F359494

General Info

Members Datasets Scaffolds Average Seq Length
247 166 494 579

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|641522639|641645919
Length 630
Sequence RAPAQAAGRPAQAAGRPAQSAGRPAQADGRPAQSAGRHAIPVRARRPLADFSADHRVVILLAMALVVGTGGAFAALALVKLIGLVTNLAWFGRLDAEPAGLAGAPRGAWMVLAPALGGLVIGLMARFGSEKIRGHGIPEAIEAILIGGSRMSAKVALLKPLSSAISIGTGGPFGAEGPIIMTGGAIGSLFAQLFHLSAAERKTLLVSGAAAGMTAIFGTPVAALLLAVELLLFEWRPRSFIPVAAAAAVATGWRPLLFGAGPLFPFAAVPDLPGWGLLSCAGLGVAAGLLSGLLTKLLYGLEDAFERLPVHWMWWPALGGLVVGAGGLVEPRALGIGYDVIADLLGGRPGAGAVLTLLAVKALIWLVALSSGTSGGVLAPLLILGGAMGWLLGHAAGLPGEAGFWALLGMAAMLGGTMRAPLTGALFAVELTGEVRALAPLLAATVAAYAVTVLLLKRSILTEKIARRGQHVTREYGVDPYELTRVAEVMVREVDVLPADLPVAEALAAIEAGRHRAYPVVDAARRPVGLVTRADALRWAVEEGRGAAHPGERLEERVSDASLAVVHPRDVVARAIDVMMESDQGRIPVTDPRTGALVGLVSRKDLLRVRAAVIRAEAERRPYLVRGRGG

