F359593

General Info

Members Datasets Scaffolds Average Seq Length
248 123 247 131

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100034291|Ga0070683_1000342913
Length 145
Sequence MSASTTITTPLVNNPPETSSGSVRPASGLPEGVREGNENLVRLTAAAGAKVAALIERDQQGRFLRIAISGGGCNGLSYKMKFVTEPKRGDILVRTGGAEVVVDSKSALYLKGTHVDYSAAMVAGGFKFSNPNAKASCSCGESFSV

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
48 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
49 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
63 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
81 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
82 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
83 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
84 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
85 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
96 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.4
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 0.4
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10158858 3300003316 Unclassified 1583
2 rootH2_10063276 3300003320 Bacteria 6711
3 rootH1_10073730 3300003323 Bacteria 4426
4 rootH1_10092443 3300003323 Bacteria 3862
5 Ga0070658_10036133 3300005327 Bacteria 3981
6 Ga0070683_100034291 3300005329 Bacteria 4635
7 Ga0070690_101712369 3300005330 Unclassified 511
8 Ga0070670_100277655 3300005331 Bacteria 1463
9 Ga0068869_100000041 3300005334 Bacteria 52640
10 Ga0070680_100826807 3300005336 Bacteria 798
11 Ga0068868_100042861 3300005338 Bacteria 3534
12 Ga0070709_11594794 3300005434 Bacteria 531
13 Ga0070705_101574733 3300005440 Unclassified 552
14 Ga0068867_100001369 3300005459 Bacteria 16832
15 Ga0070679_100022000 3300005530 Bacteria 6229
16 Ga0070684_100308040 3300005535 Bacteria 1454
17 Ga0068853_100186473 3300005539 Bacteria 1883
18 Ga0068855_100839980 3300005563 Bacteria 974
19 Ga0068856_100178870 3300005614 Bacteria 2134
20 Ga0070717_10000037 3300006028 Bacteria 121470
21 Ga0070712_100452591 3300006175 Bacteria 1069
22 Ga0097621_100009556 3300006237 Bacteria 7047
23 Ga0068871_100034381 3300006358 Bacteria 4022
24 Ga0068865_100012632 3300006881 Bacteria 5320
25 Ga0068865_100952237 3300006881 Bacteria 749
26 Ga0105240_10437601 3300009093 Bacteria 1466
27 Ga0157369_10185706 3300013105 Bacteria 2186
28 Ga0163162_11417330 3300013306 Bacteria 791
29 Ga0157375_10638025 3300013308 Bacteria 1222
30 Ga0163163_10149399 3300014325 Bacteria 2381
31 Ga0163163_10591996 3300014325 Bacteria 1172
32 Ga0157379_10871737 3300014968 Unclassified 853
33 Ga0157379_11901698 3300014968 Unclassified 586
34 Ga0157376_10588450 3300014969 Bacteria 1106
35 Ga0207705_10031960 3300025909 Bacteria 3760
36 Ga0207695_10141997 3300025913 Bacteria 2349
37 Ga0207693_10194092 3300025915 Bacteria 1597
38 Ga0207660_10747747 3300025917 Bacteria 798
39 Ga0207700_10004940 3300025928 Bacteria 7924
40 Ga0207704_10002842 3300025938 Bacteria 7817
41 Ga0207704_10332136 3300025938 Bacteria 1177
42 Ga0207704_10344972 3300025938 Bacteria 1157
43 Ga0207689_10000510 3300025942 Bacteria 36782
44 Ga0207661_10004049 3300025944 Bacteria 10240
45 Ga0207667_11920862 3300025949 Unclassified 554
46 Ga0207677_10070744 3300026023 Bacteria 2460
47 Ga0207677_10153534 3300026023 Bacteria 1780
48 Ga0207639_10054700 3300026041 Bacteria 3052
49 Ga0207702_10036688 3300026078 Bacteria 4101
50 Ga0207648_10001280 3300026089 Bacteria 28091
51 Ga0207676_11576532 3300026095 Bacteria 654
52 Ga0207683_10266978 3300026121 Unclassified 1563
53 Ga0265337_1003146 3300028556 Bacteria 7265
54 Ga0265337_1030771 3300028556 Bacteria 1596
55 Ga0265326_10091240 3300028558 Unclassified 863
56 Ga0265319_1000188 3300028563 Bacteria 46993
