F359698

General Info

Members Datasets Scaffolds Average Seq Length
248 162 496 425

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100000351|Ga0070663_10000035116
Length 465
Sequence MAGSERDGKGGTRSYDAVIVGGSLAGCATAMFLGRAGARVAVVEKSPDPAAFKRICSHFIQASAVPTLARLDLLEPMEAAGAVRPRFHARVPWGWIEAPPERAGRGVNLRRSKLDPMLREHAAATPGVELLLGQTVREVRRAGAAVTGIVARDRDGVETVIEAPLTIGADGRDSSVVGLAGVKEKTYPHGRFAYGGYFEGVALRHAPDASVWMMDPDWAAAFPTDDGLIFCAVMPTKDRLPEFKADPVAAMIDYFDQAPEAPSLRSATLSDEGVLGKIDMTNRMRTPTAPGLALIGDAALATDPLFGIGCGWAFQTAEWLADSVAPALRGEEALEAGLRRYRRKHGRRLRGHAWMIHDYATGRKLQPPERLIFSAAARDPRVATIFDAFGTRRIGAARMIATATPLALAVNARYALARRRGRVGAAPPSVDPGRGTEPLDLGNPVGDKGLRVESERAGAGAGKAA

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
77 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
93 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
105 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
106 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
125 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
126 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
127 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
128 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
161 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
162 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.6
Metatranscriptomes 0
Isolates 0.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 12.1
Rhizosphere 81.45
Stem 0
Stem Tuber 0
Unclassified 6.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100000351 3300005455 Bacteria 24141
2 Ga0070658_10180663 3300005327 Bacteria 1775
3 Ga0070677_10000003 3300005333 Bacteria 81204
4 Ga0070666_10046278 3300005335 Bacteria 2917
5 Ga0070682_100000080 3300005337 Bacteria 85683
6 Ga0070660_100012354 3300005339 Bacteria 6096
7 Ga0070660_100060707 3300005339 Bacteria 2935
8 Ga0070689_100039557 3300005340 Bacteria 3611
9 Ga0070661_100000005 3300005344 Bacteria 220455
10 Ga0070669_100049623 3300005353 Bacteria 3064
11 Ga0070688_100002150 3300005365 Bacteria 9926
12 Ga0070688_100080637 3300005365 Bacteria 2105
13 Ga0070659_100000176 3300005366 Bacteria 49062
14 Ga0070667_100096572 3300005367 Bacteria 2548
15 Ga0070710_10000013 3300005437 Bacteria 117825
16 Ga0070678_100031711 3300005456 Bacteria 3650
17 Ga0070685_10000293 3300005466 Bacteria 31562
18 Ga0070679_100000621 3300005530 Bacteria 30165
19 Ga0070679_100156979 3300005530 Bacteria 2250
20 Ga0070684_100010988 3300005535 Bacteria 7200
21 Ga0070684_100272442 3300005535 Bacteria 1550
22 Ga0068853_100017989 3300005539 Bacteria 5842
23 Ga0070665_100000159 3300005548 Bacteria 122613
24 Ga0070665_100038015 3300005548 Bacteria 4838
25 Ga0070665_100270192 3300005548 Bacteria 1702
26 Ga0070665_100283038 3300005548 Bacteria 1660
27 Ga0070664_100017602 3300005564 Bacteria 5868
28 Ga0068854_100001309 3300005578 Bacteria 15008
29 Ga0068854_100012477 3300005578 Bacteria 5567
30 Ga0068856_100001818 3300005614 Bacteria 22286
31 Ga0068856_100061013 3300005614 Unclassified 3725
32 Ga0068852_100000012 3300005616 Bacteria 140734
33 Ga0068852_100012338 3300005616 Bacteria 6482
34 Ga0068864_100135206 3300005618 Bacteria 2219
35 Ga0068851_10000988 3300005834 Bacteria 12307