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
119 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
123 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
124 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
125 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
159 641522639 Methylobacterium sp. 4-46 Isolate Nodule
160 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
161 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
162 2643221584 Caulobacter sp. Root656 Isolate Unclassified
163 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
164 2751185800 Brucella pituitosa AA2 Isolate Unclassified
165 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
166 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.5
Nodule 1.21
Rhizoplane 6.48
Rhizosphere 78.14
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000285 3300003187 Bacteria 57259
2 JGI25165J46597_1000209 3300003214 Bacteria 83865
3 JGI25153J46596_10002433 3300003215 Bacteria 10743
4 Ga0055537_1001690 3300003773 Bacteria 8171
5 Ga0055536_1006948 3300003781 Bacteria 5154
6 Ga0055530_10006770 3300003791 Bacteria 5001
7 Ga0058692_1001121 3300003856 Bacteria 10367
8 Ga0070658_10009257 3300005327 Bacteria 7919
9 Ga0070690_100016467 3300005330 Bacteria 4430
10 Ga0070670_100033768 3300005331 Bacteria 4405
11 Ga0070666_10004411 3300005335 Bacteria 8569
12 Ga0070680_100000194 3300005336 Bacteria 39385
13 Ga0070680_100017134 3300005336 Bacteria 5708
14 Ga0070680_100035123 3300005336 Bacteria 4046
15 Ga0070680_100072082 3300005336 Bacteria 2839
16 Ga0068868_100103644 3300005338 Bacteria 2305
17 Ga0068868_100115674 3300005338 Bacteria 2183
18 Ga0070689_100044466 3300005340 Bacteria 3417
19 Ga0070689_100050970 3300005340 Bacteria 3198
20 Ga0070675_100014508 3300005354 Bacteria 6214
21 Ga0070671_100003409 3300005355 Bacteria 12403
22 Ga0070673_100131876 3300005364 Bacteria 2098
23 Ga0070667_100000989 3300005367 Bacteria 26078
24 Ga0070714_100005573 3300005435 Bacteria 9617
25 Ga0070714_100019431 3300005435 Bacteria 5536
26 Ga0070681_10001021 3300005458 Bacteria 23710
27 Ga0070681_10003391 3300005458 Bacteria 14910
28 Ga0070681_10003708 3300005458 Bacteria 14341
29 Ga0070681_10013324 3300005458 Bacteria 8172
30 Ga0070681_10139981 3300005458 Bacteria 2350
31 Ga0070679_100000131 3300005530 Bacteria 60170
32 Ga0070679_100000441 3300005530 Bacteria 35288
33 Ga0070679_100027198 3300005530 Bacteria 5627
34 Ga0070679_100070055 3300005530 Bacteria 3498
35 Ga0070684_100123842 3300005535 Bacteria 2327
36 Ga0068853_100053114 3300005539 Bacteria 3490
37 Ga0070695_100042437 3300005545 Bacteria 2888
38 Ga0070696_100022419 3300005546 Bacteria 4289
39 Ga0070665_100073788 3300005548 Bacteria 3417
40 Ga0070665_100129328 3300005548 Bacteria 2527
41 Ga0068855_100003301 3300005563 Bacteria 19747
42 Ga0068855_100009039 3300005563 Bacteria 12040
43 Ga0070664_100011077 3300005564 Bacteria 7312
44 Ga0068856_100068949 3300005614 Bacteria 3496
45 Ga0068859_100000645 3300005617 Bacteria 34867
46 Ga0068864_100002911 3300005618 Bacteria 14157
47 Ga0068866_10018269 3300005718 Bacteria 3168
48 Ga0068863_100002762 3300005841 Bacteria 17386
49 Ga0068863_100014543 3300005841 Bacteria 7576
50 Ga0068863_100022796 3300005841 Bacteria 5981
51 Ga0068863_100080578 3300005841 Bacteria 3083
52 Ga0068858_100003319 3300005842 Bacteria 16028
53 Ga0068860_100031791 3300005843 Bacteria 5075
54 Ga0068860_100202341 3300005843 Bacteria 1925
55 Ga0097621_100004101 3300006237 Bacteria 10106
56 Ga0097621_100026222 3300006237 Bacteria 4569
57 Ga0068871_100097733 3300006358 Bacteria 2455
58 Ga0068865_100015294 3300006881 Bacteria 4893
