 2310
239 nmdc:mga0a205_290940_c1 3300050515 Unclassified 1508
240 nmdc:mga0a205_29796_c1 3300050515 Bacteria 5222
241 nmdc:mga0a205_94568_c1 3300050515 Bacteria 2887
242 Ga0495619_0181922 3300053085 Unclassified 1454
243 Ga0501084_0059886 3300054114 Bacteria 3188
244 Ga0501082_0067846 3300060353 Bacteria 3072
245 Ga0501082_0105471 3300060353 Bacteria 2438
246 Ga0501082_0237117 3300060353 Bacteria 1588
247 Ga0530510_0005351 3300061734 Bacteria 8878
248 Ga0307410_10017521
249 Ga0065712_10013224
250 Ga0065712_10074231
251 Ga0065712_10087646
252 Ga0065715_10002860
253 Ga0065715_10003502
254 Ga0065707_10011362
255 Ga0070670_100008418
256 Ga0070666_10011436
257 Ga0070689_100112773
258 Ga0070687_100020975
259 Ga0070668_100053125
260 Ga0070669_100008526
261 Ga0070669_100031711
262 Ga0070669_100079112
263 Ga0070669_100198681
264 Ga0070675_100000320
265 Ga0070675_100151048
266 Ga0070675_100207920
267 Ga0070671_100001663
268 Ga0070674_100001413
269 Ga0070673_100019654
270 Ga0070688_100034123
271 Ga0070701_10040859
272 Ga0070705_100002441
273 Ga0070694_100001688
274 Ga0070694_100103890
275 Ga0070708_100056462
276 Ga0070662_100198423
277 Ga0068867_100002748
278 Ga0068867_100038888
279 Ga0070707_100098376
280 Ga0070698_100178334
281 Ga0070699_100036751
282 Ga0070699_100059924
283 Ga0070686_100000279
284 Ga0070686_100148648
285 Ga0070695_100002470
286 Ga0070695_100101442
287 Ga0070696_100002046
288 Ga0070696_100004702
289 Ga0070665_100006639
290 Ga0070704_100002438
291 Ga0070704_100045614
292 Ga0068854_100001918
293 Ga0068856_100198222
294 Ga0068852_100165371
295 Ga0068859_100386757
296 Ga0068864_100230258
297 Ga0068864_100294135
298 Ga0068861_100037114
299 Ga0068861_100138436
300 Ga0068863_100000525
301 Ga0068863_100126684
302 Ga0068863_100315373
303 Ga0068858_100007609
304 Ga0068862_100003344
305 Ga0068862_100020463
306 Ga0068862_100072593
307 Ga0081455_10019380
308 Ga0068871_100001766
309 Ga0068871_100057556
310 Ga0075428_100071549
311 Ga0075430_100006518
312 Ga0075430_100090222
313 Ga0075430_100195072
314 Ga0075431_100010228
315 Ga0075431_100014867
316 Ga0075431_100018060
317 Ga0075431_100109406
318 Ga0075433_10014426
319 Ga0075434_100000385
320 Ga0075434_100014091
321 Ga0075436_100000036
322 Ga0075436_100031838
323 Ga0075436_100116101
324 Ga0097620_100386750
325 Ga0075435_100000014
326 Ga0075435_100014474
327 Ga0075435_100017881
328 Ga0075435_100033458
329 Ga0075435_100071345
330 Ga0111539_10000411
331 Ga0111539_10000574
332 Ga0111539_10009024
333 Ga0111539_10016421
334 Ga0111539_10027457
335 Ga0111539_10105411
336 Ga0111539_10250349
337 Ga0105245_10227733
338 Ga0105247_10003148
339 Ga0114129_10000263
340 Ga0114129_10002820
341 Ga0114129_10022599
342 Ga0114129_10024144
343 Ga0114129_10048593
344 Ga0114129_10102965
345 Ga0114129_10134045
346 Ga0105243_10066096
347 Ga0105241_10112681
348 Ga0105248_10005812
349 Ga0105248_10010618
350 Ga0105248_10044616
351 Ga0105248_10211164
352 Ga0105249_10000910
353 Ga0163162_10022024
354 Ga0163162_10087517
355 Ga0163163_10011037
356 Ga0163163_10143122
357 Ga0163163_10167336
358 Ga0157380_10002137
359 Ga0157380_10083042
360 Ga0157379_10003932
361 Ga0207710_10008530
362 Ga0207645_10002227
363 Ga0207695_10177064
364 Ga0207681_10001621
365 Ga0207681_10058211
366 Ga0207681_10169354
367 Ga0207650_10092110
368 Ga0207650_10220916
369 Ga0207659_10003190
370 Ga0207644_10097249
371 Ga0207670_10079971
372 Ga0207669_10159212
373 Ga0207704_10005229
374 Ga0207704_10135359
375 Ga0207691_10028220
376 Ga0207711_10108939
377 Ga0207711_10186341
378 Ga0207651_10256768
379 Ga0207712_10001414
380 Ga0207668_10139969
381 Ga0207640_10002055
382 Ga0207703_10026193
383 Ga0207708_10003178
384 Ga0207708_10048127
385 Ga0207702_10235539
386 Ga0207641_10008183
387 Ga0207641_10118750
388 Ga0207648_10002234
389 Ga0207648_10227054
390 Ga0207676_10247366
391 Ga0207674_10069324
392 Ga0207675_100050652
393 Ga0207675_100063838
394 Ga0207675_100111035
395 Ga0207428_10000135
396 Ga0207428_10006019
397 Ga0268266_10058127
398 Ga0268265_10002407
399 Ga0268265_10008084
400 Ga0268264_10149822
401 Ga0307405_10250584
402 Ga0307410_10052734
403 Ga0307407_10001002
404 Ga0307409_100025976
405 Ga0307416_100208217
406 Ga0307411_10146153
407 Ga0373959_0000858
408 Ga0373940_0003168
409 Ga0373949_0000768
410 Ga0373951_0000221
411 Ga0373941_0000311
412 Ga0373960_0000808
413 Ga0373942_0000828
414 Ga0373961_0000405
415 Ga0373962_0006528
416 Ga0373925_0063714
417 Ga0451576_0249016
418 Ga0495592_0030895
419 Ga0495651_0048189
420 Ga0495580_0147623
421 Ga0495664_0064775
422 Ga0495608_0040435
423 Ga0495618_0147462
424 Ga0495586_0094156
425 Ga0495645_0020984
426 Ga0495667_0000918
427 Ga0495599_0018263
428 Ga0495623_0088327
429 Ga0495636_0023726
430 Ga0496102_0212930
431 Ga0496108_0001575
432 Ga0496112_0029712
433 Ga0496112_0054314
434 Ga0496113_0218943
435 Ga0501039_0098508
436 Ga0501039_0216044
437 Ga0501040_0009776
438 Ga0501041_0037257
439 Ga0501041_0078010
440 Ga0501048_0042948
441 Ga0501068_0086424
442 Ga0501071_0032293
443 Ga0501071_0063086
444 Ga0501072_0047522
445 Ga0501075_0007452
446 Ga0501075_0150684
447 Ga0501075_0196026
448 Ga0501076_0025934
449 Ga0501079_0070065
450 Ga0501080_0099633
451 Ga0501081_0059429
452 Ga0501081_0110867
453 Ga0501081_0140805
454 nmdc:mga05p37_13296_c1
455 nmdc:mga05p37_15816_c1
456 nmdc:mga05p37_15_c1
457 nmdc:mga05p37_30546_c1
458 nmdc:mga05p37_3843_c1
459 nmdc:mga05p37_42748_c1
460 nmdc:mga05p37_4832_c1
461 nmdc:mga09592_186428_c1
462 nmdc:mga0qj67_144289_c1
463 nmdc:mga0qj67_162999_c1
464 nmdc:mga0qj67_39522_c1
465 nmdc:mga06r32_11723_c1
466 nmdc:mga06r32_209506_c1
467 nmdc:mga06r32_50743_c1
468 nmdc:mga08y16_176222_c1
469 nmdc:mga08y16_72218_c1
470 nmdc:mga08y16_7409_c1
471 nmdc:mga08y16_8160_c1
472 nmdc:mga0n895_30215_c1
473 nmdc:mga0n895_3898_c1
474 nmdc:mga0n895_42244_c1
475 nmdc:mga0n895_49548_c1
476 nmdc:mga0n895_722_c1
477 nmdc:mga0rr50_15110_c1
478 nmdc:mga0rr50_2_c1
479 nmdc:mga08x19_121612_c1
480 nmdc:mga08x19_49528_c1
481 nmdc:mga08x19_7255_c1
482 nmdc:mga08x19_76_c1
483 nmdc:mga08x19_8184_c1
484 nmdc:mga0a205_119677_c1
485 nmdc:mga0a205_141011_c1
486 nmdc:mga0a205_290940_c1
487 nmdc:mga0a205_29796_c1
488 nmdc:mga0a205_94568_c1
489 Ga0495619_0181922
490 Ga0501084_0059886
491 Ga0501082_0067846
492 Ga0501082_0105471
493 Ga0501082_0237117
494 Ga0530510_0005351