36 Ga0068851_10003390 3300005834 Bacteria 7091
37 Ga0068858_100000049 3300005842 Bacteria 122693
38 Ga0068860_100134907 3300005843 Unclassified 2370
39 Ga0081455_10008871 3300005937 Bacteria 10397
40 Ga0081455_10046454 3300005937 Bacteria 3766
41 Ga0070717_10000061 3300006028 Bacteria 92257
42 Ga0075363_100007796 3300006048 Bacteria 4947
43 Ga0070712_100000013 3300006175 Bacteria 109912
44 Ga0075430_100063550 3300006846 Bacteria 3100
45 Ga0075430_100181239 3300006846 Bacteria 1752
46 Ga0075431_100026114 3300006847 Bacteria 5990
47 Ga0075434_100335577 3300006871 Unclassified 1532
48 Ga0105240_10117472 3300009093 Bacteria 3206
49 Ga0105240_10273722 3300009093 Bacteria 1943
50 Ga0105245_10000056 3300009098 Bacteria 124109
51 Ga0105245_10001521 3300009098 Bacteria 20984
52 Ga0105248_10000032 3300009177 Bacteria 201114
53 Ga0105238_10058611 3300009551 Bacteria 3859
54 Ga0105238_10196868 3300009551 Bacteria 1991
55 Ga0105249_10000073 3300009553 Bacteria 145660
56 Ga0105239_10051668 3300010375 Bacteria 4505
57 Ga0105239_10057805 3300010375 Bacteria 4255
58 Ga0105239_10106580 3300010375 Bacteria 3105
59 Ga0105246_10036406 3300011119 Bacteria 3296
60 Ga0157371_10041322 3300013102 Bacteria 3291
61 Ga0157370_10007487 3300013104 Bacteria 11859
62 Ga0157369_10000099 3300013105 Bacteria 120032
63 Ga0157374_10397026 3300013296 Unclassified 1375
64 Ga0157378_10060368 3300013297 Bacteria 3384
65 Ga0157372_10000473 3300013307 Bacteria 44380
66 Ga0157372_10154719 3300013307 Bacteria 2648
67 Ga0157380_10000219 3300014326 Bacteria 34156
68 Ga0157376_10023389 3300014969 Bacteria 4835
69 Ga0207656_10000559 3300025321 Bacteria 12340
70 Ga0207682_10000052 3300025893 Bacteria 49191
71 Ga0207692_10000003 3300025898 Bacteria 431531
72 Ga0207680_10002095 3300025903 Bacteria 9346
73 Ga0207680_10008327 3300025903 Bacteria 5082
74 Ga0207680_10019278 3300025903 Bacteria 3645
75 Ga0207705_10050776 3300025909 Bacteria 2986
76 Ga0207695_10057217 3300025913 Bacteria 4052
77 Ga0207695_10181305 3300025913 Bacteria 2026
78 Ga0207693_10000046 3300025915 Bacteria 100888
79 Ga0207663_10003689 3300025916 Bacteria 7528
80 Ga0207657_10074329 3300025919 Bacteria 2870
81 Ga0207657_10106871 3300025919 Bacteria 2315
82 Ga0207649_10000005 3300025920 Bacteria 356179
83 Ga0207652_10000523 3300025921 Bacteria 38967
84 Ga0207652_10126483 3300025921 Bacteria 2277
85 Ga0207687_10000007 3300025927 Bacteria 604185
86 Ga0207687_10000970 3300025927 Bacteria 19492
87 Ga0207690_10000069 3300025932 Bacteria 90520
88 Ga0207670_10028350 3300025936 Bacteria 3554
89 Ga0207711_10000020 3300025941 Bacteria 363325
90 Ga0207711_10271315 3300025941 Bacteria 1561
91 Ga0207679_10010348 3300025945 Bacteria 6002
92 Ga0207712_10000003 3300025961 Bacteria 615314
93 Ga0207640_10000137 3300025981 Bacteria 54133
94 Ga0207640_10008904 3300025981 Bacteria 5593
95 Ga0207703_10000067 3300026035 Bacteria 125623
96 Ga0207639_10001160 3300026041 Bacteria 17875
97 Ga0207678_10000445 3300026067 Bacteria 37602
98 Ga0207678_10042224 3300026067 Bacteria 3952
99 Ga0207702_10000016 3300026078 Bacteria 226633
100 Ga0207683_10005133 3300026121 Bacteria 11241
101 Ga0207698_10000012 3300026142 Bacteria 260061
