F359545

General Info

Members Datasets Scaffolds Average Seq Length
248 186 240 219

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10048108|rootL2_100481082
Length 241
Sequence VGGEGWVGKPVKSGDQYSTRTKEMMKTLGLIHTSAALVPVFQQLCSQHIPQVQVFNIVDDSLIKNVIKNGSLLPVTARRVVDYAASAEAAGADYIMVTCSSIGAAVETAAGLTKVPVLRVDQPMADRAVQTGARIGVIATLPTTLAPTSDLVRRRALAARKEIELRSVLCEGAFDALMSGDGAKHDTMVAAALRELVTKTDVIVLAQASMARVVDTLSEADRRVPILASPGIAVQYLSTVL

Samples

Sample ID Description Type Environment
1 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
6 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
7 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
70 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
71 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
99 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
104 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
105 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
106 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
107 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
124 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
125 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
126 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
127 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
161 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
164 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
165 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
166 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
167 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
168 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
172 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
175 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
176 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
177 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
178 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
179 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
180 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
181 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
182 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
183 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
184 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
185 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
186 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 0
Isolates 3.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.9
Nodule 0
Rhizoplane 1.21
Rhizosphere 74.19
Stem 0
Stem Tuber 0
Unclassified 11.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000019 3300002774 Bacteria 135244
2 JGI25151J46595_10000074 3300003187 Bacteria 135244
3 JGI25153J46596_10000056 3300003215 Bacteria 135244
4 rootH2_10060522 3300003320 Bacteria 3482
5 rootH2_10238768 3300003320 Bacteria 1907
6 rootL2_10048108 3300003322 Bacteria 2514
7 rootL2_10053677 3300003322 Unclassified 1717
8 rootH1_10008837 3300003323 Bacteria 37199
9 rootH1_10040548 3300003323 Bacteria 1939
10 rootH1_10068235 3300003323 Bacteria 3649
11 rootH1_10218069 3300003323 Unclassified 1939
12 rootH1_10242162 3300003323 Bacteria 2661
13 Ga0065165_1000339 3300005262 Bacteria 76812
14 Ga0065714_10070164 3300005288 Bacteria 3950
15 Ga0065704_10136607 3300005289 Bacteria 1564
16 Ga0065715_10200536 3300005293 Bacteria 1363
17 Ga0065715_10533120 3300005293 Bacteria 754
18 Ga0070658_10070195 3300005327 Unclassified 2867
19 Ga0070676_10304497 3300005328 Bacteria 1082
20 Ga0070683_100060497 3300005329 Unclassified 3520
21 Ga0070683_100543049 3300005329 Bacteria 1111
22 Ga0070670_100327755 3300005331 Bacteria 1342
23 Ga0070670_100749402 3300005331 Bacteria 880
24 Ga0068869_100069772 3300005334 Bacteria 2599
25 Ga0070666_10381872 3300005335 Unclassified 1011
26 Ga0068868_100643489 3300005338 Unclassified 943
27 Ga0070691_10022422 3300005341 Unclassified 2929
