F359193
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 247 | 143 | 247 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0348035|Ga0436365_0348035_327_872 |
| Length | 181 |
| Sequence | MADLHPDNPYAKDRFPDPNKTVEFPAEAKKRFDWILTRYPNKEAALLPVLHLAQEVWGWIAPETVMYISELLDLSPADVFGVVSFYNMYNQKPVGKYHLQVCTNLSCMVTNAYDIYDHLCAKLHVKPGETTPDGLYTVTEVECLGSCGTAPVVQINNDYHENMTIEKMDQILSVAKDPQRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 78 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 111 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 112 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 116 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 117 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 120 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 121 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 122 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 123 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 124 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 125 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 126 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 127 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 137 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 138 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 95.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24033J26618_1006415 | 3300002155 | Bacteria | 1319 |
| 2 | Ga0065707_10005506 | 3300005295 | Bacteria | 7178 |
| 3 | Ga0065707_10088243 | 3300005295 | Bacteria | 4726 |
| 4 | Ga0070658_10141514 | 3300005327 | Bacteria | 2010 |
| 5 | Ga0070676_10371349 | 3300005328 | Bacteria | 988 |
| 6 | Ga0070676_10377578 | 3300005328 | Bacteria | 981 |
| 7 | Ga0070683_100000009 | 3300005329 | Bacteria | 319830 |
| 8 | Ga0070690_100106907 | 3300005330 | Bacteria | 1862 |
| 9 | Ga0070690_100124010 | 3300005330 | Bacteria | 1737 |
| 10 | Ga0070670_100000131 | 3300005331 | Bacteria | 70778 |
| 11 | Ga0070670_100566115 | 3300005331 | Bacteria | 1015 |
| 12 | Ga0068869_100170765 | 3300005334 | Bacteria | 1699 |
| 13 | Ga0068869_100217217 | 3300005334 | Bacteria | 1514 |
| 14 | Ga0068869_101219019 | 3300005334 | Bacteria | 662 |
| 15 | Ga0070680_100033855 | 3300005336 | Bacteria | 4120 |
| 16 | Ga0070680_100465829 | 3300005336 | Bacteria | 1080 |
| 17 | Ga0070682_100000001 | 3300005337 | Bacteria | 569837 |
| 18 | Ga0068868_100000567 | 3300005338 | Bacteria | 24765 |
| 19 | Ga0068868_100001221 | 3300005338 | Bacteria | 17666 |
| 20 | Ga0070689_100001189 | 3300005340 | Bacteria | 16482 |
| 21 | Ga0070691_10349292 | 3300005341 | Bacteria | 821 |
| 22 | Ga0070687_100003080 | 3300005343 | Bacteria | 6412 |
| 23 | Ga0070687_100269464 | 3300005343 | Bacteria | 1067 |
| 24 | Ga0070692_10004903 | 3300005345 | Bacteria | 5636 |
| 25 | Ga0070692_10246516 | 3300005345 | Bacteria | 1067 |
| 26 | Ga0070675_100000002 | 3300005354 | Bacteria | 435215 |
| 27 | Ga0070675_100702848 | 3300005354 | Bacteria | 921 |
| 28 | Ga0070671_100174975 | 3300005355 | Bacteria | 1816 |
| 29 | Ga0070673_100679778 | 3300005364 | Bacteria | 944 |
| 30 | Ga0070709_10119535 | 3300005434 | Bacteria | 1784 |
| 31 | Ga0070709_10983074 | 3300005434 | Bacteria | 671 |
| 32 | Ga0070713_100084439 | 3300005436 | Bacteria | 2717 |
| 33 | Ga0070701_10000041 | 3300005438 | Bacteria | 32521 |
| 34 | Ga0070700_100000078 | 3300005441 | Bacteria | 65986 |
| 35 | Ga0070700_100640655 | 3300005441 | Bacteria | 838 |
| 36 | Ga0070708_100201579 | 3300005445 | Bacteria | 1863 |
| 37 | Ga0070708_100225838 | 3300005445 | Bacteria | 1757 |
| 38 | Ga0070706_100014358 | 3300005467 | Bacteria | 7319 |
| 39 | Ga0070706_100019016 | 3300005467 | Bacteria | 6336 |
| 40 | Ga0070706_100325670 | 3300005467 | Bacteria | 1433 |
| 41 | Ga0070706_100410899 | 3300005467 | Bacteria | 1260 |
| 42 | Ga0070706_100439222 | 3300005467 | Bacteria | 1215 |
| 43 | Ga0070707_100003590 | 3300005468 | Bacteria | 14633 |
| 44 | Ga0070707_100072469 | 3300005468 | Bacteria | 3320 |
| 45 | Ga0070707_100295667 | 3300005468 | Bacteria | 1573 |
| 46 | Ga0070707_100421072 | 3300005468 | Bacteria | 1296 |
| 47 | Ga0070698_100023320 | 3300005471 | Bacteria | 6470 |
| 48 | Ga0070698_100042595 | 3300005471 | Bacteria | 4657 |
| 49 | Ga0070698_100058967 | 3300005471 | Bacteria | 3879 |
| 50 | Ga0070698_100141805 | 3300005471 | Bacteria | 2354 |
| 51 | Ga0070699_100000025 | 3300005518 | Bacteria | 158245 |
| 52 | Ga0070699_100015993 | 3300005518 | Bacteria | 6441 |
| 53 | Ga0070699_100030413 | 3300005518 | Bacteria | 4661 |