59 Ga0097620_100000645 3300006931 Bacteria 34867
60 Ga0105244_10000405 3300009036 Bacteria 40189
61 Ga0105240_10003765 3300009093 Bacteria 23440
62 Ga0105240_10005107 3300009093 Bacteria 19644
63 Ga0105240_10008454 3300009093 Bacteria 14724
64 Ga0105240_10019434 3300009093 Bacteria 9075
65 Ga0105240_10021954 3300009093 Bacteria 8478
66 Ga0114129_10000801 3300009147 Bacteria 40306
67 Ga0105241_10028020 3300009174 Bacteria 4195
68 Ga0105248_10014929 3300009177 Bacteria 8551
69 Ga0105248_10074520 3300009177 Bacteria 3815
70 Ga0105237_10000053 3300009545 Bacteria 158890
71 Ga0105237_10048676 3300009545 Bacteria 4260
72 Ga0105237_10063495 3300009545 Bacteria 3690
73 Ga0105237_10087460 3300009545 Bacteria 3105
74 Ga0105237_10127138 3300009545 Bacteria 2543
75 Ga0105238_10000393 3300009551 Bacteria 46691
76 Ga0105238_10020980 3300009551 Bacteria 6656
77 Ga0105238_10138034 3300009551 Bacteria 2416
78 Ga0105239_10000587 3300010375 Bacteria 51834
79 Ga0105239_10033169 3300010375 Bacteria 5671
80 Ga0105239_10083814 3300010375 Bacteria 3511
81 Ga0105239_10234948 3300010375 Bacteria 2057
82 Ga0157370_10001131 3300013104 Bacteria 33342
83 Ga0157374_10001464 3300013296 Bacteria 19954
84 Ga0157378_10070726 3300013297 Bacteria 3133
85 Ga0163162_10017639 3300013306 Bacteria 6983
86 Ga0157372_10002969 3300013307 Bacteria 18268
87 Ga0157372_10055600 3300013307 Bacteria 4420
88 Ga0157372_10074957 3300013307 Bacteria 3817
89 Ga0157375_10005061 3300013308 Bacteria 11442
90 Ga0157375_10014529 3300013308 Bacteria 7027
91 Ga0163163_10000002 3300014325 Bacteria 609846
92 Ga0163163_10001290 3300014325 Bacteria 21168
93 Ga0157379_10011394 3300014968 Bacteria 7757
94 Ga0157376_10010303 3300014969 Bacteria 6828
95 Ga0157376_10041011 3300014969 Bacteria 3787
96 Ga0213876_10000186 3300021384 Bacteria 64451
97 Ga0209233_1000013 3300025261 Bacteria 1013785
98 Ga0209565_1000307 3300025263 Bacteria 45852
99 Ga0209673_1001144 3300025273 Bacteria 29122
100 Ga0209130_1000263 3300025284 Bacteria 65894
101 Ga0209676_1000171 3300025292 Bacteria 154045
102 Ga0209025_1000114 3300025294 Bacteria 218921
103 Ga0209564_1019002 3300025295 Bacteria 2588
104 Ga0209758_1000013 3300025297 Bacteria 873003
105 Ga0209758_1001611 3300025297 Bacteria 25781
106 Ga0209050_1000834 3300025298 Bacteria 42660
107 Ga0209256_1007088 3300025299 Bacteria 5662
108 Ga0207426_1000436 3300025302 Bacteria 67619
109 Ga0209051_1001120 3300025303 Bacteria 24491
110 Ga0209257_1005389 3300025304 Bacteria 9012
111 Ga0207655_1000030 3300025728 Bacteria 413221
112 Ga0207680_10008099 3300025903 Bacteria 5150
113 Ga0207680_10009467 3300025903 Bacteria 4835
114 Ga0207699_10030552 3300025906 Bacteria 3016
115 Ga0207705_10081304 3300025909 Bacteria 2361
116 Ga0207707_10000025 3300025912 Bacteria 175152
117 Ga0207707_10000123 3300025912 Bacteria 80128
118 Ga0207695_10003200 3300025913 Bacteria 23328
119 Ga0207695_10003645 3300025913 Bacteria 21516
120 Ga0207695_10004775 3300025913 Bacteria 18329
121 Ga0207695_10021763 3300025913 Bacteria 7304
122 Ga0207695_10040803 3300025913 Bacteria 4972
123 Ga0207695_10065114 3300025913 Bacteria 3748
124 Ga0207671_10080023 3300025914 Bacteria 2449
125 Ga0207660_10000263 3300025917 Bacteria 34361
126 Ga0207660_10000664 3300025917 Bacteria 22972
127 Ga0207660_10007350 3300025917 Bacteria 7129
128 Ga0207657_10022624 3300025919 Bacteria 5876
129 Ga0207652_10000238 3300025921 Bacteria 57391
130 Ga0207652_10003226 3300025921 Bacteria 13557
131 Ga0207652_10026746 3300025921 Bacteria 4808
132 Ga0207694_10004228 3300025924 Bacteria 11240
133 Ga0207694_10041984 3300025924 Bacteria 3526
134 Ga0207650_10026190 3300025925 Bacteria 4157