102 Ga0207698_10008710 3300026142 Bacteria 6432
103 Ga0268266_10000023 3300028379 Bacteria 501899
104 Ga0268266_10000553 3300028379 Bacteria 52199
105 Ga0268266_10003282 3300028379 Bacteria 16272
106 Ga0268266_10164897 3300028379 Bacteria 2006
107 Ga0268266_10243079 3300028379 Bacteria 1662
108 Ga0268264_10162362 3300028381 Unclassified 2014
109 Ga0265326_10000005 3300028558 Bacteria 257124
110 Ga0265334_10000024 3300028573 Bacteria 118525
111 Ga0265338_10002617 3300028800 Bacteria 26582
112 Ga0265324_10000801 3300029957 Bacteria 20607
113 Ga0265327_10043234 3300031251 Bacteria 2413
114 Ga0307409_100145196 3300031995 Bacteria 2051
115 Ga0373937_0300984 3300036401 Bacteria 1516
116 Ga0466957_0003292 3300044842 Bacteria 8849
117 Ga0466967_0000344 3300045976 Bacteria 21424
118 Ga0466967_0016029 3300045976 Bacteria 5895
119 Ga0466967_0252878 3300045976 Unclassified 1684
120 Ga0495629_0017940 3300046459 Bacteria 5073
121 Ga0495641_0001080 3300046461 Bacteria 23509
122 Ga0495641_0022727 3300046461 Bacteria 3132
123 Ga0495641_0034960 3300046461 Bacteria 2372
124 Ga0495582_0030119 3300046473 Bacteria 2978
125 Ga0495662_0005879 3300046476 Bacteria 6135
126 Ga0495606_0000211 3300046507 Bacteria 103386
127 Ga0495608_0042926 3300046511 Bacteria 3023
128 Ga0495610_0058825 3300046512 Bacteria 1837
129 Ga0495620_0000315 3300046515 Bacteria 34463
130 Ga0495628_0000170 3300046516 Bacteria 56830
131 Ga0495630_0000025 3300046517 Bacteria 152364
132 Ga0495630_0000548 3300046517 Bacteria 27475
133 Ga0495630_0014637 3300046517 Bacteria 5717
134 Ga0495666_0024018 3300046526 Bacteria 3015
135 Ga0495652_0000018 3300046529 Bacteria 201634
136 Ga0495652_0008276 3300046529 Bacteria 9507
137 Ga0495587_0001931 3300046536 Bacteria 13803
138 Ga0495645_0017534 3300046543 Bacteria 5129
139 Ga0495645_0025204 3300046543 Bacteria 4315
140 Ga0495667_0000015 3300046559 Bacteria 200377
141 Ga0495667_0166305 3300046559 Unclassified 1418
142 Ga0495634_0000592 3300046642 Bacteria 35197
143 Ga0495634_0016468 3300046642 Bacteria 5288
144 Ga0495635_0009609 3300046663 Bacteria 6762
145 Ga0495588_0000311 3300046674 Bacteria 33416
146 Ga0495657_0000006 3300046675 Bacteria 250610
147 Ga0495657_0019635 3300046675 Bacteria 4874
148 Ga0495647_0000037 3300046681 Bacteria 42482
149 Ga0495647_0000289 3300046681 Bacteria 14023
150 Ga0495658_0010179 3300046683 Bacteria 4701
151 Ga0495624_0000028 3300046690 Bacteria 93474
152 Ga0495624_0000686 3300046690 Bacteria 26537
153 Ga0495676_0059751 3300047321 Unclassified 2992
154 Ga0495676_0077855 3300047321 Bacteria 2527
155 Ga0495680_0000421 3300047322 Bacteria 47432
156 Ga0495680_0001079 3300047322 Bacteria 30239
157 Ga0495686_0000020 3300047472 Bacteria 429191
158 Ga0495593_0072908 3300047673 Unclassified 1782
159 Ga0495602_0000364 3300048088 Bacteria 42346
160 Ga0495602_0178416 3300048088 Unclassified 1641
161 Ga0496100_0000392 3300048903 Bacteria 21271
162 Ga0496101_0003096 3300048904 Bacteria 10287
163 Ga0496102_0009403 3300048905 Bacteria 8400
164 Ga0496102_0117842 3300048905 Bacteria 2478
165 Ga0496102_0231527 3300048905 Unclassified 1742
166 Ga0496104_0012516 3300048907 Bacteria 7629
167 Ga0496104_0018901 3300048907 Bacteria 6294