| 54 | Ga0070699_100112665 | 3300005518 | Bacteria | 2389 |
| 55 | Ga0070699_100250089 | 3300005518 | Bacteria | 1583 |
| 56 | Ga0070679_100468585 | 3300005530 | Bacteria | 1204 |
| 57 | Ga0070684_100001071 | 3300005535 | Bacteria | 19605 |
| 58 | Ga0070697_100132381 | 3300005536 | Bacteria | 2092 |
| 59 | Ga0068853_100061216 | 3300005539 | Bacteria | 3255 |
| 60 | Ga0068853_100143337 | 3300005539 | Bacteria | 2146 |
| 61 | Ga0070672_100036961 | 3300005543 | Bacteria | 3724 |
| 62 | Ga0070686_100484561 | 3300005544 | Bacteria | 957 |
| 63 | Ga0070696_100133324 | 3300005546 | Bacteria | 1810 |
| 64 | Ga0070696_100960350 | 3300005546 | Bacteria | 712 |
| 65 | Ga0070693_100530633 | 3300005547 | Bacteria | 839 |
| 66 | Ga0068855_100913702 | 3300005563 | Unclassified | 927 |
| 67 | Ga0068857_100034902 | 3300005577 | Bacteria | 4450 |
| 68 | Ga0070702_100128689 | 3300005615 | Bacteria | 1596 |
| 69 | Ga0068859_101641838 | 3300005617 | Bacteria | 710 |
| 70 | Ga0068864_100000094 | 3300005618 | Bacteria | 92700 |
| 71 | Ga0068864_100376129 | 3300005618 | Bacteria | 1345 |
| 72 | Ga0068861_100610196 | 3300005719 | Bacteria | 1003 |
| 73 | Ga0068870_10247354 | 3300005840 | Bacteria | 1104 |
| 74 | Ga0068858_100001900 | 3300005842 | Bacteria | 21314 |
| 75 | Ga0070717_10000050 | 3300006028 | Bacteria | 103137 |
| 76 | Ga0070717_10778638 | 3300006028 | Bacteria | 870 |
| 77 | Ga0070717_11020230 | 3300006028 | Bacteria | 754 |
| 78 | Ga0075432_10244109 | 3300006058 | Unclassified | 726 |
| 79 | Ga0070716_100212487 | 3300006173 | Bacteria | 1294 |
| 80 | Ga0070716_100761671 | 3300006173 | Bacteria | 746 |
| 81 | Ga0097621_100540524 | 3300006237 | Bacteria | 1060 |
| 82 | Ga0068871_100821747 | 3300006358 | Bacteria | 858 |
| 83 | Ga0068871_101407197 | 3300006358 | Bacteria | 657 |
| 84 | Ga0075428_100001909 | 3300006844 | Bacteria | 22365 |
| 85 | Ga0075428_100075921 | 3300006844 | Bacteria | 3669 |
| 86 | Ga0075428_100308522 | 3300006844 | Bacteria | 1701 |
| 87 | Ga0075428_100381916 | 3300006844 | Bacteria | 1510 |
| 88 | Ga0075428_100542727 | 3300006844 | Bacteria | 1243 |
| 89 | Ga0075431_100004486 | 3300006847 | Bacteria | 13696 |
| 90 | Ga0075431_100231869 | 3300006847 | Bacteria | 1881 |
| 91 | Ga0075431_100923416 | 3300006847 | Bacteria | 842 |
| 92 | Ga0075433_10054116 | 3300006852 | Bacteria | 3501 |
| 93 | Ga0075433_10215636 | 3300006852 | Bacteria | 1705 |
| 94 | Ga0075434_100022220 | 3300006871 | Bacteria | 6179 |
| 95 | Ga0075434_100421554 | 3300006871 | Bacteria | 1356 |
| 96 | Ga0075429_100492254 | 3300006880 | Bacteria | 1074 |
| 97 | Ga0075436_100017040 | 3300006914 | Bacteria | 4973 |
| 98 | Ga0097620_101641692 | 3300006931 | Bacteria | 710 |
| 99 | Ga0075435_100000082 | 3300007076 | Bacteria | 50118 |
| 100 | Ga0075435_100194135 | 3300007076 | Bacteria | 1719 |
| 101 | Ga0075435_100240743 | 3300007076 | Bacteria | 1539 |
| 102 | Ga0105244_10087843 | 3300009036 | Bacteria | 1532 |
| 103 | Ga0111539_10000719 | 3300009094 | Bacteria | 43038 |
| 104 | Ga0111539_10001160 | 3300009094 | Bacteria | 34830 |
| 105 | Ga0111539_10318489 | 3300009094 | Unclassified | 1810 |
| 106 | Ga0105245_10000027 | 3300009098 | Bacteria | 162116 |
| 107 | Ga0105245_10000770 | 3300009098 | Bacteria | 29024 |
| 108 | Ga0105245_10000817 | 3300009098 | Bacteria | 28373 |
| 109 | Ga0105245_10316076 | 3300009098 | Bacteria | 1537 |
| 110 | Ga0114129_10085887 | 3300009147 | Bacteria | 4365 |
| 111 | Ga0114129_10136904 | 3300009147 | Bacteria | 3360 |
| 112 | Ga0114129_11245408 | 3300009147 | Bacteria | 924 |
| 113 | Ga0105243_10216203 | 3300009148 | Bacteria | 1691 |
| 114 | Ga0105242_10005722 | 3300009176 | Bacteria | 9584 |
| 115 | Ga0105238_10000118 | 3300009551 | Bacteria | 86809 |
| 116 | Ga0099796_10192969 | 3300010159 | Bacteria | 823 |
| 117 | Ga0105239_10232617 | 3300010375 | Bacteria | 2068 |
| 118 | Ga0105246_10395498 | 3300011119 | Bacteria | 1146 |
| 119 | Ga0105246_10628870 | 3300011119 | Bacteria | 931 |
| 120 | Ga0157371_10300380 | 3300013102 | Bacteria | 1162 |
| 121 | Ga0157369_10000123 | 3300013105 | Bacteria | 110823 |
| 122 | Ga0157374_10000019 | 3300013296 | Bacteria | 280543 |
| 123 | Ga0157378_10000588 | 3300013297 | Bacteria | 34092 |
| 124 | Ga0157378_10002365 | 3300013297 | Bacteria | 16757 |
| 125 | Ga0157378_10460622 | 3300013297 | Unclassified | 1263 |
| 126 | Ga0163162_10222894 | 3300013306 | Bacteria | 2015 |
| 127 | Ga0163162_10573976 | 3300013306 | Bacteria | 1255 |
| 128 | Ga0157372_10255627 | 3300013307 | Bacteria | 2034 |