135 Ga0207659_10029968 3300025926 Bacteria 3712
136 Ga0207664_10036522 3300025929 Bacteria 3798
137 Ga0207704_10008393 3300025938 Bacteria 4938
138 Ga0207691_10023252 3300025940 Bacteria 5835
139 Ga0207711_10000511 3300025941 Bacteria 39835
140 Ga0207711_10079968 3300025941 Unclassified 2854
141 Ga0207661_10113315 3300025944 Bacteria 2298
142 Ga0207667_10002092 3300025949 Bacteria 25018
143 Ga0207667_10003070 3300025949 Bacteria 20700
144 Ga0207651_10090909 3300025960 Bacteria 2233
145 Ga0207703_10040916 3300026035 Bacteria 3711
146 Ga0207639_10003735 3300026041 Bacteria 10246
147 Ga0207639_10038044 3300026041 Bacteria 3577
148 Ga0207702_10022188 3300026078 Bacteria 5262
149 Ga0207641_10027635 3300026088 Bacteria 4686
150 Ga0207676_10072078 3300026095 Bacteria 2775
151 Ga0207683_10003642 3300026121 Bacteria 13403
152 Ga0209371_1000199 3300027312 Bacteria 87337
153 Ga0268266_10000995 3300028379 Bacteria 35751
154 Ga0268266_10002472 3300028379 Bacteria 19757
155 Ga0268264_10003718 3300028381 Bacteria 13110
156 Ga0307515_10082351 3300028794 Bacteria 4164
157 Ga0265338_10011125 3300028800 Bacteria 10431
158 Ga0265331_10008815 3300031250 Bacteria 5712
159 Ga0265316_10048583 3300031344 Bacteria 3348
160 Ga0265313_10000941 3300031595 Bacteria 28889
161 Ga0265342_10007681 3300031712 Bacteria 7856
162 Ga0373937_0066155 3300036401 Bacteria 3328
163 Ga0395900_0067409 3300037418 Bacteria 3677
164 Ga0395898_0031075 3300037466 Bacteria 5341
165 Ga0395898_0224221 3300037466 Bacteria 1793
166 Ga0395905_0005843 3300037471 Bacteria 12507
167 Ga0436364_0270956 3300037853 Bacteria 13964
168 Ga0395901_0023158 3300038443 Bacteria 6367
169 Ga0436363_1372628 3300039450 Bacteria 2032
170 Ga0466969_0022405 3300044656 Bacteria 3260
171 Ga0466961_0006276 3300044693 Bacteria 7549
172 Ga0453684_0138694 3300044712 Bacteria 2908
173 Ga0453684_0219448 3300044712 Bacteria 2203
174 Ga0466957_0077252 3300044842 Bacteria 2069
175 Ga0495606_0017272 3300046507 Bacteria 5464
176 Ga0495610_0000024 3300046512 Bacteria 304748
177 Ga0495632_0001149 3300046519 Bacteria 22554
178 Ga0495667_0059902 3300046559 Bacteria 2498
179 Ga0495625_0000127 3300046660 Bacteria 118526
180 Ga0495625_0002058 3300046660 Bacteria 22563
181 Ga0495673_0000614 3300047469 Bacteria 35232
182 Ga0495686_0017739 3300047472 Bacteria 4791
183 Ga0496100_0069196 3300048903 Bacteria 2350
184 Ga0496101_0023944 3300048904 Bacteria 4222
185 Ga0496101_0061951 3300048904 Bacteria 2719
186 Ga0496102_0002697 3300048905 Bacteria 15095
187 Ga0496102_0040414 3300048905 Bacteria 4219
188 Ga0496103_0058157 3300048906 Bacteria 2402
189 Ga0496104_0041460 3300048907 Bacteria 4317
190 Ga0496106_0000977 3300048909 Bacteria 20836
191 Ga0496106_0009374 3300048909 Bacteria 7236
192 Ga0496107_0000266 3300048910 Bacteria 27680
193 Ga0496107_0043011 3300048910 Bacteria 3245
194 Ga0496108_0001798 3300048911 Bacteria 17085
195 Ga0496109_0015622 3300048912 Bacteria 6622
196 Ga0496112_0104985 3300048915 Bacteria 2795
197 Ga0496113_0008807 3300048916 Bacteria 6592
198 Ga0496115_0002798 3300048918 Bacteria 12538
199 Ga0496119_0025139 3300048922 Bacteria 4167
200 Ga0496121_0000913 3300048924 Bacteria 53289
201 Ga0496121_0007067 3300048924 Bacteria 13630
202 Ga0496122_0007385 3300048925 Bacteria 12242
203 Ga0496125_0000106 3300048928 Bacteria 199193
204 Ga0501032_0002537 3300049569 Bacteria 14292
205 Ga0501032_0043314 3300049569 Bacteria 3050
206 Ga0501033_0019087 3300049570 Bacteria 5184
207 Ga0501033_0022853 3300049570 Bacteria 4714
208 Ga0501034_0060441 3300049571 Bacteria 3806
209 Ga0501037_0023482 3300049573 Bacteria 4560
210 Ga0501037_0091637 3300049573 Bacteria 2198
211 Ga0501043_0017906 3300049579 Bacteria 5556