28 Ga0070668_100041352 3300005347 Bacteria 3532
29 Ga0070673_100137853 3300005364 Bacteria 2056
30 Ga0070659_100000283 3300005366 Bacteria 39665
31 Ga0070667_100913800 3300005367 Bacteria 817
32 Ga0070678_100233600 3300005456 Bacteria 1534
33 Ga0070681_10287290 3300005458 Bacteria 1555
34 Ga0068867_100064220 3300005459 Bacteria 2729
35 Ga0068853_100025420 3300005539 Bacteria 4968
36 Ga0070665_100422790 3300005548 Bacteria 1341
37 Ga0068855_100001483 3300005563 Bacteria 29355
38 Ga0068855_100257741 3300005563 Bacteria 1944
39 Ga0068854_100257330 3300005578 Unclassified 1396
40 Ga0068854_100322610 3300005578 Bacteria 1256
41 Ga0068856_100132545 3300005614 Bacteria 2497
42 Ga0068856_100238189 3300005614 Unclassified 1835
43 Ga0068852_100028629 3300005616 Bacteria 4564
44 Ga0068852_100270070 3300005616 Unclassified 1636
45 Ga0068863_100224306 3300005841 Bacteria 1811
46 Ga0068862_100083797 3300005844 Bacteria 2769
47 Ga0068862_100905987 3300005844 Unclassified 867
48 Ga0081455_10167641 3300005937 Bacteria 1676
49 Ga0075366_10265420 3300006195 Bacteria 1048
50 Ga0068871_100840236 3300006358 Bacteria 848
51 Ga0075428_100012570 3300006844 Bacteria 9413
52 Ga0075430_100005702 3300006846 Bacteria 10506
53 Ga0075430_100066889 3300006846 Bacteria 3017
54 Ga0075431_100035374 3300006847 Bacteria 5143
55 Ga0075434_100490657 3300006871 Unclassified 1249
56 Ga0075429_100290753 3300006880 Bacteria 1431
57 Ga0105240_10000592 3300009093 Bacteria 67301
58 Ga0111539_10111813 3300009094 Bacteria 3205
59 Ga0111539_10588949 3300009094 Unclassified 1295
60 Ga0114129_10000792 3300009147 Bacteria 40543
61 Ga0114129_10152415 3300009147 Bacteria 3163
62 Ga0105243_10782571 3300009148 Bacteria 938
63 Ga0105241_10014828 3300009174 Bacteria 5706
64 Ga0105241_10069921 3300009174 Bacteria 2723
65 Ga0105237_10003831 3300009545 Bacteria 17683
66 Ga0105238_10025018 3300009551 Bacteria 6086
67 Ga0105239_10001332 3300010375 Bacteria 33262
68 Ga0105239_10002179 3300010375 Bacteria 25167
69 Ga0157373_10000113 3300013100 Bacteria 63950
70 Ga0157373_10007331 3300013100 Bacteria 8214
71 Ga0157371_10011735 3300013102 Bacteria 6732
72 Ga0157371_10148525 3300013102 Bacteria 1671
73 Ga0157370_10080551 3300013104 Bacteria 3065
74 Ga0157369_10001781 3300013105 Bacteria 26087
75 Ga0157369_10036558 3300013105 Bacteria 5379
76 Ga0157378_10522814 3300013297 Bacteria 1188
77 Ga0157378_10544771 3300013297 Bacteria 1165
78 Ga0157372_10000021 3300013307 Bacteria 207801
79 Ga0157372_10069978 3300013307 Unclassified 3947
80 Ga0157372_10087927 3300013307 Bacteria 3527
81 Ga0157372_10116189 3300013307 Bacteria 3068
82 Ga0157372_10810554 3300013307 Bacteria 1087
83 Ga0157372_11448536 3300013307 Bacteria 791
84 Ga0157375_11509333 3300013308 Bacteria 793
85 Ga0163163_10374908 3300014325 Unclassified 1480
86 Ga0163163_10388468 3300014325 Bacteria 1453
87 Ga0157376_11316132 3300014969 Bacteria 753
88 Ga0182006_1050709 3300015261 Bacteria 1598
89 Ga0163161_10068441 3300017792 Bacteria 2594
90 Ga0207425_1000007 3300025245 Bacteria 777411
91 Ga0209026_1000521 3300025250 Bacteria 27122
92 Ga0209129_1000006 3300025258 Bacteria 777761
93 Ga0209233_1009111 3300025261 Bacteria 3036
94 Ga0209233_1053255 3300025261 Bacteria 812
95 Ga0209676_1000232 3300025292 Bacteria 120363
96 Ga0209025_1000025 3300025294 Bacteria 524454
97 Ga0209758_1000016 3300025297 Bacteria 778557
98 Ga0209050_1023496 3300025298 Bacteria 2167
99 Ga0207680_10351772 3300025903 Unclassified 1035
100 Ga0207645_10030391 3300025907 Bacteria 3480
101 Ga0207654_10048933 3300025911 Unclassified 2422
102 Ga0207695_10000048 3300025913 Bacteria 421800
103 Ga0207671_10039880 3300025914 Bacteria 3477
104 Ga0207657_10066257 3300025919 Unclassified 3075
105 Ga0207650_10090861 3300025925 Bacteria 2332
106 Ga0207690_10002858 3300025932 Bacteria 10408