168 Ga0496105_0000848 3300048908 Bacteria 20845
169 Ga0496108_0000599 3300048911 Bacteria 28272
170 Ga0496108_0021107 3300048911 Bacteria 5351
171 Ga0496108_0041149 3300048911 Bacteria 3856
172 Ga0496108_0062983 3300048911 Bacteria 3123
173 Ga0496109_0000252 3300048912 Bacteria 51599
174 Ga0496109_0001762 3300048912 Bacteria 17990
175 Ga0496109_0006800 3300048912 Bacteria 9636
176 Ga0496110_0000386 3300048913 Bacteria 29667
177 Ga0496110_0001522 3300048913 Bacteria 16827
178 Ga0496110_0040710 3300048913 Bacteria 4051
179 Ga0496111_0000225 3300048914 Bacteria 26948
180 Ga0496111_0002432 3300048914 Bacteria 11239
181 Ga0496112_0000013 3300048915 Bacteria 237194
182 Ga0496112_0000095 3300048915 Bacteria 57431
183 Ga0496112_0000362 3300048915 Bacteria 29649
184 Ga0496112_0003640 3300048915 Bacteria 12838
185 Ga0496112_0076733 3300048915 Bacteria 3305
186 Ga0496113_0000127 3300048916 Bacteria 33059
187 Ga0496113_0035195 3300048916 Bacteria 3661
188 Ga0496113_0071532 3300048916 Bacteria 2638
189 Ga0496114_0032906 3300048917 Bacteria 4270
190 Ga0496114_0228846 3300048917 Unclassified 1633
191 Ga0496116_0000447 3300048919 Bacteria 57650
192 Ga0496117_0001787 3300048920 Bacteria 29372
193 Ga0496117_0048935 3300048920 Bacteria 3013
194 Ga0496118_0000971 3300048921 Bacteria 44781
195 Ga0496119_0000432 3300048922 Bacteria 57656
196 Ga0496119_0002987 3300048922 Bacteria 17953
197 Ga0496119_0021819 3300048922 Bacteria 4610
198 Ga0496119_0022620 3300048922 Bacteria 4492
199 Ga0496120_0004598 3300048923 Bacteria 11476
200 Ga0496121_0009948 3300048924 Bacteria 10825
201 Ga0496121_0010860 3300048924 Bacteria 10183
202 Ga0496125_0023368 3300048928 Bacteria 5707
203 Ga0496125_0032004 3300048928 Bacteria 4678
204 Ga0501031_0011404 3300049568 Bacteria 5786
205 Ga0501032_0013973 3300049569 Bacteria 5696
206 Ga0501032_0154713 3300049569 Bacteria 1507
207 Ga0501033_0002182 3300049570 Bacteria 16893
208 Ga0501034_0026016 3300049571 Bacteria 5960
209 Ga0501034_0103344 3300049571 Bacteria 2843
210 Ga0501036_0019236 3300049572 Bacteria 5729
211 Ga0501037_0015089 3300049573 Bacteria 5681
212 Ga0501038_0047373 3300049574 Bacteria 3723
213 Ga0501039_0016002 3300049575 Bacteria 5744
214 Ga0501043_0017752 3300049579 Bacteria 5578
215 Ga0501043_0064733 3300049579 Bacteria 2871
216 Ga0501046_0018485 3300049580 Bacteria 5798
217 Ga0501047_0002662 3300049581 Bacteria 16994
218 Ga0501047_0022089 3300049581 Bacteria 6112
219 Ga0501047_0026105 3300049581 Bacteria 5618
220 Ga0501048_0015101 3300049582 Bacteria 5706
221 Ga0501068_0022145 3300049584 Bacteria 3713
222 Ga0501068_0096694 3300049584 Unclassified 1827
223 Ga0501069_0012803 3300049585 Bacteria 4465
224 Ga0501070_0002268 3300049586 Bacteria 16901
225 Ga0501071_0080215 3300049587 Bacteria 2386
226 Ga0501072_0017794 3300049588 Bacteria 5465
227 Ga0501073_0003176 3300049589 Bacteria 12327
228 Ga0501074_0016275 3300049590 Bacteria 5400
229 Ga0501074_0032533 3300049590 Bacteria 3778
230 Ga0501074_0050817 3300049590 Unclassified 2992
231 Ga0501079_0017114 3300049741 Bacteria 5536
232 Ga0501080_0094264 3300049742 Unclassified 2780
233 Ga0501083_0035624 3300049744 Bacteria 3398
234 Ga0501083_0062463 3300049744 Bacteria 2485
