F359303

General Info

Members Datasets Scaffolds Average Seq Length
247 159 494 297

Family's Representative Sequence

Representative Sequence 3300046520|Ga0495637_0012760|Ga0495637_0012760_2911_3783
Length 266
Sequence MFLSIIGIIVIFVGFAVSNQNNVIGRYSSITKSMFKVIDAGQVGVKTVFGKVDNDVLYSGLNVINPIAVITPFDVKTQNYTMSGVHDEGNKQTDDALRVLSADGLEVIIDLSVLFREIGTDYLEKIVRPVSRTAIRDNAVAYDAVALYSSKRDEFQAKIFNTIEKSFAKRGLELEQLLVRNITLPASVKASIESKINAEQDAQKMTFVLQKERQEAERKRVEAQGIADYQLQYESILAQKEIAKSANTKVIIMGNGKSAPIILGGN

Samples

Sample ID Description Type Environment
1 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
93 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
99 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
116 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
123 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
124 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
135 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
136 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
137 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
138 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
139 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
140 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
149 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
150 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
151 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
152 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
153 2738541278 Niastella sp. CF465 Isolate Unclassified
154 2738541283 Pedobacter sp. OK701 Isolate Unclassified
155 2739367651 Pedobacter sp. OK291 Isolate Unclassified
156 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
157 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
158 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
159 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.45
Nodule 0
Rhizoplane 0.4
Rhizosphere 87.45
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495637_0012760 3300046520 Bacteria 4010
2 rootH1_10000227 3300003323 Bacteria 8492
3 Ga0065165_1000078 3300005262 Bacteria 162412
4 Ga0065714_10027576 3300005288 Bacteria 1228
5 Ga0065714_10078852 3300005288 Bacteria 2557
6 Ga0065714_10082249 3300005288 Bacteria 2284
7 Ga0065715_10023856 3300005293 Bacteria 1694
8 Ga0070677_10046604 3300005333 Unclassified 1734
9 Ga0068869_100003288 3300005334 Bacteria 9869
10 Ga0070666_10025647 3300005335 Unclassified 3844
11 Ga0070666_10060608 3300005335 Bacteria 2561
12 Ga0068868_100040637 3300005338 Unclassified 3620
13 Ga0070661_100240048 3300005344 Unclassified 1395
14 Ga0070668_100563846 3300005347 Bacteria 992
15 Ga0070674_100150563 3300005356 Unclassified 1755
16 Ga0070673_100073542 3300005364 Unclassified 2751
17 Ga0070688_100325827 3300005365 Bacteria 1117
18 Ga0070667_100021322 3300005367 Bacteria 5381
19 Ga0070678_100021933 3300005456 Unclassified 4221
20 Ga0070662_100267589 3300005457 Unclassified 1379
21 Ga0068853_100063639 3300005539 Bacteria 3195