107 Ga0207689_10210987 3300025942 Bacteria 1604
108 Ga0207661_10116380 3300025944 Bacteria 2269
109 Ga0207668_10766078 3300025972 Bacteria 852
110 Ga0207640_10402889 3300025981 Bacteria 1115
111 Ga0207703_10373295 3300026035 Bacteria 1318
112 Ga0207639_10502580 3300026041 Bacteria 1108
113 Ga0207702_10198756 3300026078 Unclassified 1857
114 Ga0207641_10180531 3300026088 Bacteria 1933
115 Ga0207648_10012385 3300026089 Bacteria 7985
116 Ga0207648_10782352 3300026089 Unclassified 887
117 Ga0207698_10021054 3300026142 Bacteria 4502
118 Ga0268266_10886216 3300028379 Unclassified 863
119 Ga0268265_10562566 3300028380 Bacteria 1084
120 Ga0268264_10828395 3300028381 Bacteria 926
121 Ga0307515_10031909 3300028794 Bacteria 8751
122 Ga0307512_10106599 3300030522 Bacteria 1869
123 Ga0316181_1032274 3300030744 Bacteria 1656
124 Ga0265328_10065388 3300031239 Bacteria 1336
125 Ga0265325_10174894 3300031241 Bacteria 1003
126 Ga0307513_10194353 3300031456 Bacteria 1877
127 Ga0307513_10235553 3300031456 Bacteria 1640
128 Ga0307513_10422424 3300031456 Bacteria 1063
129 Ga0307509_10045269 3300031507 Bacteria 4747
130 Ga0307509_10078435 3300031507 Bacteria 3422
131 Ga0307509_10085713 3300031507 Bacteria 3241
132 Ga0307509_10322760 3300031507 Bacteria 1280
133 Ga0307408_100006462 3300031548 Bacteria 7771
134 Ga0307408_100051586 3300031548 Bacteria 2963
135 Ga0265313_10035628 3300031595 Bacteria 2504
136 Ga0307508_10000062 3300031616 Bacteria 123066
137 Ga0307508_10002665 3300031616 Bacteria 18710
138 Ga0307508_10160482 3300031616 Bacteria 1852
139 Ga0265342_10107769 3300031712 Bacteria 1580
140 Ga0307405_10126966 3300031731 Bacteria 1755
141 Ga0307413_10441171 3300031824 Bacteria 1031
142 Ga0307412_10005075 3300031911 Bacteria 7362
143 Ga0307412_10086241 3300031911 Bacteria 2184
144 Ga0307412_10904703 3300031911 Bacteria 774
145 Ga0307416_100443292 3300032002 Bacteria 1349
146 Ga0307414_10000323 3300032004 Bacteria 27329
147 Ga0307414_10002736 3300032004 Bacteria 9281
148 Ga0307414_10573938 3300032004 Bacteria 1008
149 Ga0307415_100172102 3300032126 Bacteria 1690
150 Ga0307510_10058127 3300033180 Bacteria 4008
151 Ga0373953_0076612 3300035117 Bacteria 1386
152 Ga0373924_0055492 3300035410 Bacteria 1649
153 Ga0373933_0194521 3300035724 Unclassified 1296
154 Ga0373937_0011925 3300036401 Bacteria 7627
155 Ga0373925_0120657 3300037068 Bacteria 2035
156 Ga0395899_0000001 3300037312 Bacteria 1750322
157 Ga0395899_0001857 3300037312 Bacteria 17464
158 Ga0395900_0000585 3300037418 Bacteria 50049
159 Ga0395901_1136890 3300038443 Bacteria 750
160 Ga0400488_52022 3300038741 Bacteria 2603
161 Ga0400489_65437 3300039093 Bacteria 1819
162 Ga0451791_0438377 3300041451 Bacteria 956
163 Ga0451797_1339496 3300041453 Bacteria 791
164 Ga0451849_0404290 3300041505 Bacteria 796
165 Ga0439449_0010820 3300042007 Bacteria 3443
166 Ga0439457_013402 3300042014 Bacteria 1843
167 Ga0439457_017929 3300042014 Bacteria 1571
168 Ga0466969_0000052 3300044656 Bacteria 60425
169 Ga0466966_0000591 3300044684 Bacteria 23091
170 Ga0466966_0014558 3300044684 Bacteria 5206
171 Ga0466961_0242733 3300044693 Bacteria 1107
172 Ga0466971_0143895 3300044719 Bacteria 1111
173 Ga0466957_0010144 3300044842 Bacteria 5390
174 Ga0466957_0012559 3300044842 Bacteria 4903
175 Ga0466959_0014160 3300045049 Bacteria 5789
176 Ga0466958_0041326 3300045836 Bacteria 2773
177 Ga0495592_0037539 3300046454 Bacteria 3647
178 Ga0495629_0125014 3300046459 Bacteria 1792
179 Ga0495629_0128220 3300046459 Bacteria 1768
180 Ga0495638_0029572 3300046460 Unclassified 3533
181 Ga0495638_0303268 3300046460 Bacteria 860
182 Ga0495639_0171279 3300046475 Bacteria 1054
183 Ga0495662_0123778 3300046476 Unclassified 1270
184 Ga0495664_0097272 3300046477 Bacteria 1772
185 Ga0495608_0103495 3300046511 Bacteria 1835
186 Ga0495618_0106652 3300046514 Bacteria 1794
187 Ga0495628_0032509 3300046516 Bacteria 4212