| 129 | Ga0157372_10574737 | 3300013307 | Bacteria | 1314 |
| 130 | Ga0157375_10000001 | 3300013308 | Bacteria | 696576 |
| 131 | Ga0157375_10000026 | 3300013308 | Bacteria | 222518 |
| 132 | Ga0157375_10000768 | 3300013308 | Bacteria | 28121 |
| 133 | Ga0157380_10000970 | 3300014326 | Bacteria | 18177 |
| 134 | Ga0157377_10000110 | 3300014745 | Bacteria | 56152 |
| 135 | Ga0157377_10000126 | 3300014745 | Bacteria | 49710 |
| 136 | Ga0157377_10073551 | 3300014745 | Bacteria | 1981 |
| 137 | Ga0157377_11067219 | 3300014745 | Bacteria | 616 |
| 138 | Ga0157376_10000011 | 3300014969 | Bacteria | 307434 |
| 139 | Ga0213873_10000002 | 3300021358 | Bacteria | 1164195 |
| 140 | Ga0213873_10001213 | 3300021358 | Bacteria | 4235 |
| 141 | Ga0213876_10000001 | 3300021384 | Bacteria | 1186326 |
| 142 | Ga0213876_10000070 | 3300021384 | Bacteria | 123986 |
| 143 | Ga0213876_10040072 | 3300021384 | Bacteria | 2474 |
| 144 | Ga0207655_1057313 | 3300025728 | Bacteria | 1530 |
| 145 | Ga0207699_10698344 | 3300025906 | Bacteria | 742 |
| 146 | Ga0207645_10347868 | 3300025907 | Bacteria | 992 |
| 147 | Ga0207643_10235565 | 3300025908 | Bacteria | 1124 |
| 148 | Ga0207684_10015086 | 3300025910 | Bacteria | 6652 |
| 149 | Ga0207684_10379875 | 3300025910 | Bacteria | 1215 |
| 150 | Ga0207684_11106459 | 3300025910 | Unclassified | 659 |
| 151 | Ga0207695_10014001 | 3300025913 | Bacteria | 9525 |
| 152 | Ga0207660_10012081 | 3300025917 | Bacteria | 5644 |
| 153 | Ga0207662_10006035 | 3300025918 | Bacteria | 6511 |
| 154 | Ga0207662_10413544 | 3300025918 | Bacteria | 917 |
| 155 | Ga0207646_10025707 | 3300025922 | Bacteria | 5384 |
| 156 | Ga0207646_10051261 | 3300025922 | Bacteria | 3693 |
| 157 | Ga0207646_10145985 | 3300025922 | Bacteria | 2132 |
| 158 | Ga0207646_10309674 | 3300025922 | Bacteria | 1427 |
| 159 | Ga0207681_10811495 | 3300025923 | Bacteria | 782 |
| 160 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 161 | Ga0207650_10000021 | 3300025925 | Bacteria | 322394 |
| 162 | Ga0207659_10000005 | 3300025926 | Bacteria | 405839 |
| 163 | Ga0207687_10000006 | 3300025927 | Bacteria | 641680 |
| 164 | Ga0207687_10001964 | 3300025927 | Bacteria | 14156 |
| 165 | Ga0207687_10003989 | 3300025927 | Bacteria | 9891 |
| 166 | Ga0207700_10071454 | 3300025928 | Bacteria | 2672 |
| 167 | Ga0207644_10263330 | 3300025931 | Bacteria | 1379 |
| 168 | Ga0207686_10026570 | 3300025934 | Bacteria | 3379 |
| 169 | Ga0207670_10033876 | 3300025936 | Bacteria | 3295 |
| 170 | Ga0207665_10148288 | 3300025939 | Bacteria | 1678 |
| 171 | Ga0207665_10333270 | 3300025939 | Bacteria | 1142 |
| 172 | Ga0207691_10051872 | 3300025940 | Bacteria | 3748 |
| 173 | Ga0207689_10023155 | 3300025942 | Bacteria | 5215 |
| 174 | Ga0207661_10000007 | 3300025944 | Bacteria | 471636 |
| 175 | Ga0207651_10364283 | 3300025960 | Bacteria | 1221 |
| 176 | Ga0207677_10000090 | 3300026023 | Bacteria | 74352 |
| 177 | Ga0207677_10000126 | 3300026023 | Bacteria | 63024 |
| 178 | Ga0207703_10000099 | 3300026035 | Bacteria | 103567 |
| 179 | Ga0207639_10000003 | 3300026041 | Bacteria | 806887 |
| 180 | Ga0207708_10000018 | 3300026075 | Bacteria | 188140 |
| 181 | Ga0207676_10000063 | 3300026095 | Bacteria | 110993 |
| 182 | Ga0207676_10186817 | 3300026095 | Bacteria | 1820 |
| 183 | Ga0207674_10094920 | 3300026116 | Bacteria | 2969 |
| 184 | Ga0207674_10539170 | 3300026116 | Bacteria | 1127 |
| 185 | Ga0207674_10935195 | 3300026116 | Bacteria | 835 |
| 186 | Ga0207675_100307159 | 3300026118 | Bacteria | 1546 |
| 187 | Ga0207675_100424589 | 3300026118 | Bacteria | 1313 |
| 188 | Ga0207683_10321911 | 3300026121 | Bacteria | 1416 |
| 189 | Ga0207428_10000332 | 3300027907 | Bacteria | 61283 |
| 190 | Ga0207428_10697703 | 3300027907 | Unclassified | 726 |
| 191 | Ga0307511_10004854 | 3300030521 | Bacteria | 13743 |
| 192 | Ga0265320_10024904 | 3300031240 | Bacteria | 3154 |
| 193 | Ga0307413_10742003 | 3300031824 | Bacteria | 820 |
| 194 | Ga0307412_10998591 | 3300031911 | Bacteria | 739 |
| 195 | Ga0307416_100775805 | 3300032002 | Bacteria | 1053 |
| 196 | Ga0316583_10121863 | 3300032133 | Bacteria | 909 |
| 197 | Ga0373932_0001703 | 3300035112 | Bacteria | 5979 |
| 198 | Ga0373941_0026059 | 3300035115 | Bacteria | 1695 |
| 199 | Ga0436364_0561061 | 3300037853 | Bacteria | 2343 |
| 200 | Ga0436365_0232456 | 3300039437 | Bacteria | 39991 |
| 201 | Ga0436365_0348035 | 3300039437 | Bacteria | 973 |
| 202 | Ga0436365_0774883 | 3300039437 | Bacteria | 390569 |
| 203 | Ga0436365_0840677 | 3300039437 | Bacteria | 2415 |