57 Ga0265319_1000809 3300028563 Bacteria 20093
58 Ga0265319_1001714 3300028563 Bacteria 12649
59 Ga0265319_1001996 3300028563 Bacteria 11505
60 Ga0265319_1003254 3300028563 Bacteria 8546
61 Ga0265319_1003289 3300028563 Bacteria 8499
62 Ga0265319_1007307 3300028563 Bacteria 4984
63 Ga0265319_1008712 3300028563 Bacteria 4410
64 Ga0265319_1019163 3300028563 Bacteria 2562
65 Ga0265319_1028412 3300028563 Bacteria 1972
66 Ga0265319_1071638 3300028563 Unclassified 1110
67 Ga0265319_1081444 3300028563 Bacteria 1027
68 Ga0265319_1124664 3300028563 Bacteria 802
69 Ga0265334_10047193 3300028573 Bacteria 1662
70 Ga0265334_10074267 3300028573 Bacteria 1262
71 Ga0265334_10331204 3300028573 Bacteria 521
72 Ga0265318_10000004 3300028577 Bacteria 319325
73 Ga0265318_10000129 3300028577 Bacteria 69613
74 Ga0265318_10000488 3300028577 Bacteria 29120
75 Ga0265318_10000819 3300028577 Bacteria 20509
76 Ga0265318_10002336 3300028577 Bacteria 10182
77 Ga0265318_10002460 3300028577 Bacteria 9895
78 Ga0265318_10004456 3300028577 Bacteria 6784
79 Ga0265318_10006785 3300028577 Bacteria 5235
80 Ga0265318_10015511 3300028577 Bacteria 3168
81 Ga0265318_10055582 3300028577 Bacteria 1481
82 Ga0265318_10120990 3300028577 Bacteria 963
83 Ga0265318_10197584 3300028577 Bacteria 735
84 Ga0265318_10201451 3300028577 Bacteria 727
85 Ga0265322_10008478 3300028654 Bacteria 2994
86 Ga0265336_10000623 3300028666 Bacteria 19512
87 Ga0265336_10006820 3300028666 Bacteria 4091
88 Ga0307515_10442314 3300028794 Bacteria 917
89 Ga0265338_10002481 3300028800 Bacteria 27564
90 Ga0265338_10087021 3300028800 Bacteria 2597
91 Ga0265338_10293499 3300028800 Bacteria 1184
92 Ga0265338_10392057 3300028800 Bacteria 991
93 Ga0265324_10001962 3300029957 Bacteria 11029
94 Ga0265324_10022797 3300029957 Bacteria 2236
95 Ga0265324_10060516 3300029957 Bacteria 1295
96 Ga0265324_10103847 3300029957 Unclassified 965
97 Ga0265324_10203871 3300029957 Bacteria 672
98 Ga0265760_10153053 3300031090 Unclassified 757
99 Ga0265332_10044657 3300031238 Bacteria 1911
100 Ga0265332_10084861 3300031238 Bacteria 1342
101 Ga0265332_10240335 3300031238 Unclassified 750
102 Ga0265328_10080861 3300031239 Bacteria 1197
103 Ga0265320_10000032 3300031240 Bacteria 141785
104 Ga0265320_10001041 3300031240 Bacteria 20583
105 Ga0265320_10001565 3300031240 Bacteria 16452
106 Ga0265320_10002851 3300031240 Bacteria 11865
107 Ga0265320_10008976 3300031240 Bacteria 6065
108 Ga0265320_10029664 3300031240 Bacteria 2828
109 Ga0265320_10029916 3300031240 Bacteria 2814
110 Ga0265320_10030227 3300031240 Bacteria 2795
111 Ga0265320_10094640 3300031240 Bacteria 1381
112 Ga0265320_10126183 3300031240 Bacteria 1164
113 Ga0265320_10222374 3300031240 Bacteria 840
114 Ga0265320_10412931 3300031240 Unclassified 596
115 Ga0265325_10006455 3300031241 Bacteria 7111
116 Ga0265325_10184372 3300031241 Bacteria 970
117 Ga0265329_10047006 3300031242 Bacteria 1378
118 Ga0265329_10054580 3300031242 Bacteria 1269
119 Ga0265340_10469908 3300031247 Bacteria 554
120 Ga0265331_10005726 3300031250 Bacteria 7451
121 Ga0265331_10070511 3300031250 Bacteria 1636
122 Ga0265331_10119958 3300031250 Bacteria 1203
123 Ga0265331_10234534 3300031250 Bacteria 824
124 Ga0265327_10000204 3300031251 Bacteria 123713
125 Ga0265327_10000744 3300031251 Bacteria 50640
126 Ga0265327_10001250 3300031251 Bacteria 33884
127 Ga0265327_10008738 3300031251 Bacteria 7487
128 Ga0265327_10039891 3300031251 Bacteria 2546
129 Ga0265316_10004494 3300031344 Bacteria 13859
130 Ga0265316_10028443 3300031344 Bacteria 4612
131 Ga0265316_10044518 3300031344 Bacteria 3530
132 Ga0265316_10491828 3300031344 Bacteria 877
133 Ga0265316_10687093 3300031344 Bacteria 722