188 Ga0495630_0088549 3300046517 Bacteria 2338
189 Ga0495630_0090032 3300046517 Bacteria 2318
190 Ga0495587_0134170 3300046536 Unclassified 1415
191 Ga0495645_0065104 3300046543 Bacteria 2637
192 Ga0495667_0039568 3300046559 Bacteria 3135
193 Ga0495634_0091700 3300046642 Bacteria 1972
194 Ga0495634_0092501 3300046642 Bacteria 1962
195 Ga0495611_0228011 3300046648 Bacteria 866
196 Ga0495613_0004289 3300046689 Bacteria 10685
197 Ga0495613_0102065 3300046689 Bacteria 2071
198 Ga0495613_0106438 3300046689 Bacteria 2024
199 Ga0495674_0035376 3300047319 Bacteria 4507
200 Ga0495674_0224506 3300047319 Bacteria 1552
201 Ga0495672_0014841 3300047320 Bacteria 5314
202 Ga0495672_0017676 3300047320 Bacteria 4763
203 Ga0495680_0127583 3300047322 Bacteria 1872
204 Ga0495684_0055823 3300047471 Bacteria 3012
205 Ga0495684_0195727 3300047471 Bacteria 1492
206 Ga0496114_0388555 3300048917 Bacteria 1236
207 Ga0501047_0025848 3300049581 Bacteria 5646
208 Ga0501048_0652528 3300049582 Unclassified 756
209 Ga0501223_000741 3300049663 Bacteria 7770
210 Ga0501249_000008 3300049679 Bacteria 197587
211 Ga0501044_0445950 3300049823 Bacteria 1201
212 nmdc:mga0k408_328588_c1 3300050493 Bacteria 912
213 nmdc:mga05p37_14969_c1 3300050507 Bacteria 9311
214 nmdc:mga05p37_1784_c1 3300050507 Bacteria 25122
215 nmdc:mga09592_171493_c1 3300050508 Bacteria 1876
216 nmdc:mga09592_52518_c1 3300050508 Bacteria 3441
217 nmdc:mga0qj67_3635_c1 3300050509 Bacteria 11125
218 nmdc:mga0qj67_9314_c1 3300050509 Bacteria 7304
219 nmdc:mga06r32_118337_c1 3300050510 Bacteria 2612
220 nmdc:mga08y16_1187899_c1 3300050511 Unclassified 734
221 nmdc:mga0n895_519034_c1 3300050512 Unclassified 1199
222 Ga0495601_0152292 3300053077 Bacteria 1510
223 Ga0500578_0005051 3300053086 Bacteria 9072
224 Ga0500646_0036576 3300053090 Bacteria 1368
225 Ga0500583_0000081 3300053092 Bacteria 55682
226 Ga0500583_0005623 3300053092 Bacteria 4222
227 Ga0500641_0001307 3300053096 Bacteria 8846
228 Ga0500594_0030878 3300053118 Bacteria 1409
229 Ga0500559_0198771 3300053136 Bacteria 945
230 Ga0500568_0000471 3300053139 Bacteria 29804
231 Ga0500573_0199848 3300053140 Bacteria 1062
232 Ga0500588_0009341 3300053146 Bacteria 2329
233 Ga0500589_026855 3300053147 Bacteria 2671
234 Ga0500603_030868 3300053150 Bacteria 1382
235 Ga0500616_0028342 3300053153 Unclassified 3086
236 Ga0500622_0008668 3300053156 Bacteria 5672
237 Ga0500622_0082256 3300053156 Bacteria 1611
238 Ga0500636_0162056 3300053177 Bacteria 1218
239 Ga0500611_000005 3300053727 Bacteria 228837
240 Ga0500611_015250 3300053727 Bacteria 1358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100257741 Ga0068855_1002577412 194
2 3300050493 nmdc:mga0k408_328588_c1 nmdc:mga0k408_328588_c1_39_647 202
3 3300006844 Ga0075428_100012570 Ga0075428_1000125709 203
4 3300006846 Ga0075430_100066889 Ga0075430_1000668892 203
5 3300006847 Ga0075431_100035374 Ga0075431_1000353744 203
6 3300009147 Ga0114129_10152415 Ga0114129_101524153 203
7 3300050507 nmdc:mga05p37_14969_c1 nmdc:mga05p37_14969_c1_6723_7394 203
8 3300050508 nmdc:mga09592_52518_c1 nmdc:mga09592_52518_c1_2089_2760 203
9 3300050509 nmdc:mga0qj67_9314_c1 nmdc:mga0qj67_9314_c1_355_1026 203
10 3300050510 nmdc:mga06r32_118337_c1 nmdc:mga06r32_118337_c1_1519_2190 203
11 3300041451 Ga0451791_0438377 Ga0451791_0438377_25_645 206
12 3300014969 Ga0157376_11316132 Ga0157376_113161321 207
13 3300047471 Ga0495684_0195727 Ga0495684_0195727_28_654 207
14 3300013104 Ga0157370_10080551 Ga0157370_100805512 211
15 3300044693 Ga0466961_0242733 Ga0466961_0242733_351_1010 211
16 3300044684 Ga0466966_0014558 Ga0466966_0014558_1245_1904 212
17 3300045836 Ga0466958_0041326 Ga0466958_0041326_2077_2736 212
18 iso_pu_bacteria 2833640130 2833644040 214
19 iso_pu_bacteria 2896317667 2896319166 215
20 iso_pu_bacteria 2513020052 2513235226 216