| 204 | Ga0436365_0955099 | 3300039437 | Bacteria | 933 |
| 205 | Ga0436363_0992958 | 3300039450 | Bacteria | 1536 |
| 206 | Ga0436362_0660519 | 3300039453 | Bacteria | 832172 |
| 207 | Ga0436362_0736466 | 3300039453 | Bacteria | 11594 |
| 208 | Ga0451839_0534098 | 3300041496 | Bacteria | 1712 |
| 209 | Ga0451577_0001342 | 3300042876 | Bacteria | 33389 |
| 210 | Ga0451577_0191327 | 3300042876 | Bacteria | 1846 |
| 211 | Ga0453683_0058509 | 3300044673 | Bacteria | 2411 |
| 212 | Ga0453683_0093433 | 3300044673 | Bacteria | 1886 |
| 213 | Ga0466963_0358136 | 3300044694 | Bacteria | 1028 |
| 214 | Ga0453684_0000949 | 3300044712 | Bacteria | 95680 |
| 215 | Ga0466957_0535985 | 3300044842 | Unclassified | 815 |
| 216 | Ga0451576_0088882 | 3300045051 | Bacteria | 3213 |
| 217 | Ga0451576_0603469 | 3300045051 | Bacteria | 1154 |
| 218 | Ga0451576_0631368 | 3300045051 | Bacteria | 1126 |
| 219 | Ga0495620_0017507 | 3300046515 | Bacteria | 3570 |
| 220 | Ga0495598_0051417 | 3300046537 | Bacteria | 1242 |
| 221 | Ga0495679_014845 | 3300047446 | Bacteria | 2869 |
| 222 | Ga0501073_0004246 | 3300049589 | Bacteria | 10743 |
| 223 | Ga0501077_0318296 | 3300049593 | Bacteria | 992 |
| 224 | Ga0501080_0107210 | 3300049742 | Bacteria | 2589 |
| 225 | nmdc:mga05p37_665903_c1 | 3300050507 | Unclassified | 1163 |
| 226 | nmdc:mga05p37_979531_c1 | 3300050507 | Bacteria | 901 |
| 227 | nmdc:mga09592_1097967_c1 | 3300050508 | Unclassified | 661 |
| 228 | nmdc:mga09592_266327_c1 | 3300050508 | Bacteria | 1486 |
| 229 | nmdc:mga09592_354814_c1 | 3300050508 | Bacteria | 1269 |
| 230 | nmdc:mga06r32_1590232_c1 | 3300050510 | Unclassified | 592 |
| 231 | nmdc:mga06r32_207087_c1 | 3300050510 | Bacteria | 1949 |
| 232 | nmdc:mga06r32_2659_c1 | 3300050510 | Bacteria | 15972 |
| 233 | nmdc:mga08y16_29565_c1 | 3300050511 | Bacteria | 5772 |
| 234 | nmdc:mga08y16_52_c1 | 3300050511 | Bacteria | 104128 |
| 235 | nmdc:mga08y16_605172_c1 | 3300050511 | Bacteria | 1104 |
| 236 | nmdc:mga0n895_289498_c1 | 3300050512 | Bacteria | 1661 |
| 237 | nmdc:mga0n895_438729_c1 | 3300050512 | Bacteria | 1319 |
| 238 | nmdc:mga0n895_666652_c1 | 3300050512 | Bacteria | 1038 |
| 239 | nmdc:mga0rr50_103190_c1 | 3300050513 | Bacteria | 2244 |
| 240 | nmdc:mga0rr50_123442_c1 | 3300050513 | Bacteria | 2064 |
| 241 | nmdc:mga0rr50_158844_c1 | 3300050513 | Bacteria | 1833 |
| 242 | nmdc:mga0rr50_48_c1 | 3300050513 | Bacteria | 67747 |
| 243 | nmdc:mga08x19_11435_c1 | 3300050514 | Bacteria | 5342 |
| 244 | nmdc:mga08x19_228041_c1 | 3300050514 | Bacteria | 1281 |
| 245 | nmdc:mga0a205_198680_c1 | 3300050515 | Bacteria | 1896 |
| 246 | nmdc:mga0a205_65846_c1 | 3300050515 | Bacteria | 3501 |
| 247 | nmdc:mga0a205_7887_c1 | 3300050515 | Bacteria | 9667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005563 | Ga0068855_100913702 | Ga0068855_1009137021 | 154 |
| 2 | 3300005617 | Ga0068859_101641838 | Ga0068859_1016418382 | 154 |
| 3 | 3300005618 | Ga0068864_100376129 | Ga0068864_1003761292 | 154 |
| 4 | 3300006931 | Ga0097620_101641692 | Ga0097620_1016416922 | 154 |
| 5 | 3300026095 | Ga0207676_10186817 | Ga0207676_101868172 | 154 |
| 6 | 3300005295 | Ga0065707_10005506 | Ga0065707_100055067 | 155 |
| 7 | 3300005471 | Ga0070698_100023320 | Ga0070698_1000233204 | 155 |
| 8 | 3300005518 | Ga0070699_100000025 | Ga0070699_1000000259 | 155 |
| 9 | 3300005518 | Ga0070699_100112665 | Ga0070699_1001126652 | 155 |
| 10 | 3300006852 | Ga0075433_10054116 | Ga0075433_100541162 | 155 |
| 11 | 3300006852 | Ga0075433_10215636 | Ga0075433_102156362 | 155 |
| 12 | 3300006871 | Ga0075434_100022220 | Ga0075434_1000222206 | 155 |
| 13 | 3300007076 | Ga0075435_100240743 | Ga0075435_1002407432 | 155 |
| 14 | 3300009147 | Ga0114129_11245408 | Ga0114129_112454082 | 155 |
| 15 | 3300044673 | Ga0453683_0058509 | Ga0453683_0058509_719_1186 | 155 |
| 16 | 3300045051 | Ga0451576_0088882 | Ga0451576_0088882_1738_2205 | 155 |
| 17 | 3300050507 | nmdc:mga05p37_979531_c1 | nmdc:mga05p37_979531_c1_240_707 | 155 |
| 18 | 3300050510 | nmdc:mga06r32_1590232_c1 | nmdc:mga06r32_1590232_c1_43_510 | 155 |
| 19 | 3300050512 | nmdc:mga0n895_289498_c1 | nmdc:mga0n895_289498_c1_455_922 | 155 |
| 20 | 3300050513 | nmdc:mga0rr50_158844_c1 | nmdc:mga0rr50_158844_c1_352_819 | 155 |
| 21 | 3300050515 | nmdc:mga0a205_65846_c1 | nmdc:mga0a205_65846_c1_2821_3288 | 155 |
| 22 | 3300050515 | nmdc:mga0a205_7887_c1 | nmdc:mga0a205_7887_c1_4866_5333 | 155 |
| 23 | 3300006844 | Ga0075428_100308522 | Ga0075428_1003085221 | 156 |
