F359193

General Info

Members Datasets Scaffolds Average Seq Length
247 143 247 173

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0348035|Ga0436365_0348035_327_872
Length 181
Sequence MADLHPDNPYAKDRFPDPNKTVEFPAEAKKRFDWILTRYPNKEAALLPVLHLAQEVWGWIAPETVMYISELLDLSPADVFGVVSFYNMYNQKPVGKYHLQVCTNLSCMVTNAYDIYDHLCAKLHVKPGETTPDGLYTVTEVECLGSCGTAPVVQINNDYHENMTIEKMDQILSVAKDPQRK

Samples

Sample ID Description Type Environment
1 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
134 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
143 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 95.14
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24033J26618_1006415 3300002155 Bacteria 1319
2 Ga0065707_10005506 3300005295 Bacteria 7178
3 Ga0065707_10088243 3300005295 Bacteria 4726
4 Ga0070658_10141514 3300005327 Bacteria 2010
5 Ga0070676_10371349 3300005328 Bacteria 988
6 Ga0070676_10377578 3300005328 Bacteria 981
7 Ga0070683_100000009 3300005329 Bacteria 319830
8 Ga0070690_100106907 3300005330 Bacteria 1862
9 Ga0070690_100124010 3300005330 Bacteria 1737
10 Ga0070670_100000131 3300005331 Bacteria 70778
11 Ga0070670_100566115 3300005331 Bacteria 1015
12 Ga0068869_100170765 3300005334 Bacteria 1699
13 Ga0068869_100217217 3300005334 Bacteria 1514
14 Ga0068869_101219019 3300005334 Bacteria 662
15 Ga0070680_100033855 3300005336 Bacteria 4120
16 Ga0070680_100465829 3300005336 Bacteria 1080
17 Ga0070682_100000001 3300005337 Bacteria 569837
18 Ga0068868_100000567 3300005338 Bacteria 24765
19 Ga0068868_100001221 3300005338 Bacteria 17666
20 Ga0070689_100001189 3300005340 Bacteria 16482
21 Ga0070691_10349292 3300005341 Bacteria 821
22 Ga0070687_100003080 3300005343 Bacteria 6412
23 Ga0070687_100269464 3300005343 Bacteria 1067
24 Ga0070692_10004903 3300005345 Bacteria 5636
25 Ga0070692_10246516 3300005345 Bacteria 1067
26 Ga0070675_100000002 3300005354 Bacteria 435215
27 Ga0070675_100702848 3300005354 Bacteria 921
28 Ga0070671_100174975 3300005355 Bacteria 1816
29 Ga0070673_100679778 3300005364 Bacteria 944
30 Ga0070709_10119535 3300005434 Bacteria 1784
31 Ga0070709_10983074 3300005434 Bacteria 671
32 Ga0070713_100084439 3300005436 Bacteria 2717
33 Ga0070701_10000041 3300005438 Bacteria 32521
34 Ga0070700_100000078 3300005441 Bacteria 65986
35 Ga0070700_100640655 3300005441 Bacteria 838
36 Ga0070708_100201579 3300005445 Bacteria 1863
37 Ga0070708_100225838 3300005445 Bacteria 1757
38 Ga0070706_100014358 3300005467 Bacteria 7319
39 Ga0070706_100019016 3300005467 Bacteria 6336
40 Ga0070706_100325670 3300005467 Bacteria 1433
41 Ga0070706_100410899 3300005467 Bacteria 1260
42 Ga0070706_100439222 3300005467 Bacteria 1215
43 Ga0070707_100003590 3300005468 Bacteria 14633
44 Ga0070707_100072469 3300005468 Bacteria 3320
45 Ga0070707_100295667 3300005468 Bacteria 1573
46 Ga0070707_100421072 3300005468 Bacteria 1296
47 Ga0070698_100023320 3300005471 Bacteria 6470
48 Ga0070698_100042595 3300005471 Bacteria 4657
49 Ga0070698_100058967 3300005471 Bacteria 3879
50 Ga0070698_100141805 3300005471 Bacteria 2354
51 Ga0070699_100000025 3300005518 Bacteria 158245
52 Ga0070699_100015993 3300005518 Bacteria 6441
53 Ga0070699_100030413 3300005518 Bacteria 4661
54 Ga0070699_100112665 3300005518 Bacteria 2389
55 Ga0070699_100250089 3300005518 Bacteria 1583
56 Ga0070679_100468585 3300005530 Bacteria 1204
57 Ga0070684_100001071 3300005535 Bacteria 19605
58 Ga0070697_100132381 3300005536 Bacteria 2092
59 Ga0068853_100061216 3300005539 Bacteria 3255
60 Ga0068853_100143337 3300005539 Bacteria 2146
61 Ga0070672_100036961 3300005543 Bacteria 3724
62 Ga0070686_100484561 3300005544 Bacteria 957
63 Ga0070696_100133324 3300005546 Bacteria 1810
64 Ga0070696_100960350 3300005546 Bacteria 712