21 iso_pu_bacteria 2738541278 2738729901 216
22 iso_pu_bacteria 2738543023 2739300105 216
23 iso_pu_bacteria 2919683626 2919684725 216
24 iso_pu_bacteria 8056440228 8056443608 216
25 3300005328 Ga0070676_10304497 Ga0070676_103044971 217
26 3300005334 Ga0068869_100069772 Ga0068869_1000697721 217
27 3300005347 Ga0070668_100041352 Ga0070668_1000413523 217
28 3300005456 Ga0070678_100233600 Ga0070678_1002336002 217
29 3300005459 Ga0068867_100064220 Ga0068867_1000642202 217
30 3300005578 Ga0068854_100322610 Ga0068854_1003226102 217
31 3300005844 Ga0068862_100083797 Ga0068862_1000837973 217
32 3300006195 Ga0075366_10265420 Ga0075366_102654201 217
33 3300009148 Ga0105243_10782571 Ga0105243_107825711 217
34 3300013297 Ga0157378_10522814 Ga0157378_105228142 217
35 3300025907 Ga0207645_10030391 Ga0207645_100303914 217
36 3300025942 Ga0207689_10210987 Ga0207689_102109873 217
37 3300025972 Ga0207668_10766078 Ga0207668_107660781 217
38 3300025981 Ga0207640_10402889 Ga0207640_104028892 217
39 3300026089 Ga0207648_10012385 Ga0207648_100123855 217
40 3300028380 Ga0268265_10562566 Ga0268265_105625661 217
41 3300036401 Ga0373937_0011925 Ga0373937_0011925_1575_2231 217
42 3300046536 Ga0495587_0134170 Ga0495587_0134170_659_1315 217
43 3300046559 Ga0495667_0039568 Ga0495667_0039568_1317_1973 217
44 3300046642 Ga0495634_0091700 Ga0495634_0091700_1267_1923 217
45 3300046689 Ga0495613_0004289 Ga0495613_0004289_8698_9354 217
46 iso_pu_bacteria 2522125168 2522548720 217
47 3300003322 rootL2_10048108 rootL2_100481082 218
48 3300005614 Ga0068856_100238189 Ga0068856_1002381892 218
49 3300009147 Ga0114129_10000792 Ga0114129_1000079211 218
50 3300026078 Ga0207702_10198756 Ga0207702_101987562 218
51 3300038741 Ga0400488_52022 Ga0400488_52022_145_807 218
52 3300050507 nmdc:mga05p37_1784_c1 nmdc:mga05p37_1784_c1_3850_4506 218
53 3300003320 rootH2_10060522 rootH2_100605222 219
54 3300003323 rootH1_10040548 rootH1_100405482 219
55 3300003323 rootH1_10068235 rootH1_100682353 219
56 3300003323 rootH1_10218069 rootH1_102180692 219
57 3300005327 Ga0070658_10070195 Ga0070658_100701952 219
58 3300005329 Ga0070683_100060497 Ga0070683_1000604973 219
59 3300005335 Ga0070666_10381872 Ga0070666_103818721 219
60 3300005338 Ga0068868_100643489 Ga0068868_1006434892 219
61 3300005341 Ga0070691_10022422 Ga0070691_100224223 219
62 3300005366 Ga0070659_100000283 Ga0070659_10000028323 219
63 3300005367 Ga0070667_100913800 Ga0070667_1009138001 219
64 3300005458 Ga0070681_10287290 Ga0070681_102872902 219
65 3300005548 Ga0070665_100422790 Ga0070665_1004227902 219
66 3300005563 Ga0068855_100001483 Ga0068855_10000148310 219
67 3300005578 Ga0068854_100257330 Ga0068854_1002573302 219
68 3300005614 Ga0068856_100132545 Ga0068856_1001325452 219
69 3300005616 Ga0068852_100270070 Ga0068852_1002700702 219
70 3300005841 Ga0068863_100224306 Ga0068863_1002243062 219
71 3300005937 Ga0081455_10167641 Ga0081455_101676412 219
72 3300006358 Ga0068871_100840236 Ga0068871_1008402361 219
73 3300006846 Ga0075430_100005702 Ga0075430_10000570211 219
74 3300006871 Ga0075434_100490657 Ga0075434_1004906572 219
75 3300006880 Ga0075429_100290753 Ga0075429_1002907532 219
76 3300009093 Ga0105240_10000592 Ga0105240_1000059242 219
77 3300009094 Ga0111539_10588949 Ga0111539_105889492 219
78 3300009174 Ga0105241_10014828 Ga0105241_100148284 219
79 3300009174 Ga0105241_10069921 Ga0105241_100699213 219
80 3300009545 Ga0105237_10003831 Ga0105237_100038313 219
81 3300009551 Ga0105238_10025018 Ga0105238_100250183 219
82 3300010375 Ga0105239_10001332 Ga0105239_1000133224 219
83 3300010375 Ga0105239_10002179 Ga0105239_1000217918 219
84 3300013100 Ga0157373_10000113 Ga0157373_100001136 219
85 3300013100 Ga0157373_10007331 Ga0157373_100073313 219
86 3300013102 Ga0157371_10011735 Ga0157371_100117352 219
87 3300013105 Ga0157369_10001781 Ga0157369_1000178119 219