134 Ga0265316_11067107 3300031344 Bacteria 561
135 Ga0307408_100000003 3300031548 Bacteria 618438
136 Ga0265313_10002258 3300031595 Bacteria 16930
137 Ga0265313_10003290 3300031595 Bacteria 13270
138 Ga0265313_10010637 3300031595 Bacteria 5794
139 Ga0265313_10021923 3300031595 Bacteria 3480
140 Ga0265313_10032506 3300031595 Bacteria 2662
141 Ga0307508_10000026 3300031616 Bacteria 171622
142 Ga0265314_10001147 3300031711 Bacteria 30685
143 Ga0265314_10002416 3300031711 Bacteria 19166
144 Ga0265314_10002681 3300031711 Bacteria 17834
145 Ga0265314_10003983 3300031711 Bacteria 13969
146 Ga0265314_10028008 3300031711 Bacteria 4208
147 Ga0265314_10061548 3300031711 Bacteria 2555
148 Ga0265314_10153101 3300031711 Bacteria 1411
149 Ga0265314_10191984 3300031711 Bacteria 1214
150 Ga0265342_10031662 3300031712 Bacteria 3268
151 Ga0307410_10000039 3300031852 Bacteria 46194
152 Ga0307407_10020455 3300031903 Bacteria 3392
153 Ga0307412_10062892 3300031911 Bacteria 2501
154 Ga0307412_11119237 3300031911 Unclassified 702
155 Ga0307409_100000018 3300031995 Bacteria 57233
156 Ga0307416_100000027 3300032002 Bacteria 172418
157 Ga0307416_101505313 3300032002 Unclassified 779
158 Ga0307416_102303155 3300032002 Bacteria 639
159 Ga0307411_10375050 3300032005 Bacteria 1168
160 Ga0373935_0051651 3300035692 Bacteria 2611
161 Ga0373937_1081453 3300036401 Bacteria 751
162 Ga0395905_0000096 3300037471 Bacteria 146075
163 Ga0451791_1041800 3300041451 Bacteria 770
164 Ga0451839_0234007 3300041496 Bacteria 1064
165 Ga0451845_0955902 3300041501 Unclassified 543
166 Ga0451843_0018869 3300041509 Bacteria 506
167 Ga0451853_1999524 3300041512 Unclassified 823
168 Ga0439431_0125365 3300041997 Bacteria 718
169 Ga0439441_083495 3300042001 Bacteria 698
170 Ga0451577_0000076 3300042876 Bacteria 225346
171 Ga0451577_0011219 3300042876 Bacteria 8497
172 Ga0451577_0044319 3300042876 Bacteria 3983
173 Ga0451577_0086941 3300042876 Bacteria 2789
174 Ga0451577_0213575 3300042876 Bacteria 1743
175 Ga0451577_0272377 3300042876 Bacteria 1533
176 Ga0451577_0326686 3300042876 Bacteria 1391
177 Ga0453683_0001898 3300044673 Bacteria 17074
178 Ga0453683_0200775 3300044673 Bacteria 1266
179 Ga0453683_0342699 3300044673 Bacteria 959
180 Ga0466961_0032911 3300044693 Bacteria 3331
181 Ga0453684_0010484 3300044712 Bacteria 15831
182 Ga0453684_0022460 3300044712 Bacteria 9355
183 Ga0453684_0030710 3300044712 Bacteria 7580
184 Ga0453684_0153725 3300044712 Bacteria 2731
185 Ga0453684_0242446 3300044712 Bacteria 2074
186 Ga0453684_0595723 3300044712 Unclassified 1212
187 Ga0453684_0685557 3300044712 Bacteria 1115
188 Ga0453684_1234375 3300044712 Bacteria 783
189 Ga0453684_1462666 3300044712 Unclassified 706
190 Ga0466959_0141298 3300045049 Bacteria 1701
191 Ga0451576_0000075 3300045051 Bacteria 247981
192 Ga0451576_0000445 3300045051 Bacteria 93977
193 Ga0451576_0004026 3300045051 Bacteria 19541
194 Ga0451576_0057047 3300045051 Bacteria 4083
195 Ga0451576_0345040 3300045051 Bacteria 1559
196 Ga0466967_0007357 3300045976 Bacteria 7931
197 Ga0495630_0410880 3300046517 Bacteria 1037
198 Ga0495586_0398513 3300046535 Bacteria 792
199 Ga0495675_0128514 3300047444 Bacteria 1576
200 Ga0501290_029753 3300049513 Bacteria 779
201 Ga0501032_0003688 3300049569 Bacteria 11631
202 Ga0501033_0003213 3300049570 Bacteria 13530
203 Ga0501033_0003285 3300049570 Bacteria 13368
204 Ga0501034_0022179 3300049571 Bacteria 6470
205 Ga0501034_0096202 3300049571 Bacteria 2957
206 Ga0501036_0009876 3300049572 Bacteria 7857
207 Ga0501036_0058805 3300049572 Bacteria 3257
208 Ga0501037_0007196 3300049573 Bacteria 8128
209 Ga0501037_0191558 3300049573 Bacteria 1447