65 Ga0070693_100530633 3300005547 Bacteria 839
66 Ga0068855_100913702 3300005563 Unclassified 927
67 Ga0068857_100034902 3300005577 Bacteria 4450
68 Ga0070702_100128689 3300005615 Bacteria 1596
69 Ga0068859_101641838 3300005617 Bacteria 710
70 Ga0068864_100000094 3300005618 Bacteria 92700
71 Ga0068864_100376129 3300005618 Bacteria 1345
72 Ga0068861_100610196 3300005719 Bacteria 1003
73 Ga0068870_10247354 3300005840 Bacteria 1104
74 Ga0068858_100001900 3300005842 Bacteria 21314
75 Ga0070717_10000050 3300006028 Bacteria 103137
76 Ga0070717_10778638 3300006028 Bacteria 870
77 Ga0070717_11020230 3300006028 Bacteria 754
78 Ga0075432_10244109 3300006058 Unclassified 726
79 Ga0070716_100212487 3300006173 Bacteria 1294
80 Ga0070716_100761671 3300006173 Bacteria 746
81 Ga0097621_100540524 3300006237 Bacteria 1060
82 Ga0068871_100821747 3300006358 Bacteria 858
83 Ga0068871_101407197 3300006358 Bacteria 657
84 Ga0075428_100001909 3300006844 Bacteria 22365
85 Ga0075428_100075921 3300006844 Bacteria 3669
86 Ga0075428_100308522 3300006844 Bacteria 1701
87 Ga0075428_100381916 3300006844 Bacteria 1510
88 Ga0075428_100542727 3300006844 Bacteria 1243
89 Ga0075431_100004486 3300006847 Bacteria 13696
90 Ga0075431_100231869 3300006847 Bacteria 1881
91 Ga0075431_100923416 3300006847 Bacteria 842
92 Ga0075433_10054116 3300006852 Bacteria 3501
93 Ga0075433_10215636 3300006852 Bacteria 1705
94 Ga0075434_100022220 3300006871 Bacteria 6179
95 Ga0075434_100421554 3300006871 Bacteria 1356
96 Ga0075429_100492254 3300006880 Bacteria 1074
97 Ga0075436_100017040 3300006914 Bacteria 4973
98 Ga0097620_101641692 3300006931 Bacteria 710
99 Ga0075435_100000082 3300007076 Bacteria 50118
100 Ga0075435_100194135 3300007076 Bacteria 1719
101 Ga0075435_100240743 3300007076 Bacteria 1539
102 Ga0105244_10087843 3300009036 Bacteria 1532
103 Ga0111539_10000719 3300009094 Bacteria 43038
104 Ga0111539_10001160 3300009094 Bacteria 34830
105 Ga0111539_10318489 3300009094 Unclassified 1810
106 Ga0105245_10000027 3300009098 Bacteria 162116
107 Ga0105245_10000770 3300009098 Bacteria 29024
108 Ga0105245_10000817 3300009098 Bacteria 28373
109 Ga0105245_10316076 3300009098 Bacteria 1537
110 Ga0114129_10085887 3300009147 Bacteria 4365
111 Ga0114129_10136904 3300009147 Bacteria 3360
112 Ga0114129_11245408 3300009147 Bacteria 924
113 Ga0105243_10216203 3300009148 Bacteria 1691
114 Ga0105242_10005722 3300009176 Bacteria 9584
115 Ga0105238_10000118 3300009551 Bacteria 86809
116 Ga0099796_10192969 3300010159 Bacteria 823
117 Ga0105239_10232617 3300010375 Bacteria 2068
118 Ga0105246_10395498 3300011119 Bacteria 1146
119 Ga0105246_10628870 3300011119 Bacteria 931
120 Ga0157371_10300380 3300013102 Bacteria 1162
121 Ga0157369_10000123 3300013105 Bacteria 110823
122 Ga0157374_10000019 3300013296 Bacteria 280543
123 Ga0157378_10000588 3300013297 Bacteria 34092
124 Ga0157378_10002365 3300013297 Bacteria 16757
125 Ga0157378_10460622 3300013297 Unclassified 1263
126 Ga0163162_10222894 3300013306 Bacteria 2015
127 Ga0163162_10573976 3300013306 Bacteria 1255
128 Ga0157372_10255627 3300013307 Bacteria 2034
129 Ga0157372_10574737 3300013307 Bacteria 1314
130 Ga0157375_10000001 3300013308 Bacteria 696576
131 Ga0157375_10000026 3300013308 Bacteria 222518
132 Ga0157375_10000768 3300013308 Bacteria 28121
133 Ga0157380_10000970 3300014326 Bacteria 18177
134 Ga0157377_10000110 3300014745 Bacteria 56152
135 Ga0157377_10000126 3300014745 Bacteria 49710
136 Ga0157377_10073551 3300014745 Bacteria 1981
137 Ga0157377_11067219 3300014745 Bacteria 616
138 Ga0157376_10000011 3300014969 Bacteria 307434
139 Ga0213873_10000002 3300021358 Bacteria 1164195
140 Ga0213873_10001213 3300021358 Bacteria 4235