88 3300013105 Ga0157369_10036558 Ga0157369_100365581 219
89 3300013297 Ga0157378_10544771 Ga0157378_105447711 219
90 3300013307 Ga0157372_10000021 Ga0157372_10000021130 219
91 3300013307 Ga0157372_10069978 Ga0157372_100699783 219
92 3300013307 Ga0157372_10116189 Ga0157372_101161892 219
93 3300013307 Ga0157372_10810554 Ga0157372_108105542 219
94 3300013307 Ga0157372_11448536 Ga0157372_114485361 219
95 3300013308 Ga0157375_11509333 Ga0157375_115093331 219
96 3300025250 Ga0209026_1000521 Ga0209026_100052113 219
97 3300025903 Ga0207680_10351772 Ga0207680_103517721 219
98 3300025911 Ga0207654_10048933 Ga0207654_100489332 219
99 3300025913 Ga0207695_10000048 Ga0207695_10000048183 219
100 3300025919 Ga0207657_10066257 Ga0207657_100662572 219
101 3300025932 Ga0207690_10002858 Ga0207690_100028585 219
102 3300025944 Ga0207661_10116380 Ga0207661_101163802 219
103 3300026035 Ga0207703_10373295 Ga0207703_103732952 219
104 3300026088 Ga0207641_10180531 Ga0207641_101805312 219
105 3300026089 Ga0207648_10782352 Ga0207648_107823521 219
106 3300028379 Ga0268266_10886216 Ga0268266_108862161 219
107 3300028381 Ga0268264_10828395 Ga0268264_108283951 219
108 3300028794 Ga0307515_10031909 Ga0307515_100319094 219
109 3300031456 Ga0307513_10194353 Ga0307513_101943532 219
110 3300031507 Ga0307509_10322760 Ga0307509_103227602 219
111 3300031616 Ga0307508_10002665 Ga0307508_100026656 219
112 3300031911 Ga0307412_10904703 Ga0307412_109047031 219
113 3300035117 Ga0373953_0076612 Ga0373953_0076612_565_1224 219
114 3300035410 Ga0373924_0055492 Ga0373924_0055492_497_1156 219
115 3300035724 Ga0373933_0194521 Ga0373933_0194521_475_1134 219
116 3300037312 Ga0395899_0001857 Ga0395899_0001857_6567_7226 219
117 3300038443 Ga0395901_1136890 Ga0395901_1136890_61_720 219
118 3300039093 Ga0400489_65437 Ga0400489_65437_969_1628 219
119 3300044656 Ga0466969_0000052 Ga0466969_0000052_48316_48975 219
120 3300044684 Ga0466966_0000591 Ga0466966_0000591_20092_20751 219
121 3300044842 Ga0466957_0010144 Ga0466957_0010144_4380_5039 219
122 3300044842 Ga0466957_0012559 Ga0466957_0012559_632_1291 219
123 3300045049 Ga0466959_0014160 Ga0466959_0014160_3366_4025 219
124 3300046454 Ga0495592_0037539 Ga0495592_0037539_1451_2110 219
125 3300046459 Ga0495629_0125014 Ga0495629_0125014_107_766 219
126 3300046460 Ga0495638_0029572 Ga0495638_0029572_1975_2664 219
127 3300046514 Ga0495618_0106652 Ga0495618_0106652_78_737 219
128 3300046516 Ga0495628_0032509 Ga0495628_0032509_1314_1973 219
129 3300046517 Ga0495630_0088549 Ga0495630_0088549_772_1431 219
130 3300046543 Ga0495645_0065104 Ga0495645_0065104_1144_1803 219
131 3300046648 Ga0495611_0228011 Ga0495611_0228011_160_819 219
132 3300046689 Ga0495613_0106438 Ga0495613_0106438_839_1498 219
133 3300047319 Ga0495674_0035376 Ga0495674_0035376_1390_2049 219
134 3300047471 Ga0495684_0055823 Ga0495684_0055823_2296_2955 219
135 3300048917 Ga0496114_0388555 Ga0496114_0388555_443_1102 219
136 3300050508 nmdc:mga09592_171493_c1 nmdc:mga09592_171493_c1_787_1458 219
137 3300050509 nmdc:mga0qj67_3635_c1 nmdc:mga0qj67_3635_c1_6797_7468 219
138 3300050511 nmdc:mga08y16_1187899_c1 nmdc:mga08y16_1187899_c1_21_680 219
139 3300050512 nmdc:mga0n895_519034_c1 nmdc:mga0n895_519034_c1_397_1056 219
140 3300053077 Ga0495601_0152292 Ga0495601_0152292_262_921 219
141 3300053086 Ga0500578_0005051 Ga0500578_0005051_1893_2552 219
142 3300053146 Ga0500588_0009341 Ga0500588_0009341_1531_2190 219
143 3300053153 Ga0500616_0028342 Ga0500616_0028342_80_739 219
144 3300053727 Ga0500611_000005 Ga0500611_000005_184050_184739 219
145 3300003320 rootH2_10238768 rootH2_102387682 220
146 3300003322 rootL2_10053677 rootL2_100536772 220
147 3300003323 rootH1_10008837 rootH1_1000883716 220
148 3300003323 rootH1_10242162 rootH1_102421622 220
149 3300005288 Ga0065714_10070164 Ga0065714_100701643 220
150 3300005289 Ga0065704_10136607 Ga0065704_101366072 220