235 Ga0501035_0002777 3300049822 Bacteria 16952
236 Ga0501044_0009059 3300049823 Bacteria 10877
237 Ga0501044_0016674 3300049823 Bacteria 7888
238 Ga0501045_0014626 3300049824 Bacteria 5564
239 nmdc:mga03n38_7213_c1 3300050490 Bacteria 3919
240 nmdc:mga0qj67_20605_c1 3300050509 Bacteria 5051
241 Ga0495601_0000086 3300053077 Bacteria 50421
242 Ga0495612_0010338 3300053078 Bacteria 3777
243 Ga0495612_0048408 3300053078 Bacteria 1743
244 Ga0495619_0000022 3300053085 Bacteria 184144
245 Ga0495619_0001988 3300053085 Bacteria 13616
246 Ga0495619_0087761 3300053085 Bacteria 2103
247 Ga0500614_000389 3300053123 Bacteria 11425
248 2829747269 2829745981 Bacteria 5406054
249 Ga0070663_100000351
250 Ga0070658_10180663
251 Ga0070677_10000003
252 Ga0070666_10046278
253 Ga0070682_100000080
254 Ga0070660_100012354
255 Ga0070660_100060707
256 Ga0070689_100039557
257 Ga0070661_100000005
258 Ga0070669_100049623
259 Ga0070688_100002150
260 Ga0070688_100080637
261 Ga0070659_100000176
262 Ga0070667_100096572
263 Ga0070710_10000013
264 Ga0070678_100031711
265 Ga0070685_10000293
266 Ga0070679_100000621
267 Ga0070679_100156979
268 Ga0070684_100010988
269 Ga0070684_100272442
270 Ga0068853_100017989
271 Ga0070665_100000159
272 Ga0070665_100038015
273 Ga0070665_100270192
274 Ga0070665_100283038
275 Ga0070664_100017602
276 Ga0068854_100001309
277 Ga0068854_100012477
278 Ga0068856_100001818
279 Ga0068856_100061013
280 Ga0068852_100000012
281 Ga0068852_100012338
282 Ga0068864_100135206
283 Ga0068851_10000988
284 Ga0068851_10003390
285 Ga0068858_100000049
286 Ga0068860_100134907
287 Ga0081455_10008871
288 Ga0081455_10046454
289 Ga0070717_10000061
290 Ga0075363_100007796
291 Ga0070712_100000013
292 Ga0075430_100063550
293 Ga0075430_100181239
294 Ga0075431_100026114
295 Ga0075434_100335577
296 Ga0105240_10117472
297 Ga0105240_10273722
298 Ga0105245_10000056
299 Ga0105245_10001521
300 Ga0105248_10000032
301 Ga0105238_10058611
302 Ga0105238_10196868
303 Ga0105249_10000073
304 Ga0105239_10051668
305 Ga0105239_10057805
306 Ga0105239_10106580
307 Ga0105246_10036406
308 Ga0157371_10041322
309 Ga0157370_10007487
310 Ga0157369_10000099
311 Ga0157374_10397026
312 Ga0157378_10060368
313 Ga0157372_10000473
314 Ga0157372_10154719
315 Ga0157380_10000219
316 Ga0157376_10023389
317 Ga0207656_10000559
318 Ga0207682_10000052
319 Ga0207692_10000003
320 Ga0207680_10002095
321 Ga0207680_10008327
322 Ga0207680_10019278
323 Ga0207705_10050776
324 Ga0207695_10057217
325 Ga0207695_10181305
326 Ga0207693_10000046
327 Ga0207663_10003689
328 Ga0207657_10074329
329 Ga0207657_10106871
330 Ga0207649_10000005
331 Ga0207652_10000523
332 Ga0207652_10126483
333 Ga0207687_10000007
334 Ga0207687_10000970
335 Ga0207690_10000069
336 Ga0207670_10028350
337 Ga0207711_10000020
338 Ga0207711_10271315
339 Ga0207679_10010348
340 Ga0207712_10000003
341 Ga0207640_10000137
342 Ga0207640_10008904
343 Ga0207703_10000067
344 Ga0207639_10001160
345 Ga0207678_10000445
346 Ga0207678_10042224
347 Ga0207702_10000016
348 Ga0207683_10005133
349 Ga0207698_10000012
350 Ga0207698_10008710
351 Ga0268266_10000023
352 Ga0268266_10000553
353 Ga0268266_10003282
354 Ga0268266_10164897
355 Ga0268266_10243079