141 Ga0213876_10000001 3300021384 Bacteria 1186326
142 Ga0213876_10000070 3300021384 Bacteria 123986
143 Ga0213876_10040072 3300021384 Bacteria 2474
144 Ga0207655_1057313 3300025728 Bacteria 1530
145 Ga0207699_10698344 3300025906 Bacteria 742
146 Ga0207645_10347868 3300025907 Bacteria 992
147 Ga0207643_10235565 3300025908 Bacteria 1124
148 Ga0207684_10015086 3300025910 Bacteria 6652
149 Ga0207684_10379875 3300025910 Bacteria 1215
150 Ga0207684_11106459 3300025910 Unclassified 659
151 Ga0207695_10014001 3300025913 Bacteria 9525
152 Ga0207660_10012081 3300025917 Bacteria 5644
153 Ga0207662_10006035 3300025918 Bacteria 6511
154 Ga0207662_10413544 3300025918 Bacteria 917
155 Ga0207646_10025707 3300025922 Bacteria 5384
156 Ga0207646_10051261 3300025922 Bacteria 3693
157 Ga0207646_10145985 3300025922 Bacteria 2132
158 Ga0207646_10309674 3300025922 Bacteria 1427
159 Ga0207681_10811495 3300025923 Bacteria 782
160 Ga0207694_10000001 3300025924 Bacteria 4078485
161 Ga0207650_10000021 3300025925 Bacteria 322394
162 Ga0207659_10000005 3300025926 Bacteria 405839
163 Ga0207687_10000006 3300025927 Bacteria 641680
164 Ga0207687_10001964 3300025927 Bacteria 14156
165 Ga0207687_10003989 3300025927 Bacteria 9891
166 Ga0207700_10071454 3300025928 Bacteria 2672
167 Ga0207644_10263330 3300025931 Bacteria 1379
168 Ga0207686_10026570 3300025934 Bacteria 3379
169 Ga0207670_10033876 3300025936 Bacteria 3295
170 Ga0207665_10148288 3300025939 Bacteria 1678
171 Ga0207665_10333270 3300025939 Bacteria 1142
172 Ga0207691_10051872 3300025940 Bacteria 3748
173 Ga0207689_10023155 3300025942 Bacteria 5215
174 Ga0207661_10000007 3300025944 Bacteria 471636
175 Ga0207651_10364283 3300025960 Bacteria 1221
176 Ga0207677_10000090 3300026023 Bacteria 74352
177 Ga0207677_10000126 3300026023 Bacteria 63024
178 Ga0207703_10000099 3300026035 Bacteria 103567
179 Ga0207639_10000003 3300026041 Bacteria 806887
180 Ga0207708_10000018 3300026075 Bacteria 188140
181 Ga0207676_10000063 3300026095 Bacteria 110993
182 Ga0207676_10186817 3300026095 Bacteria 1820
183 Ga0207674_10094920 3300026116 Bacteria 2969
184 Ga0207674_10539170 3300026116 Bacteria 1127
185 Ga0207674_10935195 3300026116 Bacteria 835
186 Ga0207675_100307159 3300026118 Bacteria 1546
187 Ga0207675_100424589 3300026118 Bacteria 1313
188 Ga0207683_10321911 3300026121 Bacteria 1416
189 Ga0207428_10000332 3300027907 Bacteria 61283
190 Ga0207428_10697703 3300027907 Unclassified 726
191 Ga0307511_10004854 3300030521 Bacteria 13743
192 Ga0265320_10024904 3300031240 Bacteria 3154
193 Ga0307413_10742003 3300031824 Bacteria 820
194 Ga0307412_10998591 3300031911 Bacteria 739
195 Ga0307416_100775805 3300032002 Bacteria 1053
196 Ga0316583_10121863 3300032133 Bacteria 909
197 Ga0373932_0001703 3300035112 Bacteria 5979
198 Ga0373941_0026059 3300035115 Bacteria 1695
199 Ga0436364_0561061 3300037853 Bacteria 2343
200 Ga0436365_0232456 3300039437 Bacteria 39991
201 Ga0436365_0348035 3300039437 Bacteria 973
202 Ga0436365_0774883 3300039437 Bacteria 390569
203 Ga0436365_0840677 3300039437 Bacteria 2415
204 Ga0436365_0955099 3300039437 Bacteria 933
205 Ga0436363_0992958 3300039450 Bacteria 1536
206 Ga0436362_0660519 3300039453 Bacteria 832172
207 Ga0436362_0736466 3300039453 Bacteria 11594
208 Ga0451839_0534098 3300041496 Bacteria 1712
209 Ga0451577_0001342 3300042876 Bacteria 33389
210 Ga0451577_0191327 3300042876 Bacteria 1846
211 Ga0453683_0058509 3300044673 Bacteria 2411
212 Ga0453683_0093433 3300044673 Bacteria 1886
213 Ga0466963_0358136 3300044694 Bacteria 1028
214 Ga0453684_0000949 3300044712 Bacteria 95680
215 Ga0466957_0535985 3300044842 Unclassified 815
216 Ga0451576_0088882 3300045051 Bacteria 3213
217 Ga0451576_0603469 3300045051 Bacteria 1154