22 Ga0070672_100080001 3300005543 Bacteria 2617
23 Ga0070665_100000016 3300005548 Bacteria 451538
24 Ga0070665_100026186 3300005548 Bacteria 5872
25 Ga0068857_100007449 3300005577 Bacteria 9419
26 Ga0068857_100071061 3300005577 Bacteria 3101
27 Ga0068854_100101655 3300005578 Unclassified 2156
28 Ga0068854_100132870 3300005578 Unclassified 1902
29 Ga0068856_100000120 3300005614 Bacteria 78280
30 Ga0068856_100150436 3300005614 Unclassified 2337
31 Ga0068856_100332092 3300005614 Bacteria 1538
32 Ga0068852_100002578 3300005616 Bacteria 12501
33 Ga0068859_100068890 3300005617 Unclassified 3572
34 Ga0068861_100036561 3300005719 Bacteria 3645
35 Ga0068870_10012456 3300005840 Unclassified 3976
36 Ga0068860_100000026 3300005843 Bacteria 270483
37 Ga0068860_100004501 3300005843 Bacteria 14216
38 Ga0075366_10067660 3300006195 Bacteria 2126
39 Ga0097621_100038687 3300006237 Unclassified 3828
40 Ga0068871_100017540 3300006358 Bacteria 5420
41 Ga0068871_100224968 3300006358 Bacteria 1627
42 Ga0075430_100001704 3300006846 Bacteria 17938
43 Ga0075431_100001979 3300006847 Bacteria 19547
44 Ga0075429_100259758 3300006880 Bacteria 1520
45 Ga0068865_100012202 3300006881 Bacteria 5404
46 Ga0097620_100068891 3300006931 Unclassified 3572
47 Ga0105240_10001556 3300009093 Bacteria 38962
48 Ga0105240_10059763 3300009093 Bacteria 4755
49 Ga0114129_10000267 3300009147 Bacteria 59005
50 Ga0105241_10010017 3300009174 Bacteria 6960
51 Ga0105241_10011333 3300009174 Bacteria 6536
52 Ga0105242_10349802 3300009176 Unclassified 1365
53 Ga0105237_10051271 3300009545 Bacteria 4145
54 Ga0105237_10056747 3300009545 Unclassified 3919
55 Ga0105237_10100471 3300009545 Unclassified 2884
56 Ga0105237_10196528 3300009545 Unclassified 2017
57 Ga0105238_10001372 3300009551 Bacteria 24425
58 Ga0105238_10149974 3300009551 Unclassified 2307
59 Ga0105249_10072976 3300009553 Bacteria 3174
60 Ga0105249_10178110 3300009553 Unclassified 2066
61 Ga0105239_10019080 3300010375 Bacteria 7579
62 Ga0105239_10051217 3300010375 Bacteria 4526
63 Ga0105239_10164649 3300010375 Bacteria 2479
64 Ga0105246_10002461 3300011119 Bacteria 11184
65 Ga0157373_10007797 3300013100 Bacteria 7960
66 Ga0157373_10020295 3300013100 Bacteria 4831
67 Ga0157371_10003915 3300013102 Bacteria 13247
68 Ga0157370_10012402 3300013104 Bacteria 8839
69 Ga0157370_10072804 3300013104 Bacteria 3242
70 Ga0157369_10000023 3300013105 Bacteria 226955
71 Ga0157374_10300394 3300013296 Bacteria 1588
72 Ga0157378_10454560 3300013297 Unclassified 1272
73 Ga0163162_10000766 3300013306 Bacteria 29884
74 Ga0163162_10004654 3300013306 Bacteria 13225
75 Ga0163162_10007999 3300013306 Bacteria 10312
76 Ga0157372_10001284 3300013307 Bacteria 27122
77 Ga0157372_10006772 3300013307 Bacteria 12185
78 Ga0157372_10375317 3300013307 Unclassified 1657
79 Ga0157375_10418378 3300013308 Bacteria 1506
80 Ga0163163_10231060 3300014325 Bacteria 1899
81 Ga0182008_10000001 3300014497 Bacteria 540790
82 Ga0157376_10010817 3300014969 Bacteria 6697