| 24 | 3300005467 | Ga0070706_100439222 | Ga0070706_1004392221 | 157 |
| 25 | 3300006058 | Ga0075432_10244109 | Ga0075432_102441092 | 157 |
| 26 | 3300006844 | Ga0075428_100381916 | Ga0075428_1003819161 | 157 |
| 27 | 3300006847 | Ga0075431_100923416 | Ga0075431_1009234162 | 157 |
| 28 | 3300009094 | Ga0111539_10318489 | Ga0111539_103184892 | 157 |
| 29 | 3300009147 | Ga0114129_10085887 | Ga0114129_100858875 | 157 |
| 30 | 3300027907 | Ga0207428_10697703 | Ga0207428_106977031 | 157 |
| 31 | 3300050508 | nmdc:mga09592_1097967_c1 | nmdc:mga09592_1097967_c1_35_517 | 157 |
| 32 | 3300050511 | nmdc:mga08y16_605172_c1 | nmdc:mga08y16_605172_c1_48_530 | 157 |
| 33 | 3300050513 | nmdc:mga0rr50_123442_c1 | nmdc:mga0rr50_123442_c1_1511_1993 | 157 |
| 34 | 3300050515 | nmdc:mga0a205_198680_c1 | nmdc:mga0a205_198680_c1_786_1268 | 157 |
| 35 | 3300006844 | Ga0075428_100001909 | Ga0075428_10000190925 | 163 |
| 36 | 3300009094 | Ga0111539_10000719 | Ga0111539_1000071928 | 163 |
| 37 | 3300027907 | Ga0207428_10000332 | Ga0207428_1000033243 | 163 |
| 38 | 3300050511 | nmdc:mga08y16_52_c1 | nmdc:mga08y16_52_c1_91391_91921 | 163 |
| 39 | 3300006847 | Ga0075431_100231869 | Ga0075431_1002318692 | 164 |
| 40 | 3300031240 | Ga0265320_10024904 | Ga0265320_100249042 | 164 |
| 41 | 3300050508 | nmdc:mga09592_354814_c1 | nmdc:mga09592_354814_c1_533_1063 | 164 |
| 42 | 3300050510 | nmdc:mga06r32_207087_c1 | nmdc:mga06r32_207087_c1_238_768 | 164 |
| 43 | 3300006844 | Ga0075428_100075921 | Ga0075428_1000759213 | 168 |
| 44 | 3300006880 | Ga0075429_100492254 | Ga0075429_1004922542 | 168 |
| 45 | 3300009094 | Ga0111539_10001160 | Ga0111539_1000116018 | 168 |
| 46 | 3300050508 | nmdc:mga09592_266327_c1 | nmdc:mga09592_266327_c1_429_944 | 168 |
| 47 | 3300050511 | nmdc:mga08y16_29565_c1 | nmdc:mga08y16_29565_c1_1850_2365 | 168 |
| 48 | 3300005354 | Ga0070675_100702848 | Ga0070675_1007028482 | 175 |
| 49 | 3300005364 | Ga0070673_100679778 | Ga0070673_1006797782 | 175 |
| 50 | 3300025960 | Ga0207651_10364283 | Ga0207651_103642832 | 175 |
| 51 | 3300002155 | JGI24033J26618_1006415 | JGI24033J26618_10064151 | 176 |
| 52 | 3300005295 | Ga0065707_10088243 | Ga0065707_100882438 | 176 |
| 53 | 3300005327 | Ga0070658_10141514 | Ga0070658_101415142 | 176 |
| 54 | 3300005328 | Ga0070676_10371349 | Ga0070676_103713491 | 176 |
| 55 | 3300005328 | Ga0070676_10377578 | Ga0070676_103775781 | 176 |
| 56 | 3300005329 | Ga0070683_100000009 | Ga0070683_10000000940 | 176 |
| 57 | 3300005330 | Ga0070690_100106907 | Ga0070690_1001069072 | 176 |
| 58 | 3300005330 | Ga0070690_100124010 | Ga0070690_1001240102 | 176 |
| 59 | 3300005331 | Ga0070670_100000131 | Ga0070670_10000013116 | 176 |
| 60 | 3300005331 | Ga0070670_100566115 | Ga0070670_1005661151 | 176 |
| 61 | 3300005334 | Ga0068869_100170765 | Ga0068869_1001707652 | 176 |
| 62 | 3300005334 | Ga0068869_100217217 | Ga0068869_1002172172 | 176 |
| 63 | 3300005334 | Ga0068869_101219019 | Ga0068869_1012190191 | 176 |
| 64 | 3300005336 | Ga0070680_100033855 | Ga0070680_1000338555 | 176 |
| 65 | 3300005336 | Ga0070680_100465829 | Ga0070680_1004658292 | 176 |
| 66 | 3300005337 | Ga0070682_100000001 | Ga0070682_10000000190 | 176 |
| 67 | 3300005338 | Ga0068868_100000567 | Ga0068868_10000056724 | 176 |
| 68 | 3300005338 | Ga0068868_100001221 | Ga0068868_10000122118 | 176 |
| 69 | 3300005340 | Ga0070689_100001189 | Ga0070689_10000118913 | 176 |
| 70 | 3300005341 | Ga0070691_10349292 | Ga0070691_103492921 | 176 |
| 71 | 3300005343 | Ga0070687_100003080 | Ga0070687_1000030803 | 176 |
| 72 | 3300005343 | Ga0070687_100269464 | Ga0070687_1002694641 | 176 |
| 73 | 3300005345 | Ga0070692_10004903 | Ga0070692_100049033 | 176 |
| 74 | 3300005345 | Ga0070692_10246516 | Ga0070692_102465161 | 176 |
| 75 | 3300005354 | Ga0070675_100000002 | Ga0070675_100000002244 | 176 |
| 76 | 3300005355 | Ga0070671_100174975 | Ga0070671_1001749753 | 176 |
| 77 | 3300005434 | Ga0070709_10119535 | Ga0070709_101195352 | 176 |
| 78 | 3300005434 | Ga0070709_10983074 | Ga0070709_109830742 | 176 |
| 79 | 3300005436 | Ga0070713_100084439 | Ga0070713_1000844392 | 176 |
| 80 | 3300005438 | Ga0070701_10000041 | Ga0070701_1000004129 | 176 |
| 81 | 3300005441 | Ga0070700_100000078 | Ga0070700_10000007857 | 176 |
| 82 | 3300005441 | Ga0070700_100640655 | Ga0070700_1006406552 | 176 |
| 83 | 3300005445 | Ga0070708_100201579 | Ga0070708_1002015792 | 176 |
| 84 | 3300005445 | Ga0070708_100225838 | Ga0070708_1002258382 | 176 |
| 85 | 3300005467 | Ga0070706_100014358 | Ga0070706_1000143589 | 176 |