218 Ga0451576_0631368 3300045051 Bacteria 1126
219 Ga0495620_0017507 3300046515 Bacteria 3570
220 Ga0495598_0051417 3300046537 Bacteria 1242
221 Ga0495679_014845 3300047446 Bacteria 2869
222 Ga0501073_0004246 3300049589 Bacteria 10743
223 Ga0501077_0318296 3300049593 Bacteria 992
224 Ga0501080_0107210 3300049742 Bacteria 2589
225 nmdc:mga05p37_665903_c1 3300050507 Unclassified 1163
226 nmdc:mga05p37_979531_c1 3300050507 Bacteria 901
227 nmdc:mga09592_1097967_c1 3300050508 Unclassified 661
228 nmdc:mga09592_266327_c1 3300050508 Bacteria 1486
229 nmdc:mga09592_354814_c1 3300050508 Bacteria 1269
230 nmdc:mga06r32_1590232_c1 3300050510 Unclassified 592
231 nmdc:mga06r32_207087_c1 3300050510 Bacteria 1949
232 nmdc:mga06r32_2659_c1 3300050510 Bacteria 15972
233 nmdc:mga08y16_29565_c1 3300050511 Bacteria 5772
234 nmdc:mga08y16_52_c1 3300050511 Bacteria 104128
235 nmdc:mga08y16_605172_c1 3300050511 Bacteria 1104
236 nmdc:mga0n895_289498_c1 3300050512 Bacteria 1661
237 nmdc:mga0n895_438729_c1 3300050512 Bacteria 1319
238 nmdc:mga0n895_666652_c1 3300050512 Bacteria 1038
239 nmdc:mga0rr50_103190_c1 3300050513 Bacteria 2244
240 nmdc:mga0rr50_123442_c1 3300050513 Bacteria 2064
241 nmdc:mga0rr50_158844_c1 3300050513 Bacteria 1833
242 nmdc:mga0rr50_48_c1 3300050513 Bacteria 67747
243 nmdc:mga08x19_11435_c1 3300050514 Bacteria 5342
244 nmdc:mga08x19_228041_c1 3300050514 Bacteria 1281
245 nmdc:mga0a205_198680_c1 3300050515 Bacteria 1896
246 nmdc:mga0a205_65846_c1 3300050515 Bacteria 3501
247 nmdc:mga0a205_7887_c1 3300050515 Bacteria 9667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100913702 Ga0068855_1009137021 154
2 3300005617 Ga0068859_101641838 Ga0068859_1016418382 154
3 3300005618 Ga0068864_100376129 Ga0068864_1003761292 154
4 3300006931 Ga0097620_101641692 Ga0097620_1016416922 154
5 3300026095 Ga0207676_10186817 Ga0207676_101868172 154
6 3300005295 Ga0065707_10005506 Ga0065707_100055067 155
7 3300005471 Ga0070698_100023320 Ga0070698_1000233204 155
8 3300005518 Ga0070699_100000025 Ga0070699_1000000259 155
9 3300005518 Ga0070699_100112665 Ga0070699_1001126652 155
10 3300006852 Ga0075433_10054116 Ga0075433_100541162 155
11 3300006852 Ga0075433_10215636 Ga0075433_102156362 155
12 3300006871 Ga0075434_100022220 Ga0075434_1000222206 155
13 3300007076 Ga0075435_100240743 Ga0075435_1002407432 155
14 3300009147 Ga0114129_11245408 Ga0114129_112454082 155
15 3300044673 Ga0453683_0058509 Ga0453683_0058509_719_1186 155
16 3300045051 Ga0451576_0088882 Ga0451576_0088882_1738_2205 155
17 3300050507 nmdc:mga05p37_979531_c1 nmdc:mga05p37_979531_c1_240_707 155
18 3300050510 nmdc:mga06r32_1590232_c1 nmdc:mga06r32_1590232_c1_43_510 155
19 3300050512 nmdc:mga0n895_289498_c1 nmdc:mga0n895_289498_c1_455_922 155
20 3300050513 nmdc:mga0rr50_158844_c1 nmdc:mga0rr50_158844_c1_352_819 155
21 3300050515 nmdc:mga0a205_65846_c1 nmdc:mga0a205_65846_c1_2821_3288 155
22 3300050515 nmdc:mga0a205_7887_c1 nmdc:mga0a205_7887_c1_4866_5333 155
23 3300006844 Ga0075428_100308522 Ga0075428_1003085221 156
24 3300005467 Ga0070706_100439222 Ga0070706_1004392221 157
25 3300006058 Ga0075432_10244109 Ga0075432_102441092 157
26 3300006844 Ga0075428_100381916 Ga0075428_1003819161 157
27 3300006847 Ga0075431_100923416 Ga0075431_1009234162 157
28 3300009094 Ga0111539_10318489 Ga0111539_103184892 157
29 3300009147 Ga0114129_10085887 Ga0114129_100858875 157
30 3300027907 Ga0207428_10697703 Ga0207428_106977031 157
31 3300050508 nmdc:mga09592_1097967_c1 nmdc:mga09592_1097967_c1_35_517 157
32 3300050511 nmdc:mga08y16_605172_c1 nmdc:mga08y16_605172_c1_48_530 157
33 3300050513 nmdc:mga0rr50_123442_c1 nmdc:mga0rr50_123442_c1_1511_1993 157
34 3300050515 nmdc:mga0a205_198680_c1 nmdc:mga0a205_198680_c1_786_1268 157