356 Ga0268264_10162362
357 Ga0265326_10000005
358 Ga0265334_10000024
359 Ga0265338_10002617
360 Ga0265324_10000801
361 Ga0265327_10043234
362 Ga0307409_100145196
363 Ga0373937_0300984
364 Ga0466957_0003292
365 Ga0466967_0000344
366 Ga0466967_0016029
367 Ga0466967_0252878
368 Ga0495629_0017940
369 Ga0495641_0001080
370 Ga0495641_0022727
371 Ga0495641_0034960
372 Ga0495582_0030119
373 Ga0495662_0005879
374 Ga0495606_0000211
375 Ga0495608_0042926
376 Ga0495610_0058825
377 Ga0495620_0000315
378 Ga0495628_0000170
379 Ga0495630_0000025
380 Ga0495630_0000548
381 Ga0495630_0014637
382 Ga0495666_0024018
383 Ga0495652_0000018
384 Ga0495652_0008276
385 Ga0495587_0001931
386 Ga0495645_0017534
387 Ga0495645_0025204
388 Ga0495667_0000015
389 Ga0495667_0166305
390 Ga0495634_0000592
391 Ga0495634_0016468
392 Ga0495635_0009609
393 Ga0495588_0000311
394 Ga0495657_0000006
395 Ga0495657_0019635
396 Ga0495647_0000037
397 Ga0495647_0000289
398 Ga0495658_0010179
399 Ga0495624_0000028
400 Ga0495624_0000686
401 Ga0495676_0059751
402 Ga0495676_0077855
403 Ga0495680_0000421
404 Ga0495680_0001079
405 Ga0495686_0000020
406 Ga0495593_0072908
407 Ga0495602_0000364
408 Ga0495602_0178416
409 Ga0496100_0000392
410 Ga0496101_0003096
411 Ga0496102_0009403
412 Ga0496102_0117842
413 Ga0496102_0231527
414 Ga0496104_0012516
415 Ga0496104_0018901
416 Ga0496105_0000848
417 Ga0496108_0000599
418 Ga0496108_0021107
419 Ga0496108_0041149
420 Ga0496108_0062983
421 Ga0496109_0000252
422 Ga0496109_0001762
423 Ga0496109_0006800
424 Ga0496110_0000386
425 Ga0496110_0001522
426 Ga0496110_0040710
427 Ga0496111_0000225
428 Ga0496111_0002432
429 Ga0496112_0000013
430 Ga0496112_0000095
431 Ga0496112_0000362
432 Ga0496112_0003640
433 Ga0496112_0076733
434 Ga0496113_0000127
435 Ga0496113_0035195
436 Ga0496113_0071532
437 Ga0496114_0032906
438 Ga0496114_0228846
439 Ga0496116_0000447
440 Ga0496117_0001787
441 Ga0496117_0048935
442 Ga0496118_0000971
443 Ga0496119_0000432
444 Ga0496119_0002987
445 Ga0496119_0021819
446 Ga0496119_0022620
447 Ga0496120_0004598
448 Ga0496121_0009948
449 Ga0496121_0010860
450 Ga0496125_0023368
451 Ga0496125_0032004
452 Ga0501031_0011404
453 Ga0501032_0013973
454 Ga0501032_0154713
455 Ga0501033_0002182
456 Ga0501034_0026016
457 Ga0501034_0103344
458 Ga0501036_0019236
459 Ga0501037_0015089
460 Ga0501038_0047373
461 Ga0501039_0016002
462 Ga0501043_0017752
463 Ga0501043_0064733
464 Ga0501046_0018485
465 Ga0501047_0002662
466 Ga0501047_0022089
467 Ga0501047_0026105
468 Ga0501048_0015101
469 Ga0501068_0022145
470 Ga0501068_0096694
471 Ga0501069_0012803
472 Ga0501070_0002268
473 Ga0501071_0080215
474 Ga0501072_0017794
475 Ga0501073_0003176
476 Ga0501074_0016275
477 Ga0501074_0032533
478 Ga0501074_0050817
479 Ga0501079_0017114
480 Ga0501080_0094264
481 Ga0501083_0035624
482 Ga0501083_0062463
483 Ga0501035_0002777
484 Ga0501044_0009059
485 Ga0501044_0016674
486 Ga0501045_0014626
487 nmdc:mga03n38_7213_c1
488 nmdc:mga0qj67_20605_c1
489 Ga0495601_0000086
490 Ga0495612_0010338
491 Ga0495612_0048408
492 Ga0495619_0000022
493 Ga0495619_0001988
494 Ga0495619_0087761
495 Ga0500614_000389
496 2829747269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