210 Ga0501038_0128726 3300049574 Bacteria 2081
211 Ga0501038_0134737 3300049574 Bacteria 2024
212 Ga0501038_0355254 3300049574 Bacteria 1141
213 Ga0501039_0033843 3300049575 Bacteria 3942
214 Ga0501042_0002320 3300049578 Bacteria 11647
215 Ga0501043_0071182 3300049579 Bacteria 2732
216 Ga0501043_0122081 3300049579 Bacteria 2043
217 Ga0501043_0376325 3300049579 Bacteria 1075
218 Ga0501046_0003808 3300049580 Bacteria 13802
219 Ga0501046_0013806 3300049580 Bacteria 6826
220 Ga0501046_0033674 3300049580 Bacteria 4138
221 Ga0501047_0031504 3300049581 Bacteria 5114
222 Ga0501047_0035918 3300049581 Bacteria 4787
223 Ga0501047_0064144 3300049581 Bacteria 3543
224 Ga0501047_0177483 3300049581 Bacteria 1997
225 Ga0501047_0664457 3300049581 Bacteria 861
226 Ga0501048_0032071 3300049582 Bacteria 3798
227 Ga0501068_1019915 3300049584 Unclassified 546
228 Ga0501070_0022046 3300049586 Bacteria 5336
229 Ga0501070_0624008 3300049586 Bacteria 858
230 Ga0501073_0244184 3300049589 Bacteria 1240
231 Ga0501243_012778 3300049675 Bacteria 1328
232 Ga0501080_0421848 3300049742 Bacteria 1198
233 Ga0501080_1323538 3300049742 Unclassified 616
234 Ga0501083_0001344 3300049744 Bacteria 16683
235 Ga0501083_0004310 3300049744 Bacteria 10023
236 Ga0501083_0061967 3300049744 Bacteria 2497
237 Ga0501035_0001373 3300049822 Bacteria 25060
238 Ga0501035_0004449 3300049822 Bacteria 13298
239 Ga0501035_0038780 3300049822 Bacteria 4313
240 Ga0501044_0000582 3300049823 Bacteria 44288
241 Ga0501044_0297754 3300049823 Bacteria 1543
242 Ga0501044_0399277 3300049823 Bacteria 1287
243 Ga0501045_0541948 3300049824 Bacteria 863
244 Ga0500651_0515185 3300053093 Bacteria 658
245 Ga0500568_0001869 3300053139 Bacteria 12967
246 Ga0500622_0045810 3300053156 Bacteria 2263
247 Ga0501082_0124892 3300060353 Bacteria 2232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025949 Ga0207667_11920862 Ga0207667_119208622 117
2 3300042876 Ga0451577_0213575 Ga0451577_0213575_975_1328 117
3 3300044712 Ga0453684_0022460 Ga0453684_0022460_4771_5124 117
4 3300045051 Ga0451576_0057047 Ga0451576_0057047_1704_2057 117
5 3300049586 Ga0501070_0624008 Ga0501070_0624008_380_733 117
6 3300031616 Ga0307508_10000026 Ga0307508_1000002658 118
7 3300049580 Ga0501046_0033674 Ga0501046_0033674_550_954 118
8 3300049581 Ga0501047_0064144 Ga0501047_0064144_2433_2837 118
9 3300013306 Ga0163162_11417330 Ga0163162_114173302 119
10 3300045051 Ga0451576_0345040 Ga0451576_0345040_263_622 119
11 3300028563 Ga0265319_1081444 Ga0265319_10814441 120
12 3300044693 Ga0466961_0032911 Ga0466961_0032911_1408_1779 120
13 3300045049 Ga0466959_0141298 Ga0466959_0141298_593_964 120
14 iso_pu_bacteria 2786546940 2788437786 120
15 3300045051 Ga0451576_0000445 Ga0451576_0000445_37590_38000 122
16 3300045051 Ga0451576_0000075 Ga0451576_0000075_209597_209974 123
17 3300005336 Ga0070680_100826807 Ga0070680_1008268072 124
18 3300013308 Ga0157375_10638025 Ga0157375_106380252 124
19 3300028563 Ga0265319_1000188 Ga0265319_100018828 124
20 3300028563 Ga0265319_1001714 Ga0265319_10017142 124
21 3300028563 Ga0265319_1001996 Ga0265319_10019963 124
22 3300028563 Ga0265319_1007307 Ga0265319_10073073 124
23 3300028563 Ga0265319_1071638 Ga0265319_10716382 124
24 3300028577 Ga0265318_10000488 Ga0265318_1000048829 124
25 3300028577 Ga0265318_10004456 Ga0265318_100044563 124
26 3300028577 Ga0265318_10006785 Ga0265318_100067854 124
27 3300028577 Ga0265318_10201451 Ga0265318_102014512 124
28 3300029957 Ga0265324_10203871 Ga0265324_102038711 124
29 3300031240 Ga0265320_10000032 Ga0265320_1000003283 124
30 3300031240 Ga0265320_10002851 Ga0265320_1000285111 124
31 3300031240 Ga0265320_10029664 Ga0265320_100296643 124