35 3300006844 Ga0075428_100001909 Ga0075428_10000190925 163
36 3300009094 Ga0111539_10000719 Ga0111539_1000071928 163
37 3300027907 Ga0207428_10000332 Ga0207428_1000033243 163
38 3300050511 nmdc:mga08y16_52_c1 nmdc:mga08y16_52_c1_91391_91921 163
39 3300006847 Ga0075431_100231869 Ga0075431_1002318692 164
40 3300031240 Ga0265320_10024904 Ga0265320_100249042 164
41 3300050508 nmdc:mga09592_354814_c1 nmdc:mga09592_354814_c1_533_1063 164
42 3300050510 nmdc:mga06r32_207087_c1 nmdc:mga06r32_207087_c1_238_768 164
43 3300006844 Ga0075428_100075921 Ga0075428_1000759213 168
44 3300006880 Ga0075429_100492254 Ga0075429_1004922542 168
45 3300009094 Ga0111539_10001160 Ga0111539_1000116018 168
46 3300050508 nmdc:mga09592_266327_c1 nmdc:mga09592_266327_c1_429_944 168
47 3300050511 nmdc:mga08y16_29565_c1 nmdc:mga08y16_29565_c1_1850_2365 168
48 3300005354 Ga0070675_100702848 Ga0070675_1007028482 175
49 3300005364 Ga0070673_100679778 Ga0070673_1006797782 175
50 3300025960 Ga0207651_10364283 Ga0207651_103642832 175
51 3300002155 JGI24033J26618_1006415 JGI24033J26618_10064151 176
52 3300005295 Ga0065707_10088243 Ga0065707_100882438 176
53 3300005327 Ga0070658_10141514 Ga0070658_101415142 176
54 3300005328 Ga0070676_10371349 Ga0070676_103713491 176
55 3300005328 Ga0070676_10377578 Ga0070676_103775781 176
56 3300005329 Ga0070683_100000009 Ga0070683_10000000940 176
57 3300005330 Ga0070690_100106907 Ga0070690_1001069072 176
58 3300005330 Ga0070690_100124010 Ga0070690_1001240102 176
59 3300005331 Ga0070670_100000131 Ga0070670_10000013116 176
60 3300005331 Ga0070670_100566115 Ga0070670_1005661151 176
61 3300005334 Ga0068869_100170765 Ga0068869_1001707652 176
62 3300005334 Ga0068869_100217217 Ga0068869_1002172172 176
63 3300005334 Ga0068869_101219019 Ga0068869_1012190191 176
64 3300005336 Ga0070680_100033855 Ga0070680_1000338555 176
65 3300005336 Ga0070680_100465829 Ga0070680_1004658292 176
66 3300005337 Ga0070682_100000001 Ga0070682_10000000190 176
67 3300005338 Ga0068868_100000567 Ga0068868_10000056724 176
68 3300005338 Ga0068868_100001221 Ga0068868_10000122118 176
69 3300005340 Ga0070689_100001189 Ga0070689_10000118913 176
70 3300005341 Ga0070691_10349292 Ga0070691_103492921 176
71 3300005343 Ga0070687_100003080 Ga0070687_1000030803 176
72 3300005343 Ga0070687_100269464 Ga0070687_1002694641 176
73 3300005345 Ga0070692_10004903 Ga0070692_100049033 176
74 3300005345 Ga0070692_10246516 Ga0070692_102465161 176
75 3300005354 Ga0070675_100000002 Ga0070675_100000002244 176
76 3300005355 Ga0070671_100174975 Ga0070671_1001749753 176
77 3300005434 Ga0070709_10119535 Ga0070709_101195352 176
78 3300005434 Ga0070709_10983074 Ga0070709_109830742 176
79 3300005436 Ga0070713_100084439 Ga0070713_1000844392 176
80 3300005438 Ga0070701_10000041 Ga0070701_1000004129 176
81 3300005441 Ga0070700_100000078 Ga0070700_10000007857 176
82 3300005441 Ga0070700_100640655 Ga0070700_1006406552 176
83 3300005445 Ga0070708_100201579 Ga0070708_1002015792 176
84 3300005445 Ga0070708_100225838 Ga0070708_1002258382 176
85 3300005467 Ga0070706_100014358 Ga0070706_1000143589 176
86 3300005467 Ga0070706_100019016 Ga0070706_1000190161 176
87 3300005467 Ga0070706_100325670 Ga0070706_1003256702 176
88 3300005467 Ga0070706_100410899 Ga0070706_1004108992 176
89 3300005468 Ga0070707_100003590 Ga0070707_10000359013 176
90 3300005468 Ga0070707_100072469 Ga0070707_1000724695 176
91 3300005468 Ga0070707_100295667 Ga0070707_1002956671 176
92 3300005468 Ga0070707_100421072 Ga0070707_1004210723 176
93 3300005471 Ga0070698_100042595 Ga0070698_1000425952 176
94 3300005471 Ga0070698_100058967 Ga0070698_1000589675 176
95 3300005471 Ga0070698_100141805 Ga0070698_1001418052 176
96 3300005518 Ga0070699_100015993 Ga0070699_1000159936 176