19

52

0.96

PF00890

FAD_binding_2

FAD binding domain

16

63

0.94

PF12831

FAD_oxidored

FAD dependent oxidoreductase

16

193

0.79

PF01494

FAD_binding_3

FAD binding domain

14

355

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bk1-assembly1.cif.gz_A mutant imine reductase ir007-143 from amycolatopsis azurea, e120a, m197w, m206s, a213p, d238g, i240l 0.9438 19 47
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9437 17 47
6eoh-assembly1.cif.gz_B reductive aminase from aspergillus terreus in complex with nadph and ethyl levulinate 0.934 17 47
6eod-assembly3.cif.gz_D structure of reductive aminase from aspergillus terreus in complex with nadph 0.9323 17 47
6eod-assembly4.cif.gz_E structure of reductive aminase from aspergillus terreus in complex with nadph 0.932 17 47
ID Description Score Start End Superfamily
1djnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9587 17 48 3.40.50.720
af_K8F7V7_1826_1944_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9509 19 50 3.50.50.60
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 18 47 3.40.50.720
af_Q46811_547_618_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9467 20 50 3.40.50.720
af_M9NFH8_1768_1873_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9432 19 50 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A254TER4-F1-model_v4 FAD-binding domain-containing protein 0.9672 17 419 GO:0071949
AF-A0A6G2VC59-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9638 15 416 GO:0071949
AF-A0A7W7LYT0-F1-model_v4 2-polyprenyl-6-methoxyphenol hydroxylase-like FAD-dependent oxidoreductase 0.9585 17 418 GO:0071949
AF-A0A5M3XLF7-F1-model_v4 FAD-dependent oxidoreductase 0.9574 23 411 GO:0071949
AF-A0A0T1Q8E2-F1-model_v4 Monooxygenase 0.9562 22 418 GO:0004497
GO:0071949

Map