212 Ga0501043_0136001 3300049579 Bacteria 1925
213 Ga0501046_0000094 3300049580 Bacteria 96222
214 Ga0501046_0003122 3300049580 Bacteria 15293
215 Ga0501046_0046511 3300049580 Bacteria 3444
216 Ga0501047_0006183 3300049581 Bacteria 11259
217 Ga0501047_0021706 3300049581 Bacteria 6164
218 Ga0501047_0039121 3300049581 Bacteria 4588
219 Ga0501047_0068142 3300049581 Bacteria 3428
220 Ga0501047_0072640 3300049581 Bacteria 3311
221 Ga0501070_0204176 3300049586 Bacteria 1623
222 Ga0501073_0020745 3300049589 Bacteria 4739
223 Ga0501080_0008453 3300049742 Bacteria 9327
224 Ga0501080_0036849 3300049742 Bacteria 4566
225 Ga0501080_0132330 3300049742 Bacteria 2309
226 Ga0501083_0017328 3300049744 Bacteria 5022
227 Ga0501035_0011707 3300049822 Bacteria 8127
228 Ga0501044_0001125 3300049823 Bacteria 31755
229 Ga0501044_0002391 3300049823 Bacteria 21398
230 Ga0501044_0022514 3300049823 Bacteria 6713
231 Ga0501044_0061916 3300049823 Bacteria 3827
232 Ga0501044_0119863 3300049823 Bacteria 2633
233 nmdc:mga05p37_1998_c1 3300050507 Bacteria 23813
234 nmdc:mga0n895_37598_c1 3300050512 Bacteria 4684
235 nmdc:mga0n895_7518_c1 3300050512 Bacteria 9358
236 Ga0495601_0019602 3300053077 Bacteria 4127
237 Ga0500658_0003530 3300053134 Bacteria 5902
238 Ga0501082_0035337 3300060353 Bacteria 4307
239 Ga0466962_0005076 3300061719 Bacteria 6332
240 641645919 641522639 Bacteria 7737025
241 2545673057 2545555834 Bacteria 8130841
242 2643749853 2643221545 Bacteria 5083237
243 2643929547 2643221584 Bacteria 5511711
244 2644508808 2643221691 Bacteria 5093099
245 2753361390 2751185800 Bacteria 5467370
246 2821448765 2821443989 Bacteria 7658172
247 8024486710 8024486573 Bacteria 6540512
248 JGI25151J46595_10000285
249 JGI25165J46597_1000209
250 JGI25153J46596_10002433
251 Ga0055537_1001690
252 Ga0055536_1006948
253 Ga0055530_10006770
254 Ga0058692_1001121
255 Ga0070658_10009257
256 Ga0070690_100016467
257 Ga0070670_100033768
258 Ga0070666_10004411
259 Ga0070680_100000194
260 Ga0070680_100017134
261 Ga0070680_100035123
262 Ga0070680_100072082
263 Ga0068868_100103644
264 Ga0068868_100115674
265 Ga0070689_100044466
266 Ga0070689_100050970
267 Ga0070675_100014508
268 Ga0070671_100003409
269 Ga0070673_100131876
270 Ga0070667_100000989
271 Ga0070714_100005573
272 Ga0070714_100019431
273 Ga0070681_10001021
274 Ga0070681_10003391
275 Ga0070681_10003708
276 Ga0070681_10013324
277 Ga0070681_10139981
278 Ga0070679_100000131
279 Ga0070679_100000441
280 Ga0070679_100027198
281 Ga0070679_100070055
282 Ga0070684_100123842
283 Ga0068853_100053114
284 Ga0070695_100042437
285 Ga0070696_100022419
286 Ga0070665_100073788
287 Ga0070665_100129328
288 Ga0068855_100003301
289 Ga0068855_100009039
290 Ga0070664_100011077
291 Ga0068856_100068949
292 Ga0068859_100000645
293 Ga0068864_100002911
294 Ga0068866_10018269
295 Ga0068863_100002762
296 Ga0068863_100014543
297 Ga0068863_100022796
298 Ga0068863_100080578
299 Ga0068858_100003319
300 Ga0068860_100031791
301 Ga0068860_100202341
302 Ga0097621_100004101
303 Ga0097621_100026222
304 Ga0068871_100097733
305 Ga0068865_100015294
306 Ga0097620_100000645
307 Ga0105244_10000405
308 Ga0105240_10003765
309 Ga0105240_10005107
310 Ga0105240_10008454
311 Ga0105240_10019434
312 Ga0105240_10021954
313 Ga0114129_10000801
314 Ga0105241_10028020
315 Ga0105248_10014929
316 Ga0105248_10074520
317 Ga0105237_10000053
318 Ga0105237_10048676
319 Ga0105237_10063495
320 Ga0105237_10087460
321 Ga0105237_10127138
322 Ga0105238_10000393
323 Ga0105238_10020980
324 Ga0105238_10138034
325 Ga0105239_10000587
326 Ga0105239_10033169
327 Ga0105239_10083814
328 Ga0105239_10234948
329 Ga0157370_10001131