151 3300005293 Ga0065715_10200536 Ga0065715_102005362 220
152 3300005293 Ga0065715_10533120 Ga0065715_105331201 220
153 3300005329 Ga0070683_100543049 Ga0070683_1005430491 220
154 3300005331 Ga0070670_100327755 Ga0070670_1003277552 220
155 3300005331 Ga0070670_100749402 Ga0070670_1007494021 220
156 3300005364 Ga0070673_100137853 Ga0070673_1001378532 220
157 3300005616 Ga0068852_100028629 Ga0068852_1000286292 220
158 3300005844 Ga0068862_100905987 Ga0068862_1009059871 220
159 3300009094 Ga0111539_10111813 Ga0111539_101118132 220
160 3300013102 Ga0157371_10148525 Ga0157371_101485252 220
161 3300013307 Ga0157372_10087927 Ga0157372_100879273 220
162 3300014325 Ga0163163_10374908 Ga0163163_103749082 220
163 3300014325 Ga0163163_10388468 Ga0163163_103884682 220
164 3300017792 Ga0163161_10068441 Ga0163161_100684412 220
165 3300025261 Ga0209233_1009111 Ga0209233_10091113 220
166 3300025261 Ga0209233_1053255 Ga0209233_10532551 220
167 3300025914 Ga0207671_10039880 Ga0207671_100398802 220
168 3300025925 Ga0207650_10090861 Ga0207650_100908612 220
169 3300026041 Ga0207639_10502580 Ga0207639_105025801 220
170 3300026142 Ga0207698_10021054 Ga0207698_100210544 220
171 3300030522 Ga0307512_10106599 Ga0307512_101065992 220
172 3300031239 Ga0265328_10065388 Ga0265328_100653882 220
173 3300031456 Ga0307513_10235553 Ga0307513_102355532 220
174 3300031456 Ga0307513_10422424 Ga0307513_104224241 220
175 3300031507 Ga0307509_10045269 Ga0307509_100452692 220
176 3300031507 Ga0307509_10078435 Ga0307509_100784352 220
177 3300031507 Ga0307509_10085713 Ga0307509_100857133 220
178 3300031595 Ga0265313_10035628 Ga0265313_100356282 220
179 3300031616 Ga0307508_10160482 Ga0307508_101604822 220
180 3300031712 Ga0265342_10107769 Ga0265342_101077692 220
181 3300032004 Ga0307414_10000323 Ga0307414_100003234 220
182 3300032004 Ga0307414_10002736 Ga0307414_100027364 220
183 3300032004 Ga0307414_10573938 Ga0307414_105739382 220
184 3300033180 Ga0307510_10058127 Ga0307510_100581273 220
185 3300037068 Ga0373925_0120657 Ga0373925_0120657_15_677 220
186 3300037312 Ga0395899_0000001 Ga0395899_0000001_1268784_1269446 220
187 3300037418 Ga0395900_0000585 Ga0395900_0000585_40387_41049 220
188 3300041453 Ga0451797_1339496 Ga0451797_1339496_15_677 220
189 3300042007 Ga0439449_0010820 Ga0439449_0010820_267_932 220
190 3300042014 Ga0439457_013402 Ga0439457_013402_309_971 220
191 3300042014 Ga0439457_017929 Ga0439457_017929_591_1256 220
192 3300044719 Ga0466971_0143895 Ga0466971_0143895_122_784 220
193 3300046459 Ga0495629_0128220 Ga0495629_0128220_906_1580 220
194 3300046460 Ga0495638_0303268 Ga0495638_0303268_158_820 220
195 3300046475 Ga0495639_0171279 Ga0495639_0171279_135_809 220
196 3300046476 Ga0495662_0123778 Ga0495662_0123778_480_1154 220
197 3300046477 Ga0495664_0097272 Ga0495664_0097272_916_1590 220
198 3300046511 Ga0495608_0103495 Ga0495608_0103495_178_852 220
199 3300046517 Ga0495630_0090032 Ga0495630_0090032_849_1523 220
200 3300046642 Ga0495634_0092501 Ga0495634_0092501_730_1404 220
201 3300046689 Ga0495613_0102065 Ga0495613_0102065_917_1591 220
202 3300047319 Ga0495674_0224506 Ga0495674_0224506_414_1088 220
203 3300047320 Ga0495672_0014841 Ga0495672_0014841_4224_4886 220
204 3300047320 Ga0495672_0017676 Ga0495672_0017676_1460_2122 220
205 3300047322 Ga0495680_0127583 Ga0495680_0127583_128_802 220
206 3300049679 Ga0501249_000008 Ga0501249_000008_114444_115106 220
207 3300053090 Ga0500646_0036576 Ga0500646_0036576_153_815 220
208 3300053092 Ga0500583_0000081 Ga0500583_0000081_18302_18964 220
209 3300053092 Ga0500583_0005623 Ga0500583_0005623_620_1282 220
210 3300053096 Ga0500641_0001307 Ga0500641_0001307_3793_4455 220
211 3300053118 Ga0500594_0030878 Ga0500594_0030878_104_766 220
212 3300053136 Ga0500559_0198771 Ga0500559_0198771_61_723 220
213 3300053139 Ga0500568_0000471 Ga0500568_0000471_16532_17194 220