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

94

431

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mtw-assembly1.cif.gz_A crystal structure of l-lysine, l-arginine carboxypeptidase cc2672 from caulobacter crescentus cb15 complexed with n-methyl phosphonate derivative of l-arginine 0.8697 29 423
3mkv-assembly1.cif.gz_G crystal structure of amidohydrolase eaj56179 0.8607 31 423
3feq-assembly2.cif.gz_J crystal structure of uncharacterized protein eah89906 0.8598 31 423
2qs8-assembly1.cif.gz_A crystal structure of a xaa-pro dipeptidase with bound methionine in the active site 0.8546 31 422
3feq-assembly2.cif.gz_P crystal structure of uncharacterized protein eah89906 0.8532 31 423
ID Description Score Start End Superfamily
3be7A01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9774 384 423 2.30.40.10
3gnhA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9048 31 86 2.30.40.10
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8947 31 85 2.30.40.10
2qs8B01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8779 30 86 2.30.40.10
4whbE01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8773 31 85 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A2V8G1U3-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9633 23 444 GO:0016810
AF-A0A2V8G1U3-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9544 23 444 GO:0016810
AF-A0A3N5Y770-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9427 67 441 GO:0016810
AF-A0A524LU89-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9373 10 414 GO:0016810
AF-A0A2S9XX13-F1-model_v4 Imidazolonepropionase (EC 3.5.2.7) 0.9361 32 423 GO:0050480

Map