| 86 | 3300005467 | Ga0070706_100019016 | Ga0070706_1000190161 | 176 |
| 87 | 3300005467 | Ga0070706_100325670 | Ga0070706_1003256702 | 176 |
| 88 | 3300005467 | Ga0070706_100410899 | Ga0070706_1004108992 | 176 |
| 89 | 3300005468 | Ga0070707_100003590 | Ga0070707_10000359013 | 176 |
| 90 | 3300005468 | Ga0070707_100072469 | Ga0070707_1000724695 | 176 |
| 91 | 3300005468 | Ga0070707_100295667 | Ga0070707_1002956671 | 176 |
| 92 | 3300005468 | Ga0070707_100421072 | Ga0070707_1004210723 | 176 |
| 93 | 3300005471 | Ga0070698_100042595 | Ga0070698_1000425952 | 176 |
| 94 | 3300005471 | Ga0070698_100058967 | Ga0070698_1000589675 | 176 |
| 95 | 3300005471 | Ga0070698_100141805 | Ga0070698_1001418052 | 176 |
| 96 | 3300005518 | Ga0070699_100015993 | Ga0070699_1000159936 | 176 |
| 97 | 3300005518 | Ga0070699_100030413 | Ga0070699_1000304135 | 176 |
| 98 | 3300005518 | Ga0070699_100250089 | Ga0070699_1002500892 | 176 |
| 99 | 3300005530 | Ga0070679_100468585 | Ga0070679_1004685852 | 176 |
| 100 | 3300005535 | Ga0070684_100001071 | Ga0070684_10000107112 | 176 |
| 101 | 3300005536 | Ga0070697_100132381 | Ga0070697_1001323814 | 176 |
| 102 | 3300005539 | Ga0068853_100061216 | Ga0068853_1000612163 | 176 |
| 103 | 3300005539 | Ga0068853_100143337 | Ga0068853_1001433373 | 176 |
| 104 | 3300005543 | Ga0070672_100036961 | Ga0070672_1000369615 | 176 |
| 105 | 3300005544 | Ga0070686_100484561 | Ga0070686_1004845611 | 176 |
| 106 | 3300005546 | Ga0070696_100133324 | Ga0070696_1001333242 | 176 |
| 107 | 3300005546 | Ga0070696_100960350 | Ga0070696_1009603501 | 176 |
| 108 | 3300005547 | Ga0070693_100530633 | Ga0070693_1005306332 | 176 |
| 109 | 3300005577 | Ga0068857_100034902 | Ga0068857_1000349027 | 176 |
| 110 | 3300005615 | Ga0070702_100128689 | Ga0070702_1001286892 | 176 |
| 111 | 3300005618 | Ga0068864_100000094 | Ga0068864_1000000942 | 176 |
| 112 | 3300005719 | Ga0068861_100610196 | Ga0068861_1006101962 | 176 |
| 113 | 3300005840 | Ga0068870_10247354 | Ga0068870_102473542 | 176 |
| 114 | 3300005842 | Ga0068858_100001900 | Ga0068858_1000019008 | 176 |
| 115 | 3300006028 | Ga0070717_10000050 | Ga0070717_1000005084 | 176 |
| 116 | 3300006028 | Ga0070717_10778638 | Ga0070717_107786382 | 176 |
| 117 | 3300006028 | Ga0070717_11020230 | Ga0070717_110202301 | 176 |
| 118 | 3300006173 | Ga0070716_100212487 | Ga0070716_1002124872 | 176 |
| 119 | 3300006173 | Ga0070716_100761671 | Ga0070716_1007616711 | 176 |
| 120 | 3300006237 | Ga0097621_100540524 | Ga0097621_1005405242 | 176 |
| 121 | 3300006358 | Ga0068871_100821747 | Ga0068871_1008217471 | 176 |
| 122 | 3300006358 | Ga0068871_101407197 | Ga0068871_1014071971 | 176 |
| 123 | 3300006844 | Ga0075428_100542727 | Ga0075428_1005427272 | 176 |
| 124 | 3300006847 | Ga0075431_100004486 | Ga0075431_10000448619 | 176 |
| 125 | 3300006871 | Ga0075434_100421554 | Ga0075434_1004215543 | 176 |
| 126 | 3300006914 | Ga0075436_100017040 | Ga0075436_1000170406 | 176 |
| 127 | 3300007076 | Ga0075435_100000082 | Ga0075435_10000008250 | 176 |
| 128 | 3300007076 | Ga0075435_100194135 | Ga0075435_1001941352 | 176 |
| 129 | 3300009036 | Ga0105244_10087843 | Ga0105244_100878432 | 176 |
| 130 | 3300009098 | Ga0105245_10000027 | Ga0105245_10000027132 | 176 |
| 131 | 3300009098 | Ga0105245_10000770 | Ga0105245_1000077016 | 176 |
| 132 | 3300009098 | Ga0105245_10000817 | Ga0105245_1000081714 | 176 |
| 133 | 3300009098 | Ga0105245_10316076 | Ga0105245_103160763 | 176 |
| 134 | 3300009147 | Ga0114129_10136904 | Ga0114129_101369042 | 176 |
| 135 | 3300009148 | Ga0105243_10216203 | Ga0105243_102162032 | 176 |
| 136 | 3300009176 | Ga0105242_10005722 | Ga0105242_1000572211 | 176 |
| 137 | 3300009551 | Ga0105238_10000118 | Ga0105238_1000011830 | 176 |
| 138 | 3300010159 | Ga0099796_10192969 | Ga0099796_101929692 | 176 |
| 139 | 3300010375 | Ga0105239_10232617 | Ga0105239_102326173 | 176 |
| 140 | 3300011119 | Ga0105246_10395498 | Ga0105246_103954982 | 176 |
| 141 | 3300011119 | Ga0105246_10628870 | Ga0105246_106288702 | 176 |
| 142 | 3300013102 | Ga0157371_10300380 | Ga0157371_103003801 | 176 |
| 143 | 3300013105 | Ga0157369_10000123 | Ga0157369_1000012375 | 176 |
| 144 | 3300013296 | Ga0157374_10000019 | Ga0157374_1000001955 | 176 |
| 145 | 3300013297 | Ga0157378_10000588 | Ga0157378_1000058811 | 176 |
| 146 | 3300013297 | Ga0157378_10002365 | Ga0157378_100023653 | 176 |
| 147 | 3300013297 | Ga0157378_10460622 | Ga0157378_104606223 | 176 |
| 148 | 3300013306 | Ga0163162_10222894 | Ga0163162_102228942 | 176 |
| 149 | 3300013306 | Ga0163162_10573976 | Ga0163162_105739762 | 176 |