83 Ga0182006_1000666 3300015261 Bacteria 24108
84 Ga0182006_1002598 3300015261 Bacteria 9767
85 Ga0182007_10000002 3300015262 Bacteria 564661
86 Ga0163161_10000496 3300017792 Bacteria 32389
87 Ga0163161_10001273 3300017792 Bacteria 18821
88 Ga0163161_10003860 3300017792 Bacteria 10510
89 Ga0163161_10005148 3300017792 Bacteria 9092
90 Ga0213876_10005890 3300021384 Bacteria 6702
91 Ga0209646_1002913 3300025246 Bacteria 3567
92 Ga0209676_1000915 3300025292 Bacteria 36803
93 Ga0207688_10020788 3300025901 Bacteria 3583
94 Ga0207680_10002865 3300025903 Bacteria 8072
95 Ga0207647_10026952 3300025904 Bacteria 3751
96 Ga0207645_10000307 3300025907 Bacteria 41105
97 Ga0207654_10308783 3300025911 Bacteria 1078
98 Ga0207671_10007909 3300025914 Bacteria 9125
99 Ga0207671_10057148 3300025914 Unclassified 2891
100 Ga0207671_10416329 3300025914 Bacteria 1069
101 Ga0207649_10352986 3300025920 Bacteria 1089
102 Ga0207686_10043374 3300025934 Unclassified 2755
103 Ga0207704_10018395 3300025938 Unclassified 3646
104 Ga0207691_10012727 3300025940 Bacteria 8060
105 Ga0207689_10005485 3300025942 Bacteria 11348
106 Ga0207667_10003610 3300025949 Bacteria 19086
107 Ga0207651_10056627 3300025960 Unclassified 2699
108 Ga0207658_10066639 3300025986 Unclassified 2709
109 Ga0207677_10120402 3300026023 Bacteria 1973
110 Ga0207639_10321509 3300026041 Bacteria 1374
111 Ga0207702_10000195 3300026078 Bacteria 71757
112 Ga0207702_10285374 3300026078 Bacteria 1562
113 Ga0207648_10001165 3300026089 Bacteria 29395
114 Ga0207648_10069870 3300026089 Bacteria 3061
115 Ga0207674_10009797 3300026116 Bacteria 10911
116 Ga0207674_10209114 3300026116 Bacteria 1900
117 Ga0207675_100066590 3300026118 Bacteria 3367
118 Ga0207683_10014395 3300026121 Bacteria 6735
119 Ga0207698_10001355 3300026142 Bacteria 14277
120 Ga0209995_1003775 3300027471 Bacteria 2416
121 Ga0209968_1001395 3300027526 Bacteria 3660
122 Ga0268266_10000034 3300028379 Bacteria 354251
123 Ga0268266_10258034 3300028379 Unclassified 1614
124 Ga0268264_10000436 3300028381 Bacteria 57473
125 Ga0268264_10064739 3300028381 Bacteria 3078
126 Ga0268264_10223818 3300028381 Bacteria 1733
127 Ga0265334_10010887 3300028573 Bacteria 3839
128 Ga0265318_10014083 3300028577 Unclassified 3361
129 Ga0265323_10000272 3300028653 Bacteria 30323
130 Ga0307515_10196644 3300028794 Bacteria 1906
131 Ga0265338_10011388 3300028800 Bacteria 10281
132 Ga0265338_10019426 3300028800 Bacteria 7211
133 Ga0307511_10000265 3300030521 Bacteria 54237
134 Ga0265327_10000111 3300031251 Bacteria 177959
135 Ga0265327_10013816 3300031251 Bacteria 5333
136 Ga0265316_10001815 3300031344 Bacteria 22462
137 Ga0265316_10002550 3300031344 Bacteria 18820
138 Ga0265316_10270212 3300031344 Bacteria 1244
139 Ga0307513_10043740 3300031456 Bacteria 4915
140 Ga0307513_10143391 3300031456 Bacteria 2311
141 Ga0307513_10200964 3300031456 Bacteria 1834
142 Ga0307509_10074171 3300031507 Bacteria 3540
143 Ga0265342_10073967 3300031712 Bacteria 1981