330 Ga0157374_10001464
331 Ga0157378_10070726
332 Ga0163162_10017639
333 Ga0157372_10002969
334 Ga0157372_10055600
335 Ga0157372_10074957
336 Ga0157375_10005061
337 Ga0157375_10014529
338 Ga0163163_10000002
339 Ga0163163_10001290
340 Ga0157379_10011394
341 Ga0157376_10010303
342 Ga0157376_10041011
343 Ga0213876_10000186
344 Ga0209233_1000013
345 Ga0209565_1000307
346 Ga0209673_1001144
347 Ga0209130_1000263
348 Ga0209676_1000171
349 Ga0209025_1000114
350 Ga0209564_1019002
351 Ga0209758_1000013
352 Ga0209758_1001611
353 Ga0209050_1000834
354 Ga0209256_1007088
355 Ga0207426_1000436
356 Ga0209051_1001120
357 Ga0209257_1005389
358 Ga0207655_1000030
359 Ga0207680_10008099
360 Ga0207680_10009467
361 Ga0207699_10030552
362 Ga0207705_10081304
363 Ga0207707_10000025
364 Ga0207707_10000123
365 Ga0207695_10003200
366 Ga0207695_10003645
367 Ga0207695_10004775
368 Ga0207695_10021763
369 Ga0207695_10040803
370 Ga0207695_10065114
371 Ga0207671_10080023
372 Ga0207660_10000263
373 Ga0207660_10000664
374 Ga0207660_10007350
375 Ga0207657_10022624
376 Ga0207652_10000238
377 Ga0207652_10003226
378 Ga0207652_10026746
379 Ga0207694_10004228
380 Ga0207694_10041984
381 Ga0207650_10026190
382 Ga0207659_10029968
383 Ga0207664_10036522
384 Ga0207704_10008393
385 Ga0207691_10023252
386 Ga0207711_10000511
387 Ga0207711_10079968
388 Ga0207661_10113315
389 Ga0207667_10002092
390 Ga0207667_10003070
391 Ga0207651_10090909
392 Ga0207703_10040916
393 Ga0207639_10003735
394 Ga0207639_10038044
395 Ga0207702_10022188
396 Ga0207641_10027635
397 Ga0207676_10072078
398 Ga0207683_10003642
399 Ga0209371_1000199
400 Ga0268266_10000995
401 Ga0268266_10002472
402 Ga0268264_10003718
403 Ga0307515_10082351
404 Ga0265338_10011125
405 Ga0265331_10008815
406 Ga0265316_10048583
407 Ga0265313_10000941
408 Ga0265342_10007681
409 Ga0373937_0066155
410 Ga0395900_0067409
411 Ga0395898_0031075
412 Ga0395898_0224221
413 Ga0395905_0005843
414 Ga0436364_0270956
415 Ga0395901_0023158
416 Ga0436363_1372628
417 Ga0466969_0022405
418 Ga0466961_0006276
419 Ga0453684_0138694
420 Ga0453684_0219448
421 Ga0466957_0077252
422 Ga0495606_0017272
423 Ga0495610_0000024
424 Ga0495632_0001149
425 Ga0495667_0059902
426 Ga0495625_0000127
427 Ga0495625_0002058
428 Ga0495673_0000614
429 Ga0495686_0017739
430 Ga0496100_0069196
431 Ga0496101_0023944
432 Ga0496101_0061951
433 Ga0496102_0002697
434 Ga0496102_0040414
435 Ga0496103_0058157
436 Ga0496104_0041460
437 Ga0496106_0000977
438 Ga0496106_0009374
439 Ga0496107_0000266
440 Ga0496107_0043011
441 Ga0496108_0001798
442 Ga0496109_0015622
443 Ga0496112_0104985
444 Ga0496113_0008807
445 Ga0496115_0002798
446 Ga0496119_0025139
447 Ga0496121_0000913
448 Ga0496121_0007067
449 Ga0496122_0007385
450 Ga0496125_0000106
451 Ga0501032_0002537
452 Ga0501032_0043314
453 Ga0501033_0019087
454 Ga0501033_0022853
455 Ga0501034_0060441
456 Ga0501037_0023482
457 Ga0501037_0091637
458 Ga0501043_0017906
459 Ga0501043_0136001
460 Ga0501046_0000094
461 Ga0501046_0003122
462 Ga0501046_0046511
463 Ga0501047_0006183
464 Ga0501047_0021706
465 Ga0501047_0039121
466 Ga0501047_0068142
467 Ga0501047_0072640
468 Ga0501070_0204176
469 Ga0501073_0020745
470 Ga0501080_0008453
471 Ga0501080_0036849
472 Ga0501080_0132330
473 Ga0501083_0017328
474 Ga0501035_0011707
475 Ga0501044_0001125
476 Ga0501044_0002391
477 Ga0501044_0022514
478 Ga0501044_0061916
479 Ga0501044_0119863
480 nmdc:mga05p37_1998_c1
481 nmdc:mga0n895_37598_c1
482 nmdc:mga0n895_7518_c1
483 Ga0495601_0019602
484 Ga0500658_0003530
485 Ga0501082_0035337
486 Ga0466962_0005076
487 641645919
488 2545673057
489 2643749853
490 2643929547
491 2644508808
492 2753361390
493 2821448765
494 8024486710