32 3300031240 Ga0265320_10126183 Ga0265320_101261832 124
33 3300031242 Ga0265329_10054580 Ga0265329_100545802 124
34 3300031711 Ga0265314_10003983 Ga0265314_1000398314 124
35 3300041501 Ga0451845_0955902 Ga0451845_0955902_72_470 124
36 3300042876 Ga0451577_0044319 Ga0451577_0044319_3427_3801 124
37 3300044673 Ga0453683_0200775 Ga0453683_0200775_129_533 124
38 3300044712 Ga0453684_0595723 Ga0453684_0595723_767_1141 124
39 3300049513 Ga0501290_029753 Ga0501290_029753_165_575 124
40 3300049675 Ga0501243_012778 Ga0501243_012778_359_775 124
41 3300031240 Ga0265320_10094640 Ga0265320_100946402 125
42 3300037471 Ga0395905_0000096 Ga0395905_0000096_8071_8463 125
43 3300044673 Ga0453683_0001898 Ga0453683_0001898_1924_2352 125
44 3300044673 Ga0453683_0342699 Ga0453683_0342699_91_519 125
45 3300003320 rootH2_10063276 rootH2_100632763 126
46 3300003323 rootH1_10073730 rootH1_100737302 126
47 3300005327 Ga0070658_10036133 Ga0070658_100361333 126
48 3300005329 Ga0070683_100034291 Ga0070683_1000342913 126
49 3300005330 Ga0070690_101712369 Ga0070690_1017123691 126
50 3300005331 Ga0070670_100277655 Ga0070670_1002776552 126
51 3300005334 Ga0068869_100000041 Ga0068869_10000004140 126
52 3300005338 Ga0068868_100042861 Ga0068868_1000428615 126
53 3300005440 Ga0070705_101574733 Ga0070705_1015747331 126
54 3300005459 Ga0068867_100001369 Ga0068867_1000013699 126
55 3300005530 Ga0070679_100022000 Ga0070679_1000220004 126
56 3300005535 Ga0070684_100308040 Ga0070684_1003080402 126
57 3300005539 Ga0068853_100186473 Ga0068853_1001864731 126
58 3300005563 Ga0068855_100839980 Ga0068855_1008399802 126
59 3300005614 Ga0068856_100178870 Ga0068856_1001788702 126
60 3300006175 Ga0070712_100452591 Ga0070712_1004525911 126
61 3300006237 Ga0097621_100009556 Ga0097621_1000095565 126
62 3300006358 Ga0068871_100034381 Ga0068871_1000343814 126
63 3300006881 Ga0068865_100012632 Ga0068865_1000126322 126
64 3300013105 Ga0157369_10185706 Ga0157369_101857063 126
65 3300014325 Ga0163163_10149399 Ga0163163_101493992 126
66 3300014968 Ga0157379_10871737 Ga0157379_108717371 126
67 3300014969 Ga0157376_10588450 Ga0157376_105884502 126
68 3300025909 Ga0207705_10031960 Ga0207705_100319603 126
69 3300025915 Ga0207693_10194092 Ga0207693_101940921 126
70 3300025917 Ga0207660_10747747 Ga0207660_107477471 126
71 3300025928 Ga0207700_10004940 Ga0207700_100049408 126
72 3300025938 Ga0207704_10002842 Ga0207704_100028429 126
73 3300025938 Ga0207704_10332136 Ga0207704_103321362 126
74 3300025938 Ga0207704_10344972 Ga0207704_103449721 126
75 3300025942 Ga0207689_10000510 Ga0207689_1000051023 126
76 3300025944 Ga0207661_10004049 Ga0207661_1000404910 126
77 3300026023 Ga0207677_10070744 Ga0207677_100707442 126
78 3300026023 Ga0207677_10153534 Ga0207677_101535342 126
79 3300026041 Ga0207639_10054700 Ga0207639_100547002 126
80 3300026078 Ga0207702_10036688 Ga0207702_100366882 126
81 3300026089 Ga0207648_10001280 Ga0207648_1000128020 126
82 3300026095 Ga0207676_11576532 Ga0207676_115765321 126
83 3300026121 Ga0207683_10266978 Ga0207683_102669782 126
84 3300028556 Ga0265337_1003146 Ga0265337_10031465 126
85 3300028556 Ga0265337_1030771 Ga0265337_10307713 126
86 3300028558 Ga0265326_10091240 Ga0265326_100912402 126
87 3300028563 Ga0265319_1008712 Ga0265319_10087124 126
88 3300028563 Ga0265319_1019163 Ga0265319_10191634 126
89 3300028563 Ga0265319_1028412 Ga0265319_10284122 126
90 3300028563 Ga0265319_1124664 Ga0265319_11246641 126
91 3300028573 Ga0265334_10074267 Ga0265334_100742672 126
92 3300028573 Ga0265334_10331204 Ga0265334_103312041 126
93 3300028577 Ga0265318_10000819 Ga0265318_1000081910 126
94 3300028577 Ga0265318_10002336 Ga0265318_100023365 126
95 3300028577 Ga0265318_10002460 Ga0265318_1000246012 126
96 3300028577 Ga0265318_10055582 Ga0265318_100555822 126
97 3300028577 Ga0265318_10120990 Ga0265318_101209901 126
98 3300028577 Ga0265318_10197584 Ga0265318_101975842 126
99 3300028654 Ga0265322_10008478 Ga0265322_100084783 126
100 3300028666 Ga0265336_10000623 Ga0265336_1000062310 126
101 3300028666 Ga0265336_10006820 Ga0265336_100068202 126
102 3300028800 Ga0265338_10002481 Ga0265338_100024817 126
103 3300028800 Ga0265338_10087021 Ga0265338_100870213 126
104 3300028800 Ga0265338_10293499 Ga0265338_102934992 126
105 3300028800 Ga0265338_10392057 Ga0265338_103920572 126
106 3300029957 Ga0265324_10001962 Ga0265324_100019625 126
107 3300029957 Ga0265324_10022797 Ga0265324_100227973 126
108 3300029957 Ga0265324_10060516 Ga0265324_100605163 126
109 3300029957 Ga0265324_10103847 Ga0265324_101038472 126
110 3300031090 Ga0265760_10153053 Ga0265760_101530532 126
111 3300031238 Ga0265332_10044657 Ga0265332_100446572 126
112 3300031238 Ga0265332_10240335 Ga0265332_102403352 126
113 3300031239 Ga0265328_10080861 Ga0265328_100808612 126
114 3300031240 Ga0265320_10001041 Ga0265320_100010415 126
115 3300031240 Ga0265320_10029916 Ga0265320_100299162 126
116 3300031240 Ga0265320_10222374 Ga0265320_102223741 126
117 3300031240 Ga0265320_10412931 Ga0265320_104129311 126
118 3300031241 Ga0265325_10006455 Ga0265325_100064552 126
119 3300031241 Ga0265325_10184372 Ga0265325_101843722 126
120 3300031247 Ga0265340_10469908 Ga0265340_104699081 126
121 3300031250 Ga0265331_10005726 Ga0265331_100057266 126
122 3300031250 Ga0265331_10070511 Ga0265331_100705112 126
123 3300031250 Ga0265331_10119958 Ga0265331_101199581 126
124 3300031250 Ga0265331_10234534 Ga0265331_102345341 126
125 3300031251 Ga0265327_10000204 Ga0265327_1000020492 126
126 3300031251 Ga0265327_10000744 Ga0265327_1000074441 126
127 3300031251 Ga0265327_10001250 Ga0265327_1000125011 126
128 3300031251 Ga0265327_10008738 Ga0265327_100087383 126
129 3300031251 Ga0265327_10039891 Ga0265327_100398915 126
130 3300031344 Ga0265316_10004494 Ga0265316_100044944 126
131 3300031344 Ga0265316_10028443 Ga0265316_100284435 126
132 3300031344 Ga0265316_10491828 Ga0265316_104918282 126
133 3300031344 Ga0265316_10687093 Ga0265316_106870932 126
134 3300031548 Ga0307408_100000003 Ga0307408_100000003350 126
135 3300031595 Ga0265313_10002258 Ga0265313_100022582 126
136 3300031595 Ga0265313_10003290 Ga0265313_1000329010 126
137 3300031595 Ga0265313_10032506 Ga0265313_100325064 126
138 3300031711 Ga0265314_10002416 Ga0265314_100024168 126
139 3300031711 Ga0265314_10061548 Ga0265314_100615482 126
140 3300031711 Ga0265314_10153101 Ga0265314_101531011 126
141 3300031711 Ga0265314_10191984 Ga0265314_101919841 126
142 3300031712 Ga0265342_10031662 Ga0265342_100316624 126
143 3300031852 Ga0307410_10000039 Ga0307410_1000003936 126
144 3300031903 Ga0307407_10020455 Ga0307407_100204555 126
145 3300031911 Ga0307412_10062892 Ga0307412_100628922 126
146 3300031911 Ga0307412_11119237 Ga0307412_111192372 126
147 3300031995 Ga0307409_100000018 Ga0307409_10000001831 126
148 3300032002 Ga0307416_100000027 Ga0307416_100000027113 126
149 3300032002 Ga0307416_101505313 Ga0307416_1015053131 126
150 3300032002 Ga0307416_102303155 Ga0307416_1023031551 126
151 3300032005 Ga0307411_10375050 Ga0307411_103750502 126
152 3300035692 Ga0373935_0051651 Ga0373935_0051651_1213_1623 126
153 3300041451 Ga0451791_1041800 Ga0451791_1041800_315_695 126
154 3300041509 Ga0451843_0018869 Ga0451843_0018869_23_442 126
155 3300041512 Ga0451853_1999524 Ga0451853_1999524_310_702 126
156 3300042001 Ga0439441_083495 Ga0439441_083495_106_486 126
157 3300042876 Ga0451577_0000076 Ga0451577_0000076_45816_46196 126
158 3300042876 Ga0451577_0011219 Ga0451577_0011219_6747_7127 126
159 3300042876 Ga0451577_0086941 Ga0451577_0086941_2211_2591 126
160 3300042876 Ga0451577_0272377 Ga0451577_0272377_65_445 126
161 3300042876 Ga0451577_0326686 Ga0451577_0326686_132_554 126
162 3300044712 Ga0453684_0010484 Ga0453684_0010484_5335_5715 126
163 3300044712 Ga0453684_0030710 Ga0453684_0030710_5839_6252 126
164 3300044712 Ga0453684_0153725 Ga0453684_0153725_225_605 126
165 3300044712 Ga0453684_0242446 Ga0453684_0242446_351_731 126
166 3300044712 Ga0453684_0685557 Ga0453684_0685557_543_971 126
167 3300044712 Ga0453684_1234375 Ga0453684_1234375_120_533 126
168 3300044712 Ga0453684_1462666 Ga0453684_1462666_116_547 126
169 3300045051 Ga0451576_0004026 Ga0451576_0004026_8678_9109 126
170 3300046517 Ga0495630_0410880 Ga0495630_0410880_533_913 126
171 3300046535 Ga0495586_0398513 Ga0495586_0398513_369_749 126
172 3300047444 Ga0495675_0128514 Ga0495675_0128514_825_1205 126
173 3300049569 Ga0501032_0003688 Ga0501032_0003688_2087_2467 126
174 3300049570 Ga0501033_0003213 Ga0501033_0003213_5741_6136 126
175 3300049570 Ga0501033_0003285 Ga0501033_0003285_8239_8646 126
176 3300049571 Ga0501034_0096202 Ga0501034_0096202_2353_2760 126
177 3300049572 Ga0501036_0009876 Ga0501036_0009876_5981_6388 126
178 3300049572 Ga0501036_0058805 Ga0501036_0058805_1010_1390 126
179 3300049573 Ga0501037_0007196 Ga0501037_0007196_5901_6296 126
180 3300049573 Ga0501037_0191558 Ga0501037_0191558_300_707 126
181 3300049574 Ga0501038_0128726 Ga0501038_0128726_1158_1553 126
182 3300049574 Ga0501038_0134737 Ga0501038_0134737_873_1280 126
183 3300049574 Ga0501038_0355254 Ga0501038_0355254_686_1066 126
184 3300049575 Ga0501039_0033843 Ga0501039_0033843_1284_1691 126
185 3300049578 Ga0501042_0002320 Ga0501042_0002320_1071_1478 126
186 3300049579 Ga0501043_0071182 Ga0501043_0071182_1295_1690 126
187 3300049579 Ga0501043_0122081 Ga0501043_0122081_1337_1744 126
188 3300049579 Ga0501043_0376325 Ga0501043_0376325_347_727 126
189 3300049580 Ga0501046_0003808 Ga0501046_0003808_1533_1928 126
190 3300049580 Ga0501046_0013806 Ga0501046_0013806_198_605 126
191 3300049581 Ga0501047_0031504 Ga0501047_0031504_3967_4374 126
192 3300049581 Ga0501047_0035918 Ga0501047_0035918_1551_1931 126
193 3300049581 Ga0501047_0177483 Ga0501047_0177483_1499_1894 126
194 3300049582 Ga0501048_0032071 Ga0501048_0032071_3194_3601 126
195 3300049584 Ga0501068_1019915 Ga0501068_1019915_45_440 126
196 3300049586 Ga0501070_0022046 Ga0501070_0022046_1000_1407 126
197 3300049589 Ga0501073_0244184 Ga0501073_0244184_678_1073 126
198 3300049742 Ga0501080_0421848 Ga0501080_0421848_333_740 126
199 3300049742 Ga0501080_1323538 Ga0501080_1323538_118_513 126
200 3300049744 Ga0501083_0001344 Ga0501083_0001344_10367_10765 126
201 3300049744 Ga0501083_0004310 Ga0501083_0004310_2780_3178 126
202 3300049744 Ga0501083_0061967 Ga0501083_0061967_2050_2457 126
203 3300049822 Ga0501035_0001373 Ga0501035_0001373_19283_19663 126
204 3300049822 Ga0501035_0004449 Ga0501035_0004449_11512_11919 126
205 3300049822 Ga0501035_0038780 Ga0501035_0038780_2476_2871 126
206 3300049823 Ga0501044_0000582 Ga0501044_0000582_30312_30692 126
207 3300049823 Ga0501044_0399277 Ga0501044_0399277_453_860 126
208 3300049824 Ga0501045_0541948 Ga0501045_0541948_418_825 126
209 3300053093 Ga0500651_0515185 Ga0500651_0515185_133_540 126
210 3300053139 Ga0500568_0001869 Ga0500568_0001869_10587_10967 126
211 3300053156 Ga0500622_0045810 Ga0500622_0045810_853_1233 126
212 3300060353 Ga0501082_0124892 Ga0501082_0124892_1091_1489 126
213 3300028563 Ga0265319_1000809 Ga0265319_100080921 127
214 3300028563 Ga0265319_1003254 Ga0265319_10032544 127
215 3300028577 Ga0265318_10000129 Ga0265318_1000012954 127
216 3300028794 Ga0307515_10442314 Ga0307515_104423142 127
217 3300031240 Ga0265320_10001565 Ga0265320_100015659 127
218 3300031595 Ga0265313_10021923 Ga0265313_100219232 127
219 3300031711 Ga0265314_10002681 Ga0265314_1000268115 127
220 3300031711 Ga0265314_10028008 Ga0265314_100280082 127
221 3300036401 Ga0373937_1081453 Ga0373937_1081453_319_702 127
222 3300041496 Ga0451839_0234007 Ga0451839_0234007_350_733 127
223 3300049571 Ga0501034_0022179 Ga0501034_0022179_2325_2708 127
224 3300049581 Ga0501047_0664457 Ga0501047_0664457_10_393 127
225 3300049823 Ga0501044_0297754 Ga0501044_0297754_574_957 127
226 3300003316 rootH1_10158858 rootH1_101588582 128
227 3300003323 rootH1_10092443 rootH1_100924434 128
228 3300005434 Ga0070709_11594794 Ga0070709_115947941 128
229 3300006028 Ga0070717_10000037 Ga0070717_1000003790 128
230 3300006881 Ga0068865_100952237 Ga0068865_1009522372 128
231 3300009093 Ga0105240_10437601 Ga0105240_104376012 128
232 3300014325 Ga0163163_10591996 Ga0163163_105919962 128
233 3300014968 Ga0157379_11901698 Ga0157379_119016981 128
234 3300025913 Ga0207695_10141997 Ga0207695_101419972 128
235 3300028563 Ga0265319_1003289 Ga0265319_10032899 128
236 3300028573 Ga0265334_10047193 Ga0265334_100471933 128
237 3300028577 Ga0265318_10000004 Ga0265318_10000004274 128
238 3300028577 Ga0265318_10015511 Ga0265318_100155114 128
239 3300031238 Ga0265332_10084861 Ga0265332_100848612 128
240 3300031240 Ga0265320_10008976 Ga0265320_100089766 128
241 3300031240 Ga0265320_10030227 Ga0265320_100302273 128
242 3300031242 Ga0265329_10047006 Ga0265329_100470062 128
243 3300031344 Ga0265316_10044518 Ga0265316_100445182 128
244 3300031344 Ga0265316_11067107 Ga0265316_110671071 128
245 3300031595 Ga0265313_10010637 Ga0265313_100106377 128
246 3300031711 Ga0265314_10001147 Ga0265314_1000114724 128
247 3300041997 Ga0439431_0125365 Ga0439431_0125365_177_575 128
248 3300045976 Ga0466967_0007357 Ga0466967_0007357_2384_2773 128

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

40

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.9118 24 116
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.8785 23 117
1x0g-assembly1.cif.gz_C crystal structure of isca with the [2fe-2s] cluster 0.8674 24 123
1x0g-assembly1.cif.gz_A crystal structure of isca with the [2fe-2s] cluster 0.8623 24 117
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.8611 24 117
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.9118 24 116 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8931 24 116 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8888 24 102 2.60.300.12
1x0gA00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8623 24 117 2.60.300.12
1s98A00 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8611 24 117 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A349WGQ1-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.983 16 116 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A7X9HXH7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9458 24 114 GO:0005506
GO:0016020
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A496B2X7-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9208 23 116 GO:0005506
GO:0016226
GO:0051537
AF-A0A1G1M7N8-F1-model_v4 FeS cluster biogenesis domain-containing protein 0.92 24 117 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035
AF-A0A2E4HKM4-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.9095 22 117 GO:0005506
GO:0016226
GO:0051537
GO:0051539
GO:0106035

Feature Viewer

pLDDT pTM Quality
81.83 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map