144 Ga0307405_10000006 3300031731 Bacteria 361477
145 Ga0307407_10000003 3300031903 Bacteria 271723
146 Ga0307412_10284822 3300031911 Unclassified 1299
147 Ga0307409_100031233 3300031995 Bacteria 3841
148 Ga0307416_100000002 3300032002 Bacteria 509907
149 Ga0307414_10008468 3300032004 Bacteria 5833
150 Ga0307414_10018028 3300032004 Bacteria 4334
151 Ga0307414_10105775 3300032004 Bacteria 2128
152 Ga0373935_0226588 3300035692 Bacteria 1300
153 Ga0395901_0048270 3300038443 Bacteria 4421
154 Ga0436365_1684945 3300039437 Bacteria 47686
155 Ga0439436_0010330 3300041404 Bacteria 2849
156 Ga0451797_0167851 3300041453 Bacteria 1376
157 Ga0451849_0468643 3300041505 Bacteria 1289
158 Ga0451853_0221329 3300041512 Bacteria 1194
159 Ga0439449_0031928 3300042007 Bacteria 1962
160 Ga0439449_0094038 3300042007 Bacteria 1107
161 Ga0439457_000583 3300042014 Bacteria 10682
162 Ga0439462_0043190 3300042015 Bacteria 1204
163 Ga0451577_0001966 3300042876 Bacteria 25843
164 Ga0451577_0003334 3300042876 Bacteria 18016
165 Ga0451577_0037856 3300042876 Unclassified 4341
166 Ga0451577_0075051 3300042876 Bacteria 3015
167 Ga0451577_0319606 3300042876 Unclassified 1408
168 Ga0451577_0464961 3300042876 Bacteria 1149
169 Ga0451577_0480673 3300042876 Bacteria 1128
170 Ga0451577_0710917 3300042876 Bacteria 910
171 Ga0466969_0001216 3300044656 Bacteria 13901
172 Ga0466972_0000009 3300044658 Bacteria 256374
173 Ga0466972_0002482 3300044658 Bacteria 9127
174 Ga0466972_0015910 3300044658 Bacteria 3761
175 Ga0453683_0000639 3300044673 Bacteria 37874
176 Ga0453683_0051305 3300044673 Bacteria 2584
177 Ga0453683_0073929 3300044673 Bacteria 2133
178 Ga0453683_0228718 3300044673 Bacteria 1183
179 Ga0453683_0352456 3300044673 Bacteria 945
180 Ga0466966_0000184 3300044684 Bacteria 41499
181 Ga0453684_0000170 3300044712 Bacteria 289718
182 Ga0453684_0000800 3300044712 Bacteria 107265
183 Ga0453684_0001006 3300044712 Bacteria 91343
184 Ga0453684_0008038 3300044712 Bacteria 19087
185 Ga0453684_0011653 3300044712 Bacteria 14674
186 Ga0453684_0014881 3300044712 Bacteria 12375
187 Ga0453684_0037550 3300044712 Bacteria 6647
188 Ga0453684_0052031 3300044712 Bacteria 5360
189 Ga0453684_0059653 3300044712 Bacteria 4916
190 Ga0453684_0080572 3300044712 Bacteria 4065
191 Ga0453684_0086110 3300044712 Bacteria 3900
192 Ga0453684_0086698 3300044712 Bacteria 3884
193 Ga0453684_0169020 3300044712 Bacteria 2579
194 Ga0453684_0212001 3300044712 Unclassified 2250
195 Ga0453684_0221043 3300044712 Bacteria 2194
196 Ga0453684_0278117 3300044712 Bacteria 1910
197 Ga0453684_0279997 3300044712 Bacteria 1902
198 Ga0453684_0279998 3300044712 Bacteria 1902
199 Ga0453684_0422625 3300044712 Bacteria 1488
200 Ga0466971_0073406 3300044719 Unclassified 1555
201 Ga0466968_0133229 3300044735 Bacteria 1132
202 Ga0466957_0308067 3300044842 Bacteria 1066
203 Ga0466959_0000097 3300045049 Bacteria 55620
204 Ga0451576_0000083 3300045051 Bacteria 236908
205 Ga0451576_0000760 3300045051 Bacteria 63689
206 Ga0451576_0005615 3300045051 Bacteria 15663