| 150 | 3300013307 | Ga0157372_10255627 | Ga0157372_102556272 | 176 |
| 151 | 3300013307 | Ga0157372_10574737 | Ga0157372_105747373 | 176 |
| 152 | 3300013308 | Ga0157375_10000001 | Ga0157375_10000001277 | 176 |
| 153 | 3300013308 | Ga0157375_10000026 | Ga0157375_10000026139 | 176 |
| 154 | 3300013308 | Ga0157375_10000768 | Ga0157375_100007683 | 176 |
| 155 | 3300014326 | Ga0157380_10000970 | Ga0157380_1000097015 | 176 |
| 156 | 3300014745 | Ga0157377_10000110 | Ga0157377_100001102 | 176 |
| 157 | 3300014745 | Ga0157377_10000126 | Ga0157377_1000012623 | 176 |
| 158 | 3300014745 | Ga0157377_10073551 | Ga0157377_100735512 | 176 |
| 159 | 3300014745 | Ga0157377_11067219 | Ga0157377_110672191 | 176 |
| 160 | 3300014969 | Ga0157376_10000011 | Ga0157376_10000011162 | 176 |
| 161 | 3300021358 | Ga0213873_10000002 | Ga0213873_10000002578 | 176 |
| 162 | 3300021358 | Ga0213873_10001213 | Ga0213873_100012136 | 176 |
| 163 | 3300021384 | Ga0213876_10000001 | Ga0213876_10000001661 | 176 |
| 164 | 3300021384 | Ga0213876_10000070 | Ga0213876_1000007088 | 176 |
| 165 | 3300021384 | Ga0213876_10040072 | Ga0213876_100400722 | 176 |
| 166 | 3300025728 | Ga0207655_1057313 | Ga0207655_10573132 | 176 |
| 167 | 3300025906 | Ga0207699_10698344 | Ga0207699_106983441 | 176 |
| 168 | 3300025907 | Ga0207645_10347868 | Ga0207645_103478682 | 176 |
| 169 | 3300025908 | Ga0207643_10235565 | Ga0207643_102355652 | 176 |
| 170 | 3300025910 | Ga0207684_10015086 | Ga0207684_100150868 | 176 |
| 171 | 3300025910 | Ga0207684_10379875 | Ga0207684_103798752 | 176 |
| 172 | 3300025910 | Ga0207684_11106459 | Ga0207684_111064591 | 176 |
| 173 | 3300025913 | Ga0207695_10014001 | Ga0207695_100140015 | 176 |
| 174 | 3300025917 | Ga0207660_10012081 | Ga0207660_100120813 | 176 |
| 175 | 3300025918 | Ga0207662_10006035 | Ga0207662_100060357 | 176 |
| 176 | 3300025918 | Ga0207662_10413544 | Ga0207662_104135442 | 176 |
| 177 | 3300025922 | Ga0207646_10025707 | Ga0207646_100257072 | 176 |
| 178 | 3300025922 | Ga0207646_10051261 | Ga0207646_100512615 | 176 |
| 179 | 3300025922 | Ga0207646_10145985 | Ga0207646_101459854 | 176 |
| 180 | 3300025922 | Ga0207646_10309674 | Ga0207646_103096742 | 176 |
| 181 | 3300025923 | Ga0207681_10811495 | Ga0207681_108114952 | 176 |
| 182 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001978 | 176 |
| 183 | 3300025925 | Ga0207650_10000021 | Ga0207650_10000021166 | 176 |
| 184 | 3300025926 | Ga0207659_10000005 | Ga0207659_10000005285 | 176 |
| 185 | 3300025927 | Ga0207687_10000006 | Ga0207687_10000006450 | 176 |
| 186 | 3300025927 | Ga0207687_10001964 | Ga0207687_100019643 | 176 |
| 187 | 3300025927 | Ga0207687_10003989 | Ga0207687_100039893 | 176 |
| 188 | 3300025928 | Ga0207700_10071454 | Ga0207700_100714545 | 176 |
| 189 | 3300025931 | Ga0207644_10263330 | Ga0207644_102633303 | 176 |
| 190 | 3300025934 | Ga0207686_10026570 | Ga0207686_100265704 | 176 |
| 191 | 3300025936 | Ga0207670_10033876 | Ga0207670_100338763 | 176 |
| 192 | 3300025939 | Ga0207665_10148288 | Ga0207665_101482883 | 176 |
| 193 | 3300025939 | Ga0207665_10333270 | Ga0207665_103332702 | 176 |
| 194 | 3300025940 | Ga0207691_10051872 | Ga0207691_100518722 | 176 |
| 195 | 3300025942 | Ga0207689_10023155 | Ga0207689_100231552 | 176 |
| 196 | 3300025944 | Ga0207661_10000007 | Ga0207661_10000007406 | 176 |
| 197 | 3300026023 | Ga0207677_10000090 | Ga0207677_1000009045 | 176 |
| 198 | 3300026023 | Ga0207677_10000126 | Ga0207677_100001268 | 176 |
| 199 | 3300026035 | Ga0207703_10000099 | Ga0207703_100000999 | 176 |
| 200 | 3300026041 | Ga0207639_10000003 | Ga0207639_10000003326 | 176 |
| 201 | 3300026075 | Ga0207708_10000018 | Ga0207708_1000001858 | 176 |
| 202 | 3300026095 | Ga0207676_10000063 | Ga0207676_100000633 | 176 |
| 203 | 3300026116 | Ga0207674_10094920 | Ga0207674_100949202 | 176 |
| 204 | 3300026116 | Ga0207674_10539170 | Ga0207674_105391702 | 176 |
| 205 | 3300026116 | Ga0207674_10935195 | Ga0207674_109351952 | 176 |
| 206 | 3300026118 | Ga0207675_100307159 | Ga0207675_1003071592 | 176 |
| 207 | 3300026118 | Ga0207675_100424589 | Ga0207675_1004245892 | 176 |
| 208 | 3300026121 | Ga0207683_10321911 | Ga0207683_103219112 | 176 |
| 209 | 3300030521 | Ga0307511_10004854 | Ga0307511_100048545 | 176 |
| 210 | 3300031824 | Ga0307413_10742003 | Ga0307413_107420031 | 176 |
| 211 | 3300031911 | Ga0307412_10998591 | Ga0307412_109985912 | 176 |
| 212 | 3300032002 | Ga0307416_100775805 | Ga0307416_1007758052 | 176 |
| 213 | 3300032133 | Ga0316583_10121863 | Ga0316583_101218631 | 176 |