97 3300005518 Ga0070699_100030413 Ga0070699_1000304135 176
98 3300005518 Ga0070699_100250089 Ga0070699_1002500892 176
99 3300005530 Ga0070679_100468585 Ga0070679_1004685852 176
100 3300005535 Ga0070684_100001071 Ga0070684_10000107112 176
101 3300005536 Ga0070697_100132381 Ga0070697_1001323814 176
102 3300005539 Ga0068853_100061216 Ga0068853_1000612163 176
103 3300005539 Ga0068853_100143337 Ga0068853_1001433373 176
104 3300005543 Ga0070672_100036961 Ga0070672_1000369615 176
105 3300005544 Ga0070686_100484561 Ga0070686_1004845611 176
106 3300005546 Ga0070696_100133324 Ga0070696_1001333242 176
107 3300005546 Ga0070696_100960350 Ga0070696_1009603501 176
108 3300005547 Ga0070693_100530633 Ga0070693_1005306332 176
109 3300005577 Ga0068857_100034902 Ga0068857_1000349027 176
110 3300005615 Ga0070702_100128689 Ga0070702_1001286892 176
111 3300005618 Ga0068864_100000094 Ga0068864_1000000942 176
112 3300005719 Ga0068861_100610196 Ga0068861_1006101962 176
113 3300005840 Ga0068870_10247354 Ga0068870_102473542 176
114 3300005842 Ga0068858_100001900 Ga0068858_1000019008 176
115 3300006028 Ga0070717_10000050 Ga0070717_1000005084 176
116 3300006028 Ga0070717_10778638 Ga0070717_107786382 176
117 3300006028 Ga0070717_11020230 Ga0070717_110202301 176
118 3300006173 Ga0070716_100212487 Ga0070716_1002124872 176
119 3300006173 Ga0070716_100761671 Ga0070716_1007616711 176
120 3300006237 Ga0097621_100540524 Ga0097621_1005405242 176
121 3300006358 Ga0068871_100821747 Ga0068871_1008217471 176
122 3300006358 Ga0068871_101407197 Ga0068871_1014071971 176
123 3300006844 Ga0075428_100542727 Ga0075428_1005427272 176
124 3300006847 Ga0075431_100004486 Ga0075431_10000448619 176
125 3300006871 Ga0075434_100421554 Ga0075434_1004215543 176
126 3300006914 Ga0075436_100017040 Ga0075436_1000170406 176
127 3300007076 Ga0075435_100000082 Ga0075435_10000008250 176
128 3300007076 Ga0075435_100194135 Ga0075435_1001941352 176
129 3300009036 Ga0105244_10087843 Ga0105244_100878432 176
130 3300009098 Ga0105245_10000027 Ga0105245_10000027132 176
131 3300009098 Ga0105245_10000770 Ga0105245_1000077016 176
132 3300009098 Ga0105245_10000817 Ga0105245_1000081714 176
133 3300009098 Ga0105245_10316076 Ga0105245_103160763 176
134 3300009147 Ga0114129_10136904 Ga0114129_101369042 176
135 3300009148 Ga0105243_10216203 Ga0105243_102162032 176
136 3300009176 Ga0105242_10005722 Ga0105242_1000572211 176
137 3300009551 Ga0105238_10000118 Ga0105238_1000011830 176
138 3300010159 Ga0099796_10192969 Ga0099796_101929692 176
139 3300010375 Ga0105239_10232617 Ga0105239_102326173 176
140 3300011119 Ga0105246_10395498 Ga0105246_103954982 176
141 3300011119 Ga0105246_10628870 Ga0105246_106288702 176
142 3300013102 Ga0157371_10300380 Ga0157371_103003801 176
143 3300013105 Ga0157369_10000123 Ga0157369_1000012375 176
144 3300013296 Ga0157374_10000019 Ga0157374_1000001955 176
145 3300013297 Ga0157378_10000588 Ga0157378_1000058811 176
146 3300013297 Ga0157378_10002365 Ga0157378_100023653 176
147 3300013297 Ga0157378_10460622 Ga0157378_104606223 176
148 3300013306 Ga0163162_10222894 Ga0163162_102228942 176
149 3300013306 Ga0163162_10573976 Ga0163162_105739762 176
150 3300013307 Ga0157372_10255627 Ga0157372_102556272 176
151 3300013307 Ga0157372_10574737 Ga0157372_105747373 176
152 3300013308 Ga0157375_10000001 Ga0157375_10000001277 176
153 3300013308 Ga0157375_10000026 Ga0157375_10000026139 176
154 3300013308 Ga0157375_10000768 Ga0157375_100007683 176
155 3300014326 Ga0157380_10000970 Ga0157380_1000097015 176
156 3300014745 Ga0157377_10000110 Ga0157377_100001102 176
157 3300014745 Ga0157377_10000126 Ga0157377_1000012623 176
158 3300014745 Ga0157377_10073551 Ga0157377_100735512 176