207 Ga0451576_0008217 3300045051 Bacteria 12279
208 Ga0451576_0009938 3300045051 Bacteria 10976
209 Ga0451576_0019731 3300045051 Bacteria 7358
210 Ga0451576_0039528 3300045051 Unclassified 4993
211 Ga0451576_0207810 3300045051 Unclassified 2044
212 Ga0451576_0319028 3300045051 Bacteria 1626
213 Ga0495592_0229094 3300046454 Bacteria 1238
214 Ga0495638_0116829 3300046460 Bacteria 1580
215 Ga0495638_0155257 3300046460 Bacteria 1325
216 Ga0495606_0014162 3300046507 Bacteria 6243
217 Ga0495610_0000263 3300046512 Bacteria 54974
218 Ga0495610_0002013 3300046512 Bacteria 17381
219 Ga0495648_0017099 3300046524 Bacteria 5198
220 Ga0495634_0027560 3300046642 Unclassified 3952
221 Ga0495687_000079 3300047443 Bacteria 147704
222 Ga0496122_0001866 3300048925 Bacteria 32082
223 Ga0496123_0007331 3300048926 Bacteria 10447
224 Ga0501223_001398 3300049663 Bacteria 5574
225 Ga0501224_014339 3300049664 Bacteria 1172
226 Ga0501238_010018 3300049671 Bacteria 1262
227 Ga0501249_015954 3300049679 Bacteria 1609
228 nmdc:mga0k408_12562_c1 3300050493 Bacteria 4631
229 nmdc:mga05p37_1224_c1 3300050507 Bacteria 29706
230 nmdc:mga09592_57494_c1 3300050508 Bacteria 3288
231 nmdc:mga0qj67_17410_c1 3300050509 Bacteria 5463
232 nmdc:mga06r32_196637_c1 3300050510 Bacteria 2004
233 Ga0500578_0000026 3300053086 Bacteria 145328
234 Ga0500578_0005869 3300053086 Bacteria 8275
235 Ga0500583_0000078 3300053092 Bacteria 58451
236 Ga0500650_0045466 3300053098 Bacteria 2034
237 Ga0500568_0018147 3300053139 Bacteria 3087
238 Ga0500622_0007767 3300053156 Bacteria 6055
239 Ga0500584_064351 3300053726 Bacteria 1619
240 2586209996 2585427687 Bacteria 5544917
241 2738725238 2738541278 Bacteria 9755573
242 2738754065 2738541283 Bacteria 7222293
243 2739587920 2739367651 Bacteria 6359826
244 2842724311 2842722452 Bacteria 6263924
245 2842913553 2842909656 Bacteria 6185908
246 2945998863 2945997725 Bacteria 6404843
247 2954021311 2954016120 Bacteria 6446024
248 Ga0495637_0012760
249 rootH1_10000227
250 Ga0065165_1000078
251 Ga0065714_10027576
252 Ga0065714_10078852
253 Ga0065714_10082249
254 Ga0065715_10023856
255 Ga0070677_10046604
256 Ga0068869_100003288
257 Ga0070666_10025647
258 Ga0070666_10060608
259 Ga0068868_100040637
260 Ga0070661_100240048
261 Ga0070668_100563846
262 Ga0070674_100150563
263 Ga0070673_100073542
264 Ga0070688_100325827
265 Ga0070667_100021322
266 Ga0070678_100021933
267 Ga0070662_100267589
268 Ga0068853_100063639
269 Ga0070672_100080001
270 Ga0070665_100000016
271 Ga0070665_100026186
272 Ga0068857_100007449
273 Ga0068857_100071061
274 Ga0068854_100101655
275 Ga0068854_100132870
276 Ga0068856_100000120
277 Ga0068856_100150436
278 Ga0068856_100332092
279 Ga0068852_100002578
280 Ga0068859_100068890
281 Ga0068861_100036561
282 Ga0068870_10012456
283 Ga0068860_100000026
284 Ga0068860_100004501
285 Ga0075366_10067660
286 Ga0097621_100038687
287 Ga0068871_100017540
288 Ga0068871_100224968
289 Ga0075430_100001704
290 Ga0075431_100001979