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00654

Voltage_CLC

Voltage gated chloride channel

117

453

0.98

PF00571

CBS

CBS domain

486

542

0.93

PF00571

CBS

CBS domain

557

612

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v2j-assembly1.cif.gz_A-2 crystal structure of clc-ec1 triple mutant (e113q, e148q, e203q) 0.8935 27 438
3det-assembly1.cif.gz_A structure of the e148a, y445a doubly ungated mutant of e.coli clc_ec1, cl-/h+ antiporter 0.8928 30 438
2ht3-assembly1.cif.gz_B structure of the escherichia coli clc chloride channel y445l mutant and fab complex 0.8889 26 438
2ht4-assembly1.cif.gz_B structure of the escherichia coli clc chloride channel y445w mutant and fab complex 0.886 30 438
1ott-assembly1.cif.gz_B structure of the escherichia coli clc chloride channel e148a mutant and fab complex 0.8855 30 438
ID Description Score Start End Superfamily
af_Q57753_14_393_1.10.3080.10 Mainly Alpha;Orthogonal Bundle;Clc chloride channel;Clc chloride channel 0.9083 29 430 1.10.3080.10
af_P76175_1_418_1.10.3080.10 Mainly Alpha;Orthogonal Bundle;Clc chloride channel;Clc chloride channel 0.9018 30 438 1.10.3080.10
af_Q57753_14_393_1.10.3080.10 Mainly Alpha;Orthogonal Bundle;Clc chloride channel;Clc chloride channel 0.8948 29 430 1.10.3080.10
af_P76175_1_418_1.10.3080.10 Mainly Alpha;Orthogonal Bundle;Clc chloride channel;Clc chloride channel 0.8813 30 438 1.10.3080.10
2yzqA01 Alpha Beta;Roll;CBS-domain;CBS-domain 0.8709 454 578 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A2X0IIZ7-F1-model_v4 Chloride channel protein 0.9668 30 452 GO:0005247
GO:0016020
AF-A0A6N6VT00-F1-model_v4 Chloride channel protein 0.9617 25 449 GO:0005247
GO:0016020
AF-A0A2X0IIZ7-F1-model_v4 Chloride channel protein 0.9557 30 452 GO:0005247
GO:0016020
AF-A0A1G0GHV7-F1-model_v4 Chloride channel protein 0.9508 24 444 GO:0005247
GO:0034707
AF-A0A3M2BDJ4-F1-model_v4 Chloride channel protein 0.9502 71 419 GO:0005247
GO:0016020

Map