159 3300014745 Ga0157377_11067219 Ga0157377_110672191 176
160 3300014969 Ga0157376_10000011 Ga0157376_10000011162 176
161 3300021358 Ga0213873_10000002 Ga0213873_10000002578 176
162 3300021358 Ga0213873_10001213 Ga0213873_100012136 176
163 3300021384 Ga0213876_10000001 Ga0213876_10000001661 176
164 3300021384 Ga0213876_10000070 Ga0213876_1000007088 176
165 3300021384 Ga0213876_10040072 Ga0213876_100400722 176
166 3300025728 Ga0207655_1057313 Ga0207655_10573132 176
167 3300025906 Ga0207699_10698344 Ga0207699_106983441 176
168 3300025907 Ga0207645_10347868 Ga0207645_103478682 176
169 3300025908 Ga0207643_10235565 Ga0207643_102355652 176
170 3300025910 Ga0207684_10015086 Ga0207684_100150868 176
171 3300025910 Ga0207684_10379875 Ga0207684_103798752 176
172 3300025910 Ga0207684_11106459 Ga0207684_111064591 176
173 3300025913 Ga0207695_10014001 Ga0207695_100140015 176
174 3300025917 Ga0207660_10012081 Ga0207660_100120813 176
175 3300025918 Ga0207662_10006035 Ga0207662_100060357 176
176 3300025918 Ga0207662_10413544 Ga0207662_104135442 176
177 3300025922 Ga0207646_10025707 Ga0207646_100257072 176
178 3300025922 Ga0207646_10051261 Ga0207646_100512615 176
179 3300025922 Ga0207646_10145985 Ga0207646_101459854 176
180 3300025922 Ga0207646_10309674 Ga0207646_103096742 176
181 3300025923 Ga0207681_10811495 Ga0207681_108114952 176
182 3300025924 Ga0207694_10000001 Ga0207694_10000001978 176
183 3300025925 Ga0207650_10000021 Ga0207650_10000021166 176
184 3300025926 Ga0207659_10000005 Ga0207659_10000005285 176
185 3300025927 Ga0207687_10000006 Ga0207687_10000006450 176
186 3300025927 Ga0207687_10001964 Ga0207687_100019643 176
187 3300025927 Ga0207687_10003989 Ga0207687_100039893 176
188 3300025928 Ga0207700_10071454 Ga0207700_100714545 176
189 3300025931 Ga0207644_10263330 Ga0207644_102633303 176
190 3300025934 Ga0207686_10026570 Ga0207686_100265704 176
191 3300025936 Ga0207670_10033876 Ga0207670_100338763 176
192 3300025939 Ga0207665_10148288 Ga0207665_101482883 176
193 3300025939 Ga0207665_10333270 Ga0207665_103332702 176
194 3300025940 Ga0207691_10051872 Ga0207691_100518722 176
195 3300025942 Ga0207689_10023155 Ga0207689_100231552 176
196 3300025944 Ga0207661_10000007 Ga0207661_10000007406 176
197 3300026023 Ga0207677_10000090 Ga0207677_1000009045 176
198 3300026023 Ga0207677_10000126 Ga0207677_100001268 176
199 3300026035 Ga0207703_10000099 Ga0207703_100000999 176
200 3300026041 Ga0207639_10000003 Ga0207639_10000003326 176
201 3300026075 Ga0207708_10000018 Ga0207708_1000001858 176
202 3300026095 Ga0207676_10000063 Ga0207676_100000633 176
203 3300026116 Ga0207674_10094920 Ga0207674_100949202 176
204 3300026116 Ga0207674_10539170 Ga0207674_105391702 176
205 3300026116 Ga0207674_10935195 Ga0207674_109351952 176
206 3300026118 Ga0207675_100307159 Ga0207675_1003071592 176
207 3300026118 Ga0207675_100424589 Ga0207675_1004245892 176
208 3300026121 Ga0207683_10321911 Ga0207683_103219112 176
209 3300030521 Ga0307511_10004854 Ga0307511_100048545 176
210 3300031824 Ga0307413_10742003 Ga0307413_107420031 176
211 3300031911 Ga0307412_10998591 Ga0307412_109985912 176
212 3300032002 Ga0307416_100775805 Ga0307416_1007758052 176
213 3300032133 Ga0316583_10121863 Ga0316583_101218631 176
214 3300035112 Ga0373932_0001703 Ga0373932_0001703_4642_5172 176
215 3300035115 Ga0373941_0026059 Ga0373941_0026059_907_1437 176
216 3300037853 Ga0436364_0561061 Ga0436364_0561061_1006_1536 176
217 3300039437 Ga0436365_0232456 Ga0436365_0232456_4737_5267 176
218 3300039437 Ga0436365_0348035 Ga0436365_0348035_327_872 176
219 3300039437 Ga0436365_0774883 Ga0436365_0774883_134051_134581 176
220 3300039437 Ga0436365_0840677 Ga0436365_0840677_1284_1814 176
221 3300039437 Ga0436365_0955099 Ga0436365_0955099_249_779 176