291 Ga0075429_100259758
292 Ga0068865_100012202
293 Ga0097620_100068891
294 Ga0105240_10001556
295 Ga0105240_10059763
296 Ga0114129_10000267
297 Ga0105241_10010017
298 Ga0105241_10011333
299 Ga0105242_10349802
300 Ga0105237_10051271
301 Ga0105237_10056747
302 Ga0105237_10100471
303 Ga0105237_10196528
304 Ga0105238_10001372
305 Ga0105238_10149974
306 Ga0105249_10072976
307 Ga0105249_10178110
308 Ga0105239_10019080
309 Ga0105239_10051217
310 Ga0105239_10164649
311 Ga0105246_10002461
312 Ga0157373_10007797
313 Ga0157373_10020295
314 Ga0157371_10003915
315 Ga0157370_10012402
316 Ga0157370_10072804
317 Ga0157369_10000023
318 Ga0157374_10300394
319 Ga0157378_10454560
320 Ga0163162_10000766
321 Ga0163162_10004654
322 Ga0163162_10007999
323 Ga0157372_10001284
324 Ga0157372_10006772
325 Ga0157372_10375317
326 Ga0157375_10418378
327 Ga0163163_10231060
328 Ga0182008_10000001
329 Ga0157376_10010817
330 Ga0182006_1000666
331 Ga0182006_1002598
332 Ga0182007_10000002
333 Ga0163161_10000496
334 Ga0163161_10001273
335 Ga0163161_10003860
336 Ga0163161_10005148
337 Ga0213876_10005890
338 Ga0209646_1002913
339 Ga0209676_1000915
340 Ga0207688_10020788
341 Ga0207680_10002865
342 Ga0207647_10026952
343 Ga0207645_10000307
344 Ga0207654_10308783
345 Ga0207671_10007909
346 Ga0207671_10057148
347 Ga0207671_10416329
348 Ga0207649_10352986
349 Ga0207686_10043374
350 Ga0207704_10018395
351 Ga0207691_10012727
352 Ga0207689_10005485
353 Ga0207667_10003610
354 Ga0207651_10056627
355 Ga0207658_10066639
356 Ga0207677_10120402
357 Ga0207639_10321509
358 Ga0207702_10000195
359 Ga0207702_10285374
360 Ga0207648_10001165
361 Ga0207648_10069870
362 Ga0207674_10009797
363 Ga0207674_10209114
364 Ga0207675_100066590
365 Ga0207683_10014395
366 Ga0207698_10001355
367 Ga0209995_1003775
368 Ga0209968_1001395
369 Ga0268266_10000034
370 Ga0268266_10258034
371 Ga0268264_10000436
372 Ga0268264_10064739
373 Ga0268264_10223818
374 Ga0265334_10010887
375 Ga0265318_10014083
376 Ga0265323_10000272
377 Ga0307515_10196644
378 Ga0265338_10011388
379 Ga0265338_10019426
380 Ga0307511_10000265
381 Ga0265327_10000111
382 Ga0265327_10013816
383 Ga0265316_10001815
384 Ga0265316_10002550
385 Ga0265316_10270212
386 Ga0307513_10043740
387 Ga0307513_10143391
388 Ga0307513_10200964
389 Ga0307509_10074171
390 Ga0265342_10073967
391 Ga0307405_10000006
392 Ga0307407_10000003
393 Ga0307412_10284822
394 Ga0307409_100031233
395 Ga0307416_100000002
396 Ga0307414_10008468
397 Ga0307414_10018028
398 Ga0307414_10105775
399 Ga0373935_0226588
400 Ga0395901_0048270
401 Ga0436365_1684945
402 Ga0439436_0010330
403 Ga0451797_0167851
404 Ga0451849_0468643
405 Ga0451853_0221329
406 Ga0439449_0031928
407 Ga0439449_0094038
408 Ga0439457_000583
409 Ga0439462_0043190
410 Ga0451577_0001966
411 Ga0451577_0003334
412 Ga0451577_0037856
413 Ga0451577_0075051
414 Ga0451577_0319606
415 Ga0451577_0464961
416 Ga0451577_0480673
417 Ga0451577_0710917
418 Ga0466969_0001216
419 Ga0466972_0000009
420 Ga0466972_0002482