214 3300053140 Ga0500573_0199848 Ga0500573_0199848_368_1030 220
215 3300053147 Ga0500589_026855 Ga0500589_026855_864_1526 220
216 3300053150 Ga0500603_030868 Ga0500603_030868_508_1170 220
217 3300053156 Ga0500622_0082256 Ga0500622_0082256_672_1334 220
218 3300053177 Ga0500636_0162056 Ga0500636_0162056_360_1022 220
219 3300053727 Ga0500611_015250 Ga0500611_015250_178_840 220
220 3300002774 JGI25150J39212_1000019 JGI25150J39212_100001977 221
221 3300003187 JGI25151J46595_10000074 JGI25151J46595_1000007477 221
222 3300003215 JGI25153J46596_10000056 JGI25153J46596_1000005677 221
223 3300005262 Ga0065165_1000339 Ga0065165_100033948 221
224 3300005539 Ga0068853_100025420 Ga0068853_1000254203 221
225 3300015261 Ga0182006_1050709 Ga0182006_10507092 221
226 3300025245 Ga0207425_1000007 Ga0207425_1000007242 221
227 3300025258 Ga0209129_1000006 Ga0209129_1000006242 221
228 3300025292 Ga0209676_1000232 Ga0209676_100023287 221
229 3300025294 Ga0209025_1000025 Ga0209025_100002572 221
230 3300025297 Ga0209758_1000016 Ga0209758_1000016242 221
231 3300025298 Ga0209050_1023496 Ga0209050_10234962 221
232 3300030744 Ga0316181_1032274 Ga0316181_10322742 221
233 3300031241 Ga0265325_10174894 Ga0265325_101748942 221
234 3300031548 Ga0307408_100006462 Ga0307408_1000064625 221
235 3300031548 Ga0307408_100051586 Ga0307408_1000515863 221
236 3300031616 Ga0307508_10000062 Ga0307508_1000006238 221
237 3300031731 Ga0307405_10126966 Ga0307405_101269662 221
238 3300031824 Ga0307413_10441171 Ga0307413_104411711 221
239 3300031911 Ga0307412_10005075 Ga0307412_100050755 221
240 3300031911 Ga0307412_10086241 Ga0307412_100862412 221
241 3300032002 Ga0307416_100443292 Ga0307416_1004432921 221
242 3300032126 Ga0307415_100172102 Ga0307415_1001721022 221
243 3300041505 Ga0451849_0404290 Ga0451849_0404290_88_756 221
244 3300049581 Ga0501047_0025848 Ga0501047_0025848_4880_5545 221
245 3300049582 Ga0501048_0652528 Ga0501048_0652528_18_683 221
246 3300049663 Ga0501223_000741 Ga0501223_000741_1216_1881 221
247 3300049823 Ga0501044_0445950 Ga0501044_0445950_130_795 221
248 3300053156 Ga0500622_0008668 Ga0500622_0008668_4659_5324 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01177

Asp_Glu_race

Asp/Glu/Hydantoin racemase

28

237

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jfl-assembly1.cif.gz_B crystal structure determination of aspartate racemase from an archaea 0.8065 4 218
3ojc-assembly1.cif.gz_A crystal structure of a putative asp/glu racemase from yersinia pestis 0.8063 4 221
3ojc-assembly1.cif.gz_A crystal structure of a putative asp/glu racemase from yersinia pestis 0.7933 4 221
1jfl-assembly1.cif.gz_B crystal structure determination of aspartate racemase from an archaea 0.7835 4 218
2dx7-assembly1.cif.gz_B crystal structure of pyrococcus horikoshii ot3 aspartate racemase complex with citric acid 0.7778 4 216
ID Description Score Start End Superfamily
5ellB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8066 4 96 3.40.50.1860
1jflB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8054 4 99 3.40.50.1860
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7966 4 219 3.40.50.720
af_P03813_2_229_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.7772 4 219 3.40.50.720
af_K7ML62_69_313_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.7644 7 221 1.10.472.10
ID Description Score Start End GO Terms
AF-G8TNH0-F1-model_v4 Asp/Glu/hydantoin racemase 0.9971 1 218 GO:0036361
AF-A0A1S2VA72-F1-model_v4 Asp/Glu/hydantoin racemase 0.9969 1 144 GO:0036361
AF-A0A1M5E3W3-F1-model_v4 Asp/Glu/Hydantoin racemase 0.9928 1 218 GO:0036361
AF-A0A5B8UG90-F1-model_v4 Asp/Glu/hydantoin racemase 0.991 1 218 GO:0036361
AF-A0A519UPH8-F1-model_v4 Asp/Glu/hydantoin racemase 0.9897 1 193 GO:0036361

Feature Viewer

pLDDT pTM Quality
95.5 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map