222 3300039450 Ga0436363_0992958 Ga0436363_0992958_171_701 176
223 3300039453 Ga0436362_0660519 Ga0436362_0660519_348700_349230 176
224 3300039453 Ga0436362_0736466 Ga0436362_0736466_2877_3407 176
225 3300041496 Ga0451839_0534098 Ga0451839_0534098_426_956 176
226 3300042876 Ga0451577_0001342 Ga0451577_0001342_46_576 176
227 3300042876 Ga0451577_0191327 Ga0451577_0191327_434_964 176
228 3300044673 Ga0453683_0093433 Ga0453683_0093433_573_1103 176
229 3300044694 Ga0466963_0358136 Ga0466963_0358136_25_555 176
230 3300044712 Ga0453684_0000949 Ga0453684_0000949_62905_63435 176
231 3300044842 Ga0466957_0535985 Ga0466957_0535985_146_676 176
232 3300045051 Ga0451576_0603469 Ga0451576_0603469_314_844 176
233 3300045051 Ga0451576_0631368 Ga0451576_0631368_136_666 176
234 3300046515 Ga0495620_0017507 Ga0495620_0017507_1452_1982 176
235 3300046537 Ga0495598_0051417 Ga0495598_0051417_256_786 176
236 3300047446 Ga0495679_014845 Ga0495679_014845_1947_2477 176
237 3300049589 Ga0501073_0004246 Ga0501073_0004246_8330_8860 176
238 3300049593 Ga0501077_0318296 Ga0501077_0318296_383_913 176
239 3300049742 Ga0501080_0107210 Ga0501080_0107210_1485_2015 176
240 3300050507 nmdc:mga05p37_665903_c1 nmdc:mga05p37_665903_c1_273_806 176
241 3300050510 nmdc:mga06r32_2659_c1 nmdc:mga06r32_2659_c1_11427_11957 176
242 3300050512 nmdc:mga0n895_438729_c1 nmdc:mga0n895_438729_c1_31_561 176
243 3300050512 nmdc:mga0n895_666652_c1 nmdc:mga0n895_666652_c1_63_593 176
244 3300050513 nmdc:mga0rr50_103190_c1 nmdc:mga0rr50_103190_c1_1330_1860 176
245 3300050513 nmdc:mga0rr50_48_c1 nmdc:mga0rr50_48_c1_66131_66661 176
246 3300050514 nmdc:mga08x19_11435_c1 nmdc:mga08x19_11435_c1_4418_4948 176
247 3300050514 nmdc:mga08x19_228041_c1 nmdc:mga08x19_228041_c1_213_743 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

32

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2k-assembly1.cif.gz_B crystal structure of the activation domain of human methionine synthase isoform/mutant d963e/k1071n 0.9024 58 84
1m2d-assembly1.cif.gz_B crystal structure at 1.05 angstroms resolution of the cys59ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.809 97 174
1f37-assembly1.cif.gz_B structure of a thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.8084 97 172
1m2b-assembly1.cif.gz_B crystal structure at 1.25 angstroms resolution of the cys55ser variant of the thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.8054 97 172
1m2a-assembly1.cif.gz_A crystal structure at 1.5 angstroms resolution of the wild type thioredoxin-like [2fe-2s] ferredoxin from aquifex aeolicus 0.7844 97 174
ID Description Score Start End Superfamily
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9616 94 173 3.40.30.10
af_B4FPX5_191_300_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9593 94 173 3.40.30.10
af_Q9D6J6_126_223_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9541 94 174 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9383 93 175 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9277 93 175 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A3C1EQH9-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.8032 21 176 GO:0003954
GO:0046872
GO:0051537
AF-A0A3C1EQH9-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.7988 21 176 GO:0003954
GO:0046872
GO:0051537
AF-A0A352PVV8-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.7949 23 176 GO:0003954
GO:0046872
GO:0051537
AF-A0A352PVV8-F1-model_v4 NADH-quinone oxidoreductase subunit NuoE 0.7906 23 176 GO:0003954
GO:0046872
GO:0051537
AF-A0A1F5J3A6-F1-model_v4 NADH dehydrogenase 0.7905 22 174 GO:0003954
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
91.08 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map