421 Ga0466972_0015910
422 Ga0453683_0000639
423 Ga0453683_0051305
424 Ga0453683_0073929
425 Ga0453683_0228718
426 Ga0453683_0352456
427 Ga0466966_0000184
428 Ga0453684_0000170
429 Ga0453684_0000800
430 Ga0453684_0001006
431 Ga0453684_0008038
432 Ga0453684_0011653
433 Ga0453684_0014881
434 Ga0453684_0037550
435 Ga0453684_0052031
436 Ga0453684_0059653
437 Ga0453684_0080572
438 Ga0453684_0086110
439 Ga0453684_0086698
440 Ga0453684_0169020
441 Ga0453684_0212001
442 Ga0453684_0221043
443 Ga0453684_0278117
444 Ga0453684_0279997
445 Ga0453684_0279998
446 Ga0453684_0422625
447 Ga0466971_0073406
448 Ga0466968_0133229
449 Ga0466957_0308067
450 Ga0466959_0000097
451 Ga0451576_0000083
452 Ga0451576_0000760
453 Ga0451576_0005615
454 Ga0451576_0008217
455 Ga0451576_0009938
456 Ga0451576_0019731
457 Ga0451576_0039528
458 Ga0451576_0207810
459 Ga0451576_0319028
460 Ga0495592_0229094
461 Ga0495638_0116829
462 Ga0495638_0155257
463 Ga0495606_0014162
464 Ga0495610_0000263
465 Ga0495610_0002013
466 Ga0495648_0017099
467 Ga0495634_0027560
468 Ga0495687_000079
469 Ga0496122_0001866
470 Ga0496123_0007331
471 Ga0501223_001398
472 Ga0501224_014339
473 Ga0501238_010018
474 Ga0501249_015954
475 nmdc:mga0k408_12562_c1
476 nmdc:mga05p37_1224_c1
477 nmdc:mga09592_57494_c1
478 nmdc:mga0qj67_17410_c1
479 nmdc:mga06r32_196637_c1
480 Ga0500578_0000026
481 Ga0500578_0005869
482 Ga0500583_0000078
483 Ga0500650_0045466
484 Ga0500568_0018147
485 Ga0500622_0007767
486 Ga0500584_064351
487 2586209996
488 2738725238
489 2738754065
490 2739587920
491 2842724311
492 2842913553
493 2945998863
494 2954021311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

36

241

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.8521 87 209
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.8466 84 210
8gn9-assembly1.cif.gz_A-2 spfh domain of pyrococcus horikoshii stomatin 0.8449 87 209
7wh3-assembly1.cif.gz_A solution structure of human stomatin spfh domain in a phosphate buffer 0.8189 84 210
4fvj-assembly2.cif.gz_B spfh domain of the mouse stomatin (crystal form 2) 0.8139 84 210
ID Description Score Start End Superfamily
af_O94550_73_202_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9745 86 216 3.30.479.30
af_O35129_80_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9626 86 201 3.30.479.30
af_O49460_91_184_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9574 115 208 3.30.479.30
af_A4IAQ8_67_201_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.954 86 221 3.30.479.30
af_K7M2L3_66_170_3.30.479.30 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;Band 7 domain 0.9381 120 217 3.30.479.30
ID Description Score Start End GO Terms
AF-A0A4V1U3K4-F1-model_v4 deleted 0.9682 1 207
AF-A0A4V1U3K4-F1-model_v4 deleted 0.9636 1 207
AF-A0A452UKD5-F1-model_v4 Prohibitin 0.9592 25 226 GO:0005743
GO:0007005
GO:0071897
AF-A0A7S0IJ93-F1-model_v4 Band 7 domain-containing protein 0.9556 112 210
AF-A0A2S2QG11-F1-model_v4 Prohibitin 0.9541 66 215 GO:0005743
GO:0007005

Map