| 214 | 3300035112 | Ga0373932_0001703 | Ga0373932_0001703_4642_5172 | 176 |
| 215 | 3300035115 | Ga0373941_0026059 | Ga0373941_0026059_907_1437 | 176 |
| 216 | 3300037853 | Ga0436364_0561061 | Ga0436364_0561061_1006_1536 | 176 |
| 217 | 3300039437 | Ga0436365_0232456 | Ga0436365_0232456_4737_5267 | 176 |
| 218 | 3300039437 | Ga0436365_0348035 | Ga0436365_0348035_327_872 | 176 |
| 219 | 3300039437 | Ga0436365_0774883 | Ga0436365_0774883_134051_134581 | 176 |
| 220 | 3300039437 | Ga0436365_0840677 | Ga0436365_0840677_1284_1814 | 176 |
| 221 | 3300039437 | Ga0436365_0955099 | Ga0436365_0955099_249_779 | 176 |
| 222 | 3300039450 | Ga0436363_0992958 | Ga0436363_0992958_171_701 | 176 |
| 223 | 3300039453 | Ga0436362_0660519 | Ga0436362_0660519_348700_349230 | 176 |
| 224 | 3300039453 | Ga0436362_0736466 | Ga0436362_0736466_2877_3407 | 176 |
| 225 | 3300041496 | Ga0451839_0534098 | Ga0451839_0534098_426_956 | 176 |
| 226 | 3300042876 | Ga0451577_0001342 | Ga0451577_0001342_46_576 | 176 |
| 227 | 3300042876 | Ga0451577_0191327 | Ga0451577_0191327_434_964 | 176 |
| 228 | 3300044673 | Ga0453683_0093433 | Ga0453683_0093433_573_1103 | 176 |
| 229 | 3300044694 | Ga0466963_0358136 | Ga0466963_0358136_25_555 | 176 |
| 230 | 3300044712 | Ga0453684_0000949 | Ga0453684_0000949_62905_63435 | 176 |
| 231 | 3300044842 | Ga0466957_0535985 | Ga0466957_0535985_146_676 | 176 |
| 232 | 3300045051 | Ga0451576_0603469 | Ga0451576_0603469_314_844 | 176 |
| 233 | 3300045051 | Ga0451576_0631368 | Ga0451576_0631368_136_666 | 176 |
| 234 | 3300046515 | Ga0495620_0017507 | Ga0495620_0017507_1452_1982 | 176 |
| 235 | 3300046537 | Ga0495598_0051417 | Ga0495598_0051417_256_786 | 176 |
| 236 | 3300047446 | Ga0495679_014845 | Ga0495679_014845_1947_2477 | 176 |
| 237 | 3300049589 | Ga0501073_0004246 | Ga0501073_0004246_8330_8860 | 176 |
| 238 | 3300049593 | Ga0501077_0318296 | Ga0501077_0318296_383_913 | 176 |
| 239 | 3300049742 | Ga0501080_0107210 | Ga0501080_0107210_1485_2015 | 176 |
| 240 | 3300050507 | nmdc:mga05p37_665903_c1 | nmdc:mga05p37_665903_c1_273_806 | 176 |
| 241 | 3300050510 | nmdc:mga06r32_2659_c1 | nmdc:mga06r32_2659_c1_11427_11957 | 176 |
| 242 | 3300050512 | nmdc:mga0n895_438729_c1 | nmdc:mga0n895_438729_c1_31_561 | 176 |
| 243 | 3300050512 | nmdc:mga0n895_666652_c1 | nmdc:mga0n895_666652_c1_63_593 | 176 |
| 244 | 3300050513 | nmdc:mga0rr50_103190_c1 | nmdc:mga0rr50_103190_c1_1330_1860 | 176 |
| 245 | 3300050513 | nmdc:mga0rr50_48_c1 | nmdc:mga0rr50_48_c1_66131_66661 | 176 |
| 246 | 3300050514 | nmdc:mga08x19_11435_c1 | nmdc:mga08x19_11435_c1_4418_4948 | 176 |
| 247 | 3300050514 | nmdc:mga08x19_228041_c1 | nmdc:mga08x19_228041_c1_213_743 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2o2k-assembly1.cif.gz_B | crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n | 0.9024 | 58 | 84 |
| 1m2d-assembly1.cif.gz_B | crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.809 | 97 | 174 |
| 1f37-assembly1.cif.gz_B | structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.8084 | 97 | 172 |
| 1m2b-assembly1.cif.gz_B | crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.8054 | 97 | 172 |
| 1m2a-assembly1.cif.gz_A | crystal structure at 1.5 angstroms resolution of the wild type thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus | 0.7844 | 97 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HX94_128_234_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9616 | 94 | 173 | 3.40.30.10 |
| af_B4FPX5_191_300_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9593 | 94 | 173 | 3.40.30.10 |
| af_Q9D6J6_126_223_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9541 | 94 | 174 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9383 | 93 | 175 | 3.40.30.10 |
| af_P0AFD1_83_165_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9277 | 93 | 175 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1EQH9-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.8032 | 21 | 176 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A3C1EQH9-F1-model_v4 | NAD(P)H-dependent oxidoreductase subunit E | 0.7988 | 21 | 176 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A352PVV8-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE | 0.7949 | 23 | 176 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A352PVV8-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoE | 0.7906 | 23 | 176 |
GO:0003954
GO:0046872 GO:0051537 |
| AF-A0A1F5J3A6-F1-model_v4 | NADH dehydrogenase | 0.7905 | 22 | 174 |
GO:0003954
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar