F359646

General Info

Members Datasets Scaffolds Average Seq Length
248 157 248 133

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100228619|Ga0070674_1002286192
Length 155
Sequence VTDSAPQTRGQMAGPASRSPVRVRYAETDQMGVVYYANYFVWFEIGRTDLLRTLGSTYRQLEAEGLSLPVIEASCQYAAPCLYDEELVVVTRGRLLSPIRVSFSYAVERADGTVAARGRTEHAALGPDGRPRRLPAFLRDALTVAARSAPPGSSR

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
104 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
113 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
114 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
115 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
116 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
142 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.23
Nodule 0
Rhizoplane 2.42
Rhizosphere 93.95
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10759843 3300005295 Bacteria 615
2 Ga0070676_10017401 3300005328 Bacteria 3979
3 Ga0070676_11142895 3300005328 Unclassified 590
4 Ga0070670_100071634 3300005331 Bacteria 2976
5 Ga0070670_100410913 3300005331 Bacteria 1196
6 Ga0070677_10490438 3300005333 Bacteria 664
7 Ga0070666_10066402 3300005335 Bacteria 2448
8 Ga0070666_10260504 3300005335 Bacteria 1229
9 Ga0070680_100856158 3300005336 Bacteria 784
10 Ga0068868_100693815 3300005338 Bacteria 910
11 Ga0070691_10001774 3300005341 Bacteria 9379
12 Ga0070668_100024853 3300005347 Bacteria 4541
13 Ga0070669_100015502 3300005353 Bacteria 5432
14 Ga0070675_100223123 3300005354 Bacteria 1642
15 Ga0070671_100618154 3300005355 Bacteria 937
16 Ga0070674_100228619 3300005356 Bacteria 1450
17 Ga0070674_100238124 3300005356 Bacteria 1423
18 Ga0070674_100560152 3300005356 Bacteria 960
19 Ga0070673_100250432 3300005364 Bacteria 1544
20 Ga0070673_100500896 3300005364 Bacteria 1098
21 Ga0070673_101793336 3300005364 Bacteria 581
22 Ga0070714_100057997 3300005435 Bacteria 3316
23 Ga0070713_100061623 3300005436 Bacteria 3139
24 Ga0070701_10109277 3300005438 Bacteria 1543
25 Ga0070701_10170104 3300005438 Bacteria 1268
26 Ga0070705_100012816 3300005440 Bacteria 4274
27 Ga0070705_100094454 3300005440 Bacteria 1872
28 Ga0070700_100034309 3300005441 Bacteria 3064
29 Ga0070700_100220665 3300005441 Bacteria 1343
30 Ga0070700_100431589 3300005441 Bacteria 998
31 Ga0070694_100061996 3300005444 Bacteria 2554
32 Ga0070708_100639286 3300005445 Bacteria 1003
33 Ga0070662_100122339 3300005457 Bacteria 1996
34 Ga0070662_100348446 3300005457 Bacteria 1213
35 Ga0068867_100027261 3300005459 Bacteria 4104
36 Ga0068867_100392365 3300005459 Bacteria 1169
37 Ga0070685_10642685 3300005466 Bacteria 768
38 Ga0070685_11240826 3300005466 Bacteria 568
39 Ga0070706_100952892 3300005467 Bacteria 792
40 Ga0070707_100842537 3300005468 Bacteria 881
41 Ga0070698_100325262 3300005471 Bacteria 1468
42 Ga0070698_100469227 3300005471 Bacteria 1195
43 Ga0070672_100746398 3300005543 Bacteria 859
44 Ga0070672_101076243 3300005543 Unclassified 714
45 Ga0070695_100118822 3300005545 Bacteria 1805
46 Ga0070695_100286766 3300005545 Bacteria 1212
47 Ga0070696_100044643 3300005546 Bacteria 3069
48 Ga0070665_100013642 3300005548 Bacteria 8174
49 Ga0070704_100024158 3300005549 Bacteria 3984
50 Ga0070704_100127305 3300005549 Bacteria 1967
51 Ga0070704_100874070 3300005549 Bacteria 807
52 Ga0068857_100208450 3300005577 Bacteria 1783
53 Ga0068854_100281819 3300005578 Bacteria 1338
54 Ga0068854_100626992 3300005578 Bacteria 921
55 Ga0068856_100785439 3300005614 Bacteria 972
56 Ga0070702_100988448 3300005615 Bacteria 665
57 Ga0068859_101254486 3300005617 Unclassified 816
58 Ga0068864_100031124 3300005618 Bacteria 4526
59 Ga0068866_10056705 3300005718 Bacteria 2015
60 Ga0068866_10096320 3300005718 Bacteria 1623
61 Ga0068861_100237560 3300005719 Bacteria 1548
62 Ga0068861_100516280 3300005719 Bacteria 1083
63 Ga0068861_101736461 3300005719 Bacteria 618
64 Ga0068858_100129613 3300005842 Bacteria 2364
65 Ga0068858_100754895 3300005842 Bacteria 948
66 Ga0068860_100238905 3300005843 Bacteria 1767
67 Ga0068860_101471733 3300005843 Bacteria 703
68 Ga0068862_100066537 3300005844 Bacteria 3105
69 Ga0068862_100730127 3300005844 Bacteria 962
70 Ga0075365_10001998 3300006038 Bacteria 9667
71 Ga0075364_10929248 3300006051 Bacteria 592
72 Ga0075367_10879786 3300006178 Bacteria 571
73 Ga0075433_10432716 3300006852 Bacteria 1160
74 Ga0075433_10981581 3300006852 Bacteria 736
75 Ga0075434_100267612 3300006871 Bacteria 1728
76 Ga0075434_100621669 3300006871 Bacteria 1099
77 Ga0068865_100033009 3300006881 Bacteria 3463
78 Ga0068865_100179878 3300006881 Bacteria 1628
79 Ga0075436_100028414 3300006914 Bacteria 3847
80 Ga0075436_100074375 3300006914 Bacteria 2352
81 Ga0097620_101254517 3300006931 Unclassified 816
82 Ga0075435_100045790 3300007076 Bacteria 3508
83 Ga0075435_100119361 3300007076 Bacteria 2199
84 Ga0105240_10274018 3300009093 Bacteria 1942
85 Ga0105240_10503846 3300009093 Bacteria 1346
86 Ga0105240_11324823 3300009093 Bacteria 759
87 Ga0111539_10004974 3300009094 Bacteria 17299
88 Ga0111539_10144545 3300009094 Bacteria 2784
89 Ga0111539_10193656 3300009094 Bacteria 2372
90 Ga0111539_10354701 3300009094 Bacteria 1707
91 Ga0111539_10380983 3300009094 Bacteria 1642
92 Ga0111539_10467792 3300009094 Bacteria 1468
93 Ga0105245_10030481 3300009098 Bacteria 4769
94 Ga0105245_10870188 3300009098 Bacteria 942
95 Ga0105247_10816932 3300009101 Bacteria 713
96 Ga0114129_10016354 3300009147 Bacteria 10560
97 Ga0114129_10533214 3300009147 Unclassified 1529
98 Ga0114129_10678629 3300009147 Bacteria 1327
99 Ga0105243_10025372 3300009148 Bacteria 4529
100 Ga0105243_10216536 3300009148 Bacteria 1690
101 Ga0105242_10245421 3300009176 Bacteria 1611
102 Ga0105242_10302379 3300009176 Bacteria 1461
103 Ga0105242_10494175 3300009176 Bacteria 1162
104 Ga0105242_11133994 3300009176 Bacteria 798
105 Ga0105242_11993394 3300009176 Bacteria 623
106 Ga0105248_10375900 3300009177 Bacteria 1600
107 Ga0105248_10843447 3300009177 Bacteria 1034
108 Ga0105248_11121413 3300009177 Bacteria 889
109 Ga0105248_11830300 3300009177 Bacteria 689
110 Ga0105238_10154211 3300009551 Bacteria 2272
111 Ga0105249_10697353 3300009553 Bacteria 1075
112 Ga0157378_10840883 3300013297 Bacteria 946
113 Ga0163162_10346303 3300013306 Bacteria 1619
114 Ga0157375_10793265 3300013308 Bacteria 1096
115 Ga0163163_10037345 3300014325 Bacteria 4725
116 Ga0157380_10089553 3300014326 Bacteria 2535
117 Ga0157380_10532921 3300014326 Bacteria 1148
118 Ga0157377_10559521 3300014745 Bacteria 809
119 Ga0157379_10115724 3300014968 Bacteria 2411
120 Ga0157379_11099346 3300014968 Bacteria 761
121 Ga0157379_12082066 3300014968 Unclassified 562
122 Ga0157376_11600354 3300014969 Bacteria 686
123 Ga0207682_10452609 3300025893 Bacteria 608
124 Ga0207692_10461114 3300025898 Bacteria 801
125 Ga0207642_10084261 3300025899 Bacteria 1552
126 Ga0207710_10393973 3300025900 Bacteria 710
127 Ga0207699_10152079 3300025906 Bacteria 1532
128 Ga0207645_10023984 3300025907 Bacteria 3959
129 Ga0207645_10479073 3300025907 Bacteria 841
130 Ga0207660_10666236 3300025917 Bacteria 849
131 Ga0207662_10618024 3300025918 Bacteria 755
132 Ga0207681_10101372 3300025923 Bacteria 2077
133 Ga0207687_11209642 3300025927 Unclassified 649
134 Ga0207700_10054752 3300025928 Bacteria 2996
135 Ga0207664_10025522 3300025929 Bacteria 4455
136 Ga0207644_10441157 3300025931 Bacteria 1069
137 Ga0207706_10044668 3300025933 Bacteria 3927
138 Ga0207706_10331860 3300025933 Bacteria 1323
139 Ga0207686_11432978 3300025934 Bacteria 569
140 Ga0207709_10023026 3300025935 Bacteria 3541
141 Ga0207709_10242341 3300025935 Bacteria 1312
142 Ga0207669_10038142 3300025937 Bacteria 2764
143 Ga0207669_10058891 3300025937 Bacteria 2346
144 Ga0207704_10640769 3300025938 Bacteria 874
145 Ga0207711_10323637 3300025941 Bacteria 1425
146 Ga0207711_10469268 3300025941 Bacteria 1172
147 Ga0207689_10443791 3300025942 Bacteria 1084
148 Ga0207651_10292154 3300025960 Bacteria 1352
149 Ga0207712_10251925 3300025961 Bacteria 1428
150 Ga0207668_10023855 3300025972 Bacteria 3940
151 Ga0207668_10057438 3300025972 Bacteria 2715
152 Ga0207640_10275246 3300025981 Bacteria 1319
153 Ga0207640_10396512 3300025981 Bacteria 1123
154 Ga0207703_10127719 3300026035 Bacteria 2191
155 Ga0207703_10614544 3300026035 Bacteria 1029
156 Ga0207703_10869182 3300026035 Bacteria 863
157 Ga0207708_10095294 3300026075 Bacteria 2298
158 Ga0207708_10162291 3300026075 Bacteria 1765
159 Ga0207708_10476982 3300026075 Bacteria 1042
160 Ga0207648_10008617 3300026089 Bacteria 9859
161 Ga0207648_10075748 3300026089 Bacteria 2933
162 Ga0207648_10111132 3300026089 Bacteria 2406
163 Ga0207648_10405322 3300026089 Bacteria 1236
164 Ga0207648_10833103 3300026089 Bacteria 860
165 Ga0207674_11140740 3300026116 Bacteria 749
166 Ga0207675_100002329 3300026118 Bacteria 18829
167 Ga0207428_10019602 3300027907 Bacteria 5764
168 Ga0207428_10158216 3300027907 Bacteria 1721
169 Ga0268265_10025651 3300028380 Bacteria 4187
170 Ga0307513_10631025 3300031456 Bacteria 779
171 Ga0316576_10563151 3300031727 Bacteria 834
172 Ga0373958_0065818 3300034819 Bacteria 795
173 Ga0373926_0344733 3300035083 Unclassified 584
174 Ga0373960_0004534 3300035121 Bacteria 3189
175 Ga0373943_0072883 3300035170 Bacteria 1743
176 Ga0373943_0713914 3300035170 Bacteria 594
177 Ga0373962_0087419 3300035242 Bacteria 955
178 Ga0373931_0461926 3300035691 Bacteria 813
179 Ga0373947_0145276 3300035725 Bacteria 1524
180 Ga0373925_0205364 3300037068 Bacteria 1568
181 Ga0450920_014899 3300042122 Bacteria 1475
182 Ga0450923_005340 3300042125 Bacteria 2068
183 Ga0450894_009272 3300042131 Bacteria 1276
184 Ga0450908_004737 3300042184 Bacteria 2619
185 Ga0439435_0006384 3300042436 Bacteria 2647
186 Ga0466967_0595561 3300045976 Bacteria 1091
187 Ga0495638_0007626 3300046460 Bacteria 7734
188 Ga0495674_1091369 3300047319 Bacteria 608
189 Ga0496100_0391720 3300048903 Bacteria 1057
190 Ga0496104_0196663 3300048907 Bacteria 1928
191 Ga0496106_1067000 3300048909 Bacteria 634
192 Ga0496107_0235296 3300048910 Bacteria 1363
193 Ga0496112_0070709 3300048915 Bacteria 3449
194 Ga0496112_0767107 3300048915 Bacteria 890
195 Ga0501031_0091216 3300049568 Bacteria 1987
196 Ga0501033_0181612 3300049570 Bacteria 1508
197 Ga0501034_0030152 3300049571 Bacteria 5512
198 Ga0501036_0270941 3300049572 Bacteria 1421
199 Ga0501036_0514805 3300049572 Bacteria 995
200 Ga0501038_0236397 3300049574 Bacteria 1452
201 Ga0501039_0160685 3300049575 Bacteria 1766
202 Ga0501040_0035844 3300049576 Bacteria 3366
203 Ga0501040_0432528 3300049576 Bacteria 946
204 Ga0501041_0041438 3300049577 Bacteria 2797
205 Ga0501041_0054308 3300049577 Bacteria 2444
206 Ga0501042_0023694 3300049578 Bacteria 4298
207 Ga0501042_0371916 3300049578 Bacteria 1034
208 Ga0501042_1256385 3300049578 Unclassified 540
209 Ga0501046_0565479 3300049580 Bacteria 809
210 Ga0501048_0036313 3300049582 Bacteria 3542
211 Ga0501048_0166614 3300049582 Bacteria 1560
212 Ga0501071_0062243 3300049587 Bacteria 2703
213 Ga0501071_0097243 3300049587 Bacteria 2167
214 Ga0501072_0118918 3300049588 Bacteria 2105
215 Ga0501074_0687599 3300049590 Unclassified 722
216 Ga0501075_0033309 3300049591 Bacteria 3833
217 Ga0501075_0136530 3300049591 Bacteria 1868
218 Ga0501076_0070841 3300049592 Bacteria 2788
219 Ga0501076_0436338 3300049592 Bacteria 1078
220 Ga0501077_0333740 3300049593 Bacteria 967
221 Ga0501079_0316370 3300049741 Bacteria 1222
222 Ga0501080_0111404 3300049742 Bacteria 2537
223 Ga0501080_1344332 3300049742 Unclassified 611
224 Ga0501081_0271290 3300049743 Bacteria 1241
225 Ga0501045_0012697 3300049824 Bacteria 5931
226 Ga0501045_0270239 3300049824 Bacteria 1266
227 nmdc:mga00v17_256289_c1 3300050491 Bacteria 1134
228 nmdc:mga00v17_957483_c1 3300050491 Bacteria 540
229 nmdc:mga0yw44_2307_c1 3300050492 Bacteria 8073
230 nmdc:mga0yw44_270534_c1 3300050492 Bacteria 1134
231 nmdc:mga06z11_531714_c1 3300050494 Bacteria 713
232 nmdc:mga05p37_191562_c2 3300050507 Bacteria 591
233 nmdc:mga05p37_216724_c1 3300050507 Bacteria 2312
234 nmdc:mga05p37_95715_c1 3300050507 Bacteria 3658
235 nmdc:mga08y16_266319_c1 3300050511 Bacteria 1769
236 nmdc:mga08y16_532452_c1 3300050511 Bacteria 1190
237 nmdc:mga08y16_8741_c1 3300050511 Bacteria 10623
238 nmdc:mga0n895_15813_c1 3300050512 Bacteria 6900
239 nmdc:mga0n895_167731_c1 3300050512 Bacteria 2227
240 nmdc:mga0rr50_28496_c1 3300050513 Bacteria 3927
241 nmdc:mga08x19_352516_c1 3300050514 Bacteria 1028
242 nmdc:mga08x19_45250_c1 3300050514 Bacteria 2813
243 nmdc:mga0a205_221568_c1 3300050515 Bacteria 1777
244 Ga0501084_0097488 3300054114 Bacteria 2468
245 Ga0501084_0552218 3300054114 Bacteria 973
246 Ga0501082_0090722 3300060353 Bacteria 2639
247 Ga0501082_0229477 3300060353 Bacteria 1616
248 Ga0530510_0446987 3300061734 Bacteria 977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10380983 Ga0111539_103809833 113
2 3300042122 Ga0450920_014899 Ga0450920_014899_891_1268 113
3 3300042125 Ga0450923_005340 Ga0450923_005340_1458_1835 113
4 3300042184 Ga0450908_004737 Ga0450908_004737_501_878 113
5 3300050492 nmdc:mga0yw44_270534_c1 nmdc:mga0yw44_270534_c1_747_1124 113
6 3300005435 Ga0070714_100057997 Ga0070714_1000579972 114
7 3300005436 Ga0070713_100061623 Ga0070713_1000616232 114
8 3300005577 Ga0068857_100208450 Ga0068857_1002084502 114
9 3300005617 Ga0068859_101254486 Ga0068859_1012544862 114
10 3300005618 Ga0068864_100031124 Ga0068864_1000311245 114
11 3300005718 Ga0068866_10096320 Ga0068866_100963202 114
12 3300006931 Ga0097620_101254517 Ga0097620_1012545172 114
13 3300009093 Ga0105240_10274018 Ga0105240_102740183 114
14 3300009176 Ga0105242_11133994 Ga0105242_111339941 114
15 3300009176 Ga0105242_11993394 Ga0105242_119933941 114
16 3300014325 Ga0163163_10037345 Ga0163163_100373452 114
17 3300014969 Ga0157376_11600354 Ga0157376_116003541 114
18 3300025928 Ga0207700_10054752 Ga0207700_100547524 114
19 3300025929 Ga0207664_10025522 Ga0207664_100255224 114
20 3300026089 Ga0207648_10111132 Ga0207648_101111322 114
21 3300042436 Ga0439435_0006384 Ga0439435_0006384_2155_2502 114
22 3300047319 Ga0495674_1091369 Ga0495674_1091369_120_563 114
23 3300049571 Ga0501034_0030152 Ga0501034_0030152_4264_4608 114
24 3300050507 nmdc:mga05p37_191562_c2 nmdc:mga05p37_191562_c2_41_385 114
25 3300014745 Ga0157377_10559521 Ga0157377_105595212 121
26 3300050491 nmdc:mga00v17_957483_c1 nmdc:mga00v17_957483_c1_119_520 121
27 3300005441 Ga0070700_100220665 Ga0070700_1002206653 122
28 3300005543 Ga0070672_101076243 Ga0070672_1010762431 122
29 3300009147 Ga0114129_10678629 Ga0114129_106786292 122
30 3300009148 Ga0105243_10025372 Ga0105243_100253723 122
31 3300009176 Ga0105242_10245421 Ga0105242_102454212 122
32 3300013297 Ga0157378_10840883 Ga0157378_108408832 122
33 3300049568 Ga0501031_0091216 Ga0501031_0091216_996_1364 122
34 3300049570 Ga0501033_0181612 Ga0501033_0181612_379_747 122
35 3300049572 Ga0501036_0270941 Ga0501036_0270941_248_616 122
36 3300049575 Ga0501039_0160685 Ga0501039_0160685_963_1331 122
37 3300049576 Ga0501040_0432528 Ga0501040_0432528_537_905 122
38 3300049577 Ga0501041_0054308 Ga0501041_0054308_1417_1785 122
39 3300049578 Ga0501042_0023694 Ga0501042_0023694_1114_1482 122
40 3300049580 Ga0501046_0565479 Ga0501046_0565479_115_483 122
41 3300049582 Ga0501048_0166614 Ga0501048_0166614_1053_1421 122
42 3300049587 Ga0501071_0062243 Ga0501071_0062243_1756_2124 122
43 3300049590 Ga0501074_0687599 Ga0501074_0687599_138_506 122
44 3300049591 Ga0501075_0033309 Ga0501075_0033309_2331_2699 122
45 3300049593 Ga0501077_0333740 Ga0501077_0333740_488_856 122
46 3300049741 Ga0501079_0316370 Ga0501079_0316370_21_389 122
47 3300049742 Ga0501080_0111404 Ga0501080_0111404_1161_1529 122
48 3300049824 Ga0501045_0012697 Ga0501045_0012697_4003_4371 122
49 3300050507 nmdc:mga05p37_95715_c1 nmdc:mga05p37_95715_c1_989_1357 122
50 3300054114 Ga0501084_0097488 Ga0501084_0097488_448_816 122
51 3300060353 Ga0501082_0090722 Ga0501082_0090722_1390_1758 122
52 3300005445 Ga0070708_100639286 Ga0070708_1006392862 124
53 3300006881 Ga0068865_100033009 Ga0068865_1000330094 124
54 3300009098 Ga0105245_10030481 Ga0105245_100304812 124
55 3300009098 Ga0105245_10870188 Ga0105245_108701882 124
56 3300009147 Ga0114129_10016354 Ga0114129_100163546 124
57 3300009176 Ga0105242_10494175 Ga0105242_104941752 124
58 3300009177 Ga0105248_11830300 Ga0105248_118303002 124
59 3300009551 Ga0105238_10154211 Ga0105238_101542112 124
60 3300013306 Ga0163162_10346303 Ga0163162_103463031 124
61 3300013308 Ga0157375_10793265 Ga0157375_107932652 124
62 3300014968 Ga0157379_11099346 Ga0157379_110993462 124
63 3300045976 Ga0466967_0595561 Ga0466967_0595561_463_846 124
64 3300050507 nmdc:mga05p37_216724_c1 nmdc:mga05p37_216724_c1_1550_1939 124
65 3300050494 nmdc:mga06z11_531714_c1 nmdc:mga06z11_531714_c1_52_522 125
66 3300025923 Ga0207681_10101372 Ga0207681_101013723 127
67 3300005338 Ga0068868_100693815 Ga0068868_1006938152 129
68 3300005328 Ga0070676_11142895 Ga0070676_111428951 130
69 3300005331 Ga0070670_100071634 Ga0070670_1000716343 130
70 3300005614 Ga0068856_100785439 Ga0068856_1007854392 130
71 3300005719 Ga0068861_101736461 Ga0068861_1017364612 130
72 3300006038 Ga0075365_10001998 Ga0075365_100019988 130
73 3300006178 Ga0075367_10879786 Ga0075367_108797861 130
74 3300009093 Ga0105240_11324823 Ga0105240_113248232 130
75 3300009094 Ga0111539_10144545 Ga0111539_101445453 130
76 3300009094 Ga0111539_10193656 Ga0111539_101936562 130
77 3300009094 Ga0111539_10354701 Ga0111539_103547012 130
78 3300009094 Ga0111539_10467792 Ga0111539_104677922 130
79 3300014968 Ga0157379_12082066 Ga0157379_120820662 130
80 3300026116 Ga0207674_11140740 Ga0207674_111407401 130
81 3300027907 Ga0207428_10158216 Ga0207428_101582162 130
82 3300031727 Ga0316576_10563151 Ga0316576_105631512 130
83 3300034819 Ga0373958_0065818 Ga0373958_0065818_80_475 130
84 3300035242 Ga0373962_0087419 Ga0373962_0087419_271_666 130
85 3300035691 Ga0373931_0461926 Ga0373931_0461926_35_430 130
86 3300049574 Ga0501038_0236397 Ga0501038_0236397_444_842 130
87 3300049576 Ga0501040_0035844 Ga0501040_0035844_1773_2171 130
88 3300049577 Ga0501041_0041438 Ga0501041_0041438_2144_2542 130
89 3300049578 Ga0501042_0371916 Ga0501042_0371916_446_844 130
90 3300049582 Ga0501048_0036313 Ga0501048_0036313_2110_2508 130
91 3300049587 Ga0501071_0097243 Ga0501071_0097243_801_1199 130
92 3300049588 Ga0501072_0118918 Ga0501072_0118918_1085_1483 130
93 3300049591 Ga0501075_0136530 Ga0501075_0136530_1411_1809 130
94 3300049592 Ga0501076_0436338 Ga0501076_0436338_25_423 130
95 3300050491 nmdc:mga00v17_256289_c1 nmdc:mga00v17_256289_c1_158_553 130
96 3300050492 nmdc:mga0yw44_2307_c1 nmdc:mga0yw44_2307_c1_457_855 130
97 3300050511 nmdc:mga08y16_266319_c1 nmdc:mga08y16_266319_c1_1061_1456 130
98 3300050511 nmdc:mga08y16_532452_c1 nmdc:mga08y16_532452_c1_605_1000 130
99 3300054114 Ga0501084_0552218 Ga0501084_0552218_259_654 130
100 3300005356 Ga0070674_100560152 Ga0070674_1005601522 131
101 3300005466 Ga0070685_10642685 Ga0070685_106426851 131
102 3300005843 Ga0068860_100238905 Ga0068860_1002389051 131
103 3300006051 Ga0075364_10929248 Ga0075364_109292482 131
104 3300031456 Ga0307513_10631025 Ga0307513_106310252 131
105 3300042131 Ga0450894_009272 Ga0450894_009272_788_1234 131
106 3300005335 Ga0070666_10066402 Ga0070666_100664022 132
107 3300005364 Ga0070673_100250432 Ga0070673_1002504322 132
108 3300005364 Ga0070673_101793336 Ga0070673_1017933361 132
109 3300005466 Ga0070685_11240826 Ga0070685_112408262 132
110 3300005467 Ga0070706_100952892 Ga0070706_1009528922 132
111 3300005468 Ga0070707_100842537 Ga0070707_1008425372 132
112 3300005471 Ga0070698_100325262 Ga0070698_1003252622 132
113 3300005471 Ga0070698_100469227 Ga0070698_1004692272 132
114 3300005545 Ga0070695_100286766 Ga0070695_1002867662 132
115 3300005548 Ga0070665_100013642 Ga0070665_10001364210 132
116 3300005549 Ga0070704_100024158 Ga0070704_1000241583 132
117 3300005844 Ga0068862_100730127 Ga0068862_1007301272 132
118 3300006852 Ga0075433_10981581 Ga0075433_109815811 132
119 3300009147 Ga0114129_10533214 Ga0114129_105332142 132
120 3300009177 Ga0105248_11121413 Ga0105248_111214132 132
121 3300025898 Ga0207692_10461114 Ga0207692_104611142 132
122 3300025927 Ga0207687_11209642 Ga0207687_112096421 132
123 3300026035 Ga0207703_10869182 Ga0207703_108691822 132
124 3300026089 Ga0207648_10833103 Ga0207648_108331032 132
125 3300035083 Ga0373926_0344733 Ga0373926_0344733_96_506 132
126 3300035170 Ga0373943_0072883 Ga0373943_0072883_423_833 132
127 3300035170 Ga0373943_0713914 Ga0373943_0713914_46_447 132
128 3300035725 Ga0373947_0145276 Ga0373947_0145276_764_1174 132
129 3300037068 Ga0373925_0205364 Ga0373925_0205364_409_819 132
130 3300048907 Ga0496104_0196663 Ga0496104_0196663_1472_1882 132
131 3300048915 Ga0496112_0070709 Ga0496112_0070709_2113_2523 132
132 3300048915 Ga0496112_0767107 Ga0496112_0767107_35_445 132
133 3300049572 Ga0501036_0514805 Ga0501036_0514805_23_427 132
134 3300049578 Ga0501042_1256385 Ga0501042_1256385_87_491 132
135 3300049592 Ga0501076_0070841 Ga0501076_0070841_2350_2754 132
136 3300049742 Ga0501080_1344332 Ga0501080_1344332_191_595 132
137 3300049743 Ga0501081_0271290 Ga0501081_0271290_511_915 132
138 3300049824 Ga0501045_0270239 Ga0501045_0270239_341_745 132
139 3300060353 Ga0501082_0229477 Ga0501082_0229477_1148_1552 132
140 3300061734 Ga0530510_0446987 Ga0530510_0446987_255_659 132
141 3300026089 Ga0207648_10405322 Ga0207648_104053222 133
142 3300005842 Ga0068858_100754895 Ga0068858_1007548952 134
143 3300009101 Ga0105247_10816932 Ga0105247_108169321 134
144 3300014968 Ga0157379_10115724 Ga0157379_101157243 134
145 3300025900 Ga0207710_10393973 Ga0207710_103939732 134
146 3300026035 Ga0207703_10614544 Ga0207703_106145442 134
147 3300050515 nmdc:mga0a205_221568_c1 nmdc:mga0a205_221568_c1_175_612 134
148 3300005331 Ga0070670_100410913 Ga0070670_1004109131 135
149 3300005347 Ga0070668_100024853 Ga0070668_1000248533 135
150 3300005354 Ga0070675_100223123 Ga0070675_1002231232 135
151 3300005356 Ga0070674_100228619 Ga0070674_1002286192 135
152 3300005457 Ga0070662_100348446 Ga0070662_1003484461 135
153 3300005543 Ga0070672_100746398 Ga0070672_1007463982 135
154 3300005719 Ga0068861_100516280 Ga0068861_1005162802 135
155 3300014326 Ga0157380_10532921 Ga0157380_105329212 135
156 3300025937 Ga0207669_10038142 Ga0207669_100381423 135
157 3300025972 Ga0207668_10023855 Ga0207668_100238553 135
158 3300005295 Ga0065707_10759843 Ga0065707_107598431 136
159 3300005328 Ga0070676_10017401 Ga0070676_100174013 136
160 3300005333 Ga0070677_10490438 Ga0070677_104904381 136
161 3300005335 Ga0070666_10260504 Ga0070666_102605042 136
162 3300005336 Ga0070680_100856158 Ga0070680_1008561582 136
163 3300005341 Ga0070691_10001774 Ga0070691_100017742 136
164 3300005353 Ga0070669_100015502 Ga0070669_1000155027 136
165 3300005355 Ga0070671_100618154 Ga0070671_1006181542 136
166 3300005356 Ga0070674_100238124 Ga0070674_1002381242 136
167 3300005364 Ga0070673_100500896 Ga0070673_1005008961 136
168 3300005438 Ga0070701_10109277 Ga0070701_101092772 136
169 3300005438 Ga0070701_10170104 Ga0070701_101701042 136
170 3300005440 Ga0070705_100012816 Ga0070705_1000128165 136
171 3300005440 Ga0070705_100094454 Ga0070705_1000944542 136
172 3300005441 Ga0070700_100034309 Ga0070700_1000343094 136
173 3300005441 Ga0070700_100431589 Ga0070700_1004315892 136
174 3300005444 Ga0070694_100061996 Ga0070694_1000619962 136
175 3300005457 Ga0070662_100122339 Ga0070662_1001223393 136
176 3300005459 Ga0068867_100027261 Ga0068867_1000272614 136
177 3300005459 Ga0068867_100392365 Ga0068867_1003923652 136
178 3300005545 Ga0070695_100118822 Ga0070695_1001188222 136
179 3300005546 Ga0070696_100044643 Ga0070696_1000446434 136
180 3300005549 Ga0070704_100127305 Ga0070704_1001273051 136
181 3300005549 Ga0070704_100874070 Ga0070704_1008740701 136
182 3300005578 Ga0068854_100281819 Ga0068854_1002818192 136
183 3300005578 Ga0068854_100626992 Ga0068854_1006269922 136
184 3300005615 Ga0070702_100988448 Ga0070702_1009884482 136
185 3300005718 Ga0068866_10056705 Ga0068866_100567052 136
186 3300005719 Ga0068861_100237560 Ga0068861_1002375603 136
187 3300005842 Ga0068858_100129613 Ga0068858_1001296132 136
188 3300005843 Ga0068860_101471733 Ga0068860_1014717332 136
189 3300005844 Ga0068862_100066537 Ga0068862_1000665374 136
190 3300006852 Ga0075433_10432716 Ga0075433_104327162 136
191 3300006871 Ga0075434_100267612 Ga0075434_1002676122 136
192 3300006871 Ga0075434_100621669 Ga0075434_1006216692 136
193 3300006881 Ga0068865_100179878 Ga0068865_1001798782 136
194 3300006914 Ga0075436_100028414 Ga0075436_1000284145 136
195 3300006914 Ga0075436_100074375 Ga0075436_1000743752 136
196 3300007076 Ga0075435_100045790 Ga0075435_1000457905 136
197 3300007076 Ga0075435_100119361 Ga0075435_1001193612 136
198 3300009093 Ga0105240_10503846 Ga0105240_105038462 136
199 3300009094 Ga0111539_10004974 Ga0111539_1000497411 136
200 3300009148 Ga0105243_10216536 Ga0105243_102165362 136
201 3300009176 Ga0105242_10302379 Ga0105242_103023792 136
202 3300009177 Ga0105248_10375900 Ga0105248_103759002 136
203 3300009177 Ga0105248_10843447 Ga0105248_108434472 136
204 3300009553 Ga0105249_10697353 Ga0105249_106973532 136
205 3300014326 Ga0157380_10089553 Ga0157380_100895533 136
206 3300025893 Ga0207682_10452609 Ga0207682_104526091 136
207 3300025899 Ga0207642_10084261 Ga0207642_100842612 136
208 3300025906 Ga0207699_10152079 Ga0207699_101520791 136
209 3300025907 Ga0207645_10023984 Ga0207645_100239844 136
210 3300025907 Ga0207645_10479073 Ga0207645_104790732 136
211 3300025917 Ga0207660_10666236 Ga0207660_106662362 136
212 3300025918 Ga0207662_10618024 Ga0207662_106180242 136
213 3300025931 Ga0207644_10441157 Ga0207644_104411572 136
214 3300025933 Ga0207706_10044668 Ga0207706_100446684 136
215 3300025933 Ga0207706_10331860 Ga0207706_103318602 136
216 3300025934 Ga0207686_11432978 Ga0207686_114329782 136
217 3300025935 Ga0207709_10023026 Ga0207709_100230264 136
218 3300025935 Ga0207709_10242341 Ga0207709_102423412 136
219 3300025937 Ga0207669_10058891 Ga0207669_100588912 136
220 3300025938 Ga0207704_10640769 Ga0207704_106407692 136
221 3300025941 Ga0207711_10323637 Ga0207711_103236372 136
222 3300025941 Ga0207711_10469268 Ga0207711_104692682 136
223 3300025942 Ga0207689_10443791 Ga0207689_104437912 136
224 3300025960 Ga0207651_10292154 Ga0207651_102921542 136
225 3300025961 Ga0207712_10251925 Ga0207712_102519252 136
226 3300025972 Ga0207668_10057438 Ga0207668_100574384 136
227 3300025981 Ga0207640_10275246 Ga0207640_102752462 136
228 3300025981 Ga0207640_10396512 Ga0207640_103965122 136
229 3300026035 Ga0207703_10127719 Ga0207703_101277193 136
230 3300026075 Ga0207708_10095294 Ga0207708_100952942 136
231 3300026075 Ga0207708_10162291 Ga0207708_101622912 136
232 3300026075 Ga0207708_10476982 Ga0207708_104769822 136
233 3300026089 Ga0207648_10008617 Ga0207648_100086178 136
234 3300026089 Ga0207648_10075748 Ga0207648_100757482 136
235 3300026118 Ga0207675_100002329 Ga0207675_10000232911 136
236 3300027907 Ga0207428_10019602 Ga0207428_100196024 136
237 3300028380 Ga0268265_10025651 Ga0268265_100256515 136
238 3300035121 Ga0373960_0004534 Ga0373960_0004534_206_616 136
239 3300046460 Ga0495638_0007626 Ga0495638_0007626_867_1337 136
240 3300048903 Ga0496100_0391720 Ga0496100_0391720_406_816 136
241 3300048909 Ga0496106_1067000 Ga0496106_1067000_139_549 136
242 3300048910 Ga0496107_0235296 Ga0496107_0235296_49_459 136
243 3300050511 nmdc:mga08y16_8741_c1 nmdc:mga08y16_8741_c1_2740_3150 136
244 3300050512 nmdc:mga0n895_15813_c1 nmdc:mga0n895_15813_c1_1068_1511 136
245 3300050512 nmdc:mga0n895_167731_c1 nmdc:mga0n895_167731_c1_444_854 136
246 3300050513 nmdc:mga0rr50_28496_c1 nmdc:mga0rr50_28496_c1_1646_2056 136
247 3300050514 nmdc:mga08x19_352516_c1 nmdc:mga08x19_352516_c1_462_905 136
248 3300050514 nmdc:mga08x19_45250_c1 nmdc:mga08x19_45250_c1_1912_2355 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

31

116

0.93

PF13279

4HBT_2

Thioesterase-like superfamily

23

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ae8-assembly1.cif.gz_B crystal structure of human them4 0.9152 59 116
4ae8-assembly2.cif.gz_C crystal structure of human them4 0.9129 59 116
1psu-assembly1.cif.gz_A structure of the e. coli paai protein from the phyenylacetic acid degradation operon 0.9104 59 116
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.9073 9 136
1z54-assembly1.cif.gz_C crystal structure of a hypothetical protein tt1821 from thermus thermophilus 0.906 9 135
ID Description Score Start End Superfamily
af_Q940V5_3_144_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9358 60 116 3.10.129.10
af_P34419_18_155_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9326 58 118 3.10.129.10
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9143 53 129 3.10.129.10
5v10B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9073 9 136 3.10.129.10
af_Q86HX3_15_154_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9052 61 114 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1Q7QXD5-F1-model_v4 Uncharacterized protein 0.9493 23 136 GO:0047617
AF-A0A3L7THT7-F1-model_v4 Acyl-CoA thioesterase 0.9386 32 135 GO:0006633
GO:0016790
AF-A0A6A7KY39-F1-model_v4 YbgC/FadM family acyl-CoA thioesterase (EC 3.1.2.-) 0.9362 8 136 GO:0047617
AF-A0A1F2S755-F1-model_v4 Thioesterase domain-containing protein 0.9337 9 135 GO:0047617
AF-A0A2V8E0S2-F1-model_v4 Acyl-CoA thioesterase 0.93 1 136 GO:0047617

Feature Viewer

pLDDT pTM Quality